Development of a Monoclonal Antibody-Based Sandwich ELISA for Peanut Allergen Ara h 1 in Food
Directory of Open Access Journals (Sweden)
Chuanlai Xu
2013-07-01
Full Text Available We have established a highly sensitive sandwich enzyme-linked immunosorbent assay (ELISA based on two monoclonal antibodies (mAb to measure the content of the major peanut allergen Ara h 1 in foods. Two mAbs were selected out of 12 murine hybridoma cells secreting Ara h 1-specific antibody. Using mAb 6 as the capture antibody and HRP-labelled mAb 4 as the detection antibody, the limit of detection (LOD the assay was 0.34 ng/mL. Cross-reaction analysis showed that this method was strongly specific and had no cross-reactions with Ara h 2, pea protein or soy protein. Sample analysis showed that this ELISA was a useful tool to monitor peanut allergens in food products by measuring Ara h 1 content.
Crystal structures of CCa2CuO5 and CSr1.9Ca1.1Cu2O7 refined from single crystal data
International Nuclear Information System (INIS)
Kopnin, E.M.; Matveev, A.T.; Salamakha, P.S.; Sato, A.; Takayama-Muromachi, E.
2003-01-01
Single crystals were grown for new layered oxycarbonates CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7 at 6 GPa using a belt-type apparatus. Their crystal structures were determined using single crystal X-ray diffraction data with R1(wR2)=0.0294(0.0659) and 0.0199(0.0457) for CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7 , respectively. These phases crystallize in the space group P4/mmm (No. 123), Z=1 with a=3.8157(1) Angst, c=7.1426(3) Angst for CCa 2 CuO 5 and a=3.8753(1) Angst, c=10.6765(5) Angst for CSr 1.9 Ca 1.1 Cu 2 O 7 . In contrast to CSr 2 CuO 5 , no ordering in the orientation of the triangular CO 3 groups was revealed in CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7
Analysis list: mab-5 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available mab-5 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/m...ab-5.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/mab-5.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/ce10/target/mab-5.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/mab-5.Embryo.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/ce10/colo/mab-5.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...
Directory of Open Access Journals (Sweden)
Mikelsaar Aavo-Valdur
2012-09-01
Full Text Available Abstract Background Previously we have reported on the development of a new mouse anti-titin monoclonal antibody, named MAb Titl 5 H1.1, using the synthetic peptide N-AVNKYGIGEPLESDSVVAK-C which corresponds to an amino acid sequence in the A-region of the titin molecule as immunogen. In the human skeletal muscles, MAb Titl 5 H1.1 reacts specifically with titin in the A-band of the sarcomere and in different non-muscle cell types with nucleus and cytoplasm, including centrioles. In this report we have studied the evolutionary aspects of the binding of MAb Tit1 5 H1.1 with its target antigen (titin. Results We have specified the epitope area of MAb Tit1 5 H1.1 by subpeptide mapping to the hexapeptide N-AVNKYG-C. According to protein databases this amino acid sequence is located in the COOH-terminus of several different Fn3 domains of the A-region of titin molecule in many organisms, such as human being, mouse, rabbit, zebrafish (Danio rerio, and even in sea squirt (Ciona intestinalis. Our immunohisto- and cytochemical studies with MAb Tit1 5 H1.1 in human, mouse and zebrafish tissues and cell cultures showed a striated staining pattern in muscle cells and also staining of centrioles, cytoplasm and nuclei in non-muscle cells. Conclusions The data confirm that titin can play, in addition to the known roles in striated muscle cells also an important role in non-muscle cells as a centriole associated protein. This phenomenon is highly conserved in the evolution and is related to Fn3 domains of the titin molecule. Using titin A-band-specific monoclonal antibody MAb Tit1 5 H1.1 it was possible to locate titin in the sarcomeres of skeletal muscle cells and in the centrioles, cytoplasm and nuclei of non-muscle cells in phylogenetically so distant organisms as Homo sapiens, Mus musculus and zebrafish (Danio rerio.
Liu, Nan-Nan; Xue, Ying-Ying; Ding, Yi-Hong
2017-02-09
[5]Radialene, the missing link for synthesis of radialene family, has been finally obtained via the preparation and decomplexation of the [5]radialene-bis-Fe(CO) 3 complex. The stability of [5]radialene complex benefits from the coordination with Fe(CO) 3 by losing free 1,3-butadiene structures to avoid polymerization. In light of the similar coordination ability of half-sandwiches CpM(Cp = η 5 -C 5 H 5 ; M = Fe, Co, Ni), there is a great possibility that the sandwiched complexes of [5]radialene with CpM are available. Herein, we present the first theoretical prediction on the geometry, spin states and bonding of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ). For M = Fe, Co, Ni, the ground states of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ) are doublet and triplet, singlet and singlet, and doublet and triplet states, where each Fe, Co, and Ni adopts 17, 18, and 19 electron-configuration, respectively. In particular, (CpFe) 2 (C 10 H 10 ) and (CpNi) 2 (C 10 H 10 ) have considerable open-shell singlet features. Generally the trans isomers of (CpM) 2 (C 10 H 10 ) with two CpM fragments on the opposite sides of the [5]radialene plane are apparently more stable than the cis ones with CpM fragments on the same side. However, for the singlet and triplet isomers of (CpNi) 2 (C 10 H 10 ) (both cis and trans isomers), the energy differences are relatively small, indicating that these isomers all have the opportunity to exist. Besides, the easy Diels-Alder (DA) dimerization between the [3]dendralene-like fragments of (CpM)(C 10 H 10 ) suggests the great difficulty in isolating the (CpM)(C 10 H 10 ) monomer.
CSMA/CCA: A Modified CSMA/CA Protocol Mitigating the Fairness Problem for IEEE 802.11 DCF
Directory of Open Access Journals (Sweden)
Wang Xin
2006-01-01
Full Text Available Carrier sense multiple access with collision avoidance (CSMA/CA has been adopted by the IEEE 802.11 standards for wireless local area networks (WLANs. Using a distributed coordination function (DCF, the CSMA/CA protocol reduces collisions and improves the overall throughput. To mitigate fairness issues arising with CSMA/CA, we develop a modified version that we term CSMA with copying collision avoidance (CSMA/CCA. A station in CSMA/CCA contends for the shared wireless medium by employing a binary exponential backoff similar to CSMA/CA. Different from CSMA/CA, CSMA/CCA copies the contention window (CW size piggybacked in the MAC header of an overheard data frame within its basic service set (BSS and updates its backoff counter according to the new CW size. Simulations carried out in several WLAN configurations illustrate that CSMA/CCA improves fairness relative to CSMA/CA and offers considerable advantages for deployment in the 802.11-standard-based WLANs.
Development of an Anti-HER2 Monoclonal Antibody H2Mab-139 Against Colon Cancer.
Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Kato, Yukinari
2018-02-01
Human epidermal growth factor receptor 2 (HER2) expression has been reported in several cancers, such as breast, gastric, lung, pancreatic, and colorectal cancers. HER2 is overexpressed in those cancers and is associated with poor clinical outcomes. Trastuzumab, a humanized anti-HER2 antibody, provides significant survival benefits for patients with HER2-overexpressing breast cancers and gastric cancers. In this study, we developed a novel anti-HER2 monoclonal antibody (mAb), H 2 Mab-139 (IgG 1 , kappa) and investigated it against colon cancers using flow cytometry, western blot, and immunohistochemical analyses. Flow cytometry analysis revealed that H 2 Mab-139 reacted with colon cancer cell lines, such as Caco-2, HCT-116, HCT-15, HT-29, LS 174T, COLO 201, COLO 205, HCT-8, SW1116, and DLD-1. Although H 2 Mab-139 strongly reacted with LN229/HER2 cells on the western blot, we did not observe a specific signal for HER2 in colon cancer cell lines. Immunohistochemical analyses revealed sensitive and specific reactions of H 2 Mab-139 against colon cancers, indicating that H 2 Mab-139 is useful in detecting HER2 overexpression in colon cancers using flow cytometry and immunohistochemical analyses.
Extractive decontamination of heavy metals from CCA contaminated ...
African Journals Online (AJOL)
In this paper, the mobilization and extraction of As, Cr and Cu from chromated copper arsenate (CCA) contaminated soil obtained from a wood treatment factory site by four organic acids are presented and discussed. The CCA contaminated soil (pH = 5.91, carbon = 0.32, CEC = 47.84 meq/100 g) was found to contain 39.55 ...
International Nuclear Information System (INIS)
Watanabe, N.; Gunma Univ. School of Medicine; Oriuchi, N.; Inoue, T.; Sugiyama, S.; Kuroki, M.; Matsuoka, Y.; Tanada, S.; Murata, H.; Sasaki, Y.
1999-01-01
Aim: The purpose of this study was to assess the potential for radioimmunodetection (RAID) of murine anti-carcinoembryonic antigen (CEA) monoclonal antibody (MAb) F33-104 labeled with technetium-99m (99m-Tc) by a reduction-mediated labeling method. Methods: The binding capacity of 99m-Tc-labeled anti-CEA MAb F33-104 with CEA by means of in vitro procedures such as immunoradiometric assay and cell binding assay and the biodistribution of 99m-Tc-labeled anti-CEA MAb F33-104 in normal nude mice and nude mice bearing human colon adenocarcinoma LS180 tumor were investigated and compared with 99m-Tc-labeled anti-CEA MAb BW431/26. Results: The in vitro binding rate of 99m-Tc-labeled anti-CEA MAb F33-104 with CEA in solution and attached to the cell membrane was significantly higher than 99m-Tc-labeled anti-CEA MAb BW431/261 (31.4 ± 0.95% vs. 11.9 ± 0.55% at 100 ng/mL of soluble CEA, 83.5 ± 2.84% vs. 54.0 ± 2.54% at 10 7 of LS 180 cells). In vivo, accumulation of 99m-Tc-labeled anti-CEA MAb F33-104 was higher at 18 h postinjection than 99m-Tc-labeled anti-CEA MAb BW431/26 (20.1 ± 3.50% ID/g vs. 14.4 ± 3.30% ID/g). 99m-Tc-activity in the kidneys of nude mice bearing tumor was higher at 18 h postinjection than at 3 h (12.8 ± 2.10% ID/g vs. 8.01 ± 2.40% ID/g of 99m-Tc-labeled anti-CEA MAb F33-104, 10.7 ± 1.70% ID/g vs. 8.10 ± 1.75% ID/g of 99m-Tc-labeled anti-CEA MAb BW431/26). Conclusion: 99m-Tc-labeled anti-CEA MAb F33-104 is a potential novel agent for RAID of recurrent colorectal cancer. (orig.) [de
H2Mab-77 is a Sensitive and Specific Anti-HER2 Monoclonal Antibody Against Breast Cancer.
Itai, Shunsuke; Fujii, Yuki; Kaneko, Mika K; Yamada, Shinji; Nakamura, Takuro; Yanaka, Miyuki; Saidoh, Noriko; Chang, Yao-Wen; Handa, Saori; Takahashi, Maki; Suzuki, Hiroyoshi; Harada, Hiroyuki; Kato, Yukinari
2017-08-01
Human epidermal growth factor receptor 2 (HER2) plays a critical role in the progression of breast cancers, and HER2 overexpression is associated with poor clinical outcomes. Trastuzumab is an anti-HER2 humanized antibody that leads to significant survival benefits in patients with HER2-positive metastatic breast cancers. In this study, we developed novel anti-HER2 monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. Initially, we expressed the full length or ectodomain of HER2 in LN229 glioblastoma cells and then immunized mice with ectodomain of HER2 or LN229/HER2, and performed the first screening by enzyme-linked immunosorbent assays using ectodomain of HER2. Subsequently, we selected mAbs according to their efficacy in flow cytometry (second screening), Western blot (third screening), and immunohistochemical analyses (fourth screening). Among 100 mAb clones, only three mAbs reacted with HER2 in Western blot, and clone H 2 Mab-77 (IgG 1 , kappa) was selected. Finally, immunohistochemical analyses with H 2 Mab-77 showed sensitive and specific reactions against breast cancer cells, warranting the use of H 2 Mab-77 to detect HER2 in pathological analyses of breast cancers.
LWD–TCP complex activates the morning gene CCA1 in Arabidopsis
Wu, Jing-Fen; Tsai, Huang-Lung; Joanito, Ignasius; Wu, Yi-Chen; Chang, Chin-Wen; Li, Yi-Hang; Wang, Ying; Hong, Jong Chan; Chu, Jhih-Wei; Hsu, Chao-Ping; Wu, Shu-Hsing
2016-01-01
A double-negative feedback loop formed by the morning genes CIRCADIAN CLOCK ASSOCIATED1 (CCA1)/LATE ELONGATED HYPOCOTYL (LHY) and the evening gene TIMING OF CAB EXPRESSION1 (TOC1) contributes to regulation of the circadian clock in Arabidopsis. A 24-h circadian cycle starts with the peak expression of CCA1 at dawn. Although CCA1 is targeted by multiple transcriptional repressors, including PSEUDO-RESPONSE REGULATOR9 (PRR9), PRR7, PRR5 and CCA1 HIKING EXPEDITION (CHE), activators of CCA1 remain elusive. Here we use mathematical modelling to infer a co-activator role for LIGHT-REGULATED WD1 (LWD1) in CCA1 expression. We show that the TEOSINTE BRANCHED 1-CYCLOIDEA-PCF20 (TCP20) and TCP22 proteins act as LWD-interacting transcriptional activators. The concomitant binding of LWD1 and TCP20/TCP22 to the TCP-binding site in the CCA1 promoter activates CCA1. Our study reveals activators of the morning gene CCA1 and provides an action mechanism that ensures elevated expression of CCA1 at dawn to sustain a robust clock. PMID:27734958
LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
Wu, Jing-Fen; Tsai, Huang-Lung; Joanito, Ignasius; Wu, Yi-Chen; Chang, Chin-Wen; Li, Yi-Hang; Wang, Ying; Hong, Jong Chan; Chu, Jhih-Wei; Hsu, Chao-Ping; Wu, Shu-Hsing
2016-10-13
A double-negative feedback loop formed by the morning genes CIRCADIAN CLOCK ASSOCIATED1 (CCA1)/LATE ELONGATED HYPOCOTYL (LHY) and the evening gene TIMING OF CAB EXPRESSION1 (TOC1) contributes to regulation of the circadian clock in Arabidopsis. A 24-h circadian cycle starts with the peak expression of CCA1 at dawn. Although CCA1 is targeted by multiple transcriptional repressors, including PSEUDO-RESPONSE REGULATOR9 (PRR9), PRR7, PRR5 and CCA1 HIKING EXPEDITION (CHE), activators of CCA1 remain elusive. Here we use mathematical modelling to infer a co-activator role for LIGHT-REGULATED WD1 (LWD1) in CCA1 expression. We show that the TEOSINTE BRANCHED 1-CYCLOIDEA-PCF20 (TCP20) and TCP22 proteins act as LWD-interacting transcriptional activators. The concomitant binding of LWD1 and TCP20/TCP22 to the TCP-binding site in the CCA1 promoter activates CCA1. Our study reveals activators of the morning gene CCA1 and provides an action mechanism that ensures elevated expression of CCA1 at dawn to sustain a robust clock.
Takahashi, Hitoshi; Nagata, Shiho; Odagiri, Takato; Kageyama, Tsutomu
2018-04-15
The H5 subtype of highly pathogenic avian influenza (H5 HPAI) viruses is a threat to both animal and human public health and has the potential to cause a serious future pandemic in humans. Thus, specific and rapid detection of H5 HPAI viruses is required for infection control in humans. To develop a simple and rapid diagnostic system to detect H5 HPAI viruses with high specificity and sensitivity, we attempted to prepare monoclonal antibodies (mAbs) that specifically recognize linear epitopes in hemagglutinin (HA) of H5 subtype viruses. Nine mAb clones were obtained from mice immunized with a synthetic partial peptide of H5 HA molecules conserved among various H5 HPAI viruses. The antigen-capture enzyme-linked immunosorbent assay using the most suitable combination of these mAbs, which bound specifically to lysed H5 HA under an optimized detergent condition, was specific for H5 viruses and could broadly detect H5 viruses in multiple different clades. Taken together, these peptide mAbs, which recognize linear epitopes in a highly conserved region of H5 HA, may be useful for specific and highly sensitive detection of H5 HPAI viruses and can help in the rapid diagnosis of human, avian, and animal H5 virus infections. Copyright © 2018 Elsevier Inc. All rights reserved.
Development of monoclonal antibody-based sandwich ELISA for detection of dextran.
Wang, Sheng-Yu; Li, Zhe; Wang, Xian-Jiang; Lv, Sha; Yang, Yun; Zeng, Lian-Qiang; Luo, Fang-Hong; Yan, Jiang-Hua; Liang, Da-Feng
2014-10-01
Dextran as anti-nutritional factor is usually a result of bacteria activity and has associated serial problems during the process stream in the sugar industry and in medical therapy. A sensitive method is expected to detect dextran quantitatively. Here we generated four monoclonal antibodies (MAbs) against dextran using dextran T40 conjugated with bovine serum albumin (BSA) as immunogen in our lab following hybridoma protocol. Through pairwise, an MAb named D24 was determined to be conjugated with horseradish peroxidase (HRP) and was used in the establishment of a sensitive sandwich enzyme-linked immunosorbent assay (ELISA) method for determination of dextran, in which MAb D9 was chosen as a capture antibody. The detection limit and working scope of the developed sandwich ELISA method were 3.9 ng/mL and 7.8-500 ng/mL with a correlation coefficient of 0.9909. In addition, the cross-reaction assay demonstrated that the method possessed high specificity with no significant cross-reaction with dextran-related substances, and the recovery rate ranged from 96.35 to 102.00%, with coefficient of variation ranging from 1.58 to 6.94%. These results indicated that we developed a detection system of MAb-based sandwich ELISA to measure dextran and this system should be a potential tool to determine dextran levels.
LpMab-23: A Cancer-Specific Monoclonal Antibody Against Human Podoplanin.
Yamada, Shinji; Ogasawara, Satoshi; Kaneko, Mika K; Kato, Yukinari
2017-04-01
Human podoplanin (hPDPN), the ligand of C-type lectin-like receptor-2, is involved in cancer metastasis. Until now, many monoclonal antibodies (mAbs) have been established against hPDPN. However, it is still difficult to develop a cancer-specific mAb (CasMab) against hPDPN because the protein sequence of hPDPN expressed in cancer cells is the same as that in normal cells. Herein, we report LpMab-23 of the mouse IgG 1 subclass, a novel CasMab against hPDPN. In an immunohistochemical analysis, LpMab-23 reacted with tumor cells of human oral cancer, but did not react with normal cells such as lymphatic endothelial cells (LECs). In contrast, LpMab-17, another anti-hPDPN mAb, reacted with both tumor cells and LECs. Furthermore, flow cytometric analysis revealed that LpMab-23 reacted with hPDPN-expressing cancer cell lines (LN319, RERF-LC-AI/hPDPN, Y-MESO-14/hPDPN, and HSC3/hPDPN) but showed little reaction with normal cells (LECs and HEK-293T), although another anti-hPDPN mAb, LpMab-7, reacted with both hPDPN-expressing cancer cells and normal cells, indicating that LpMab-23 is a CasMab against hPDPN.
Directory of Open Access Journals (Sweden)
Yukinari Kato
Full Text Available Podoplanin (PDPN, also known as Aggrus, possesses three tandem repeat of platelet aggregation-stimulating (PLAG domains in its N-terminus. Among the PLAG domains, sialylated O-glycan on Thr52 of PLAG3 is essential for the binding to C-type lectin-like receptor-2 (CLEC-2 and the platelet-aggregating activity of human PDPN (hPDPN. Although various anti-hPDPN monoclonal antibodies (mAbs have been generated, no specific mAb has been reported to target the epitope containing glycosylated Thr52. We recently established CasMab technology to develop mAbs against glycosylated membrane proteins. Herein, we report the development of a novel anti-glycopeptide mAb (GpMab, LpMab-12. LpMab-12 detected endogenous hPDPN by flow cytometry. Immunohistochemical analyses also showed that hPDPN-expressing lymphatic endothelial and cancer cells were clearly labeled by LpMab-12. The minimal epitope of LpMab-12 was identified as Asp49-Pro53 of hPDPN. Furthermore, LpMab-12 reacted with the synthetic glycopeptide of hPDPN, corresponding to 38-54 amino acids (hpp3854: 38-EGGVAMPGAEDDVVTPG-54, which carries α2-6 sialylated N-acetyl-D-galactosamine (GalNAc on Thr52. LpMab-12 did not recognize non-sialylated GalNAc-attached glycopeptide, indicating that sialylated GalNAc on Thr52 is necessary for the binding of LpMab-12 to hPDPN. Thus, LpMab-12 could serve as a new diagnostic tool for determining whether hPDPN possesses the sialylation on Thr52, a site-specific post-translational modification critical for the hPDPN association with CLEC-2.
Identification and characterization of Burkholderia multivorans CCA53.
Akita, Hironaga; Kimura, Zen-Ichiro; Yusoff, Mohd Zulkhairi Mohd; Nakashima, Nobutaka; Hoshino, Tamotsu
2017-07-06
A lignin-degrading bacterium, Burkholderia sp. CCA53, was previously isolated from leaf soil. The purpose of this study was to determine phenotypic and biochemical features of Burkholderia sp. CCA53. Multilocus sequence typing (MLST) analysis based on fragments of the atpD, gltD, gyrB, lepA, recA and trpB gene sequences was performed to identify Burkholderia sp. CCA53. The MLST analysis revealed that Burkholderia sp. CCA53 was tightly clustered with B. multivorans ATCC BAA-247 T . The quinone and cellular fatty acid profiles, carbon source utilization, growth temperature and pH were consistent with the characteristics of B. multivorans species. Burkholderia sp. CCA53 was therefore identified as B. multivorans CCA53.
Yamada, Shinji; Itai, Shunsuke; Nakamura, Takuro; Chang, Yao-Wen; Harada, Hiroyuki; Suzuki, Hiroyoshi; Kaneko, Mika K; Kato, Yukinari
2017-12-01
Human epidermal growth factor receptor 2 (HER2) is overexpressed in breast cancer and is associated with poor clinical outcomes. In addition, HER2 expression has been reported in other cancers, such as gastric, colorectal, lung, and pancreatic cancers. An anti-HER2 humanized antibody, trastuzumab, leads to significant survival benefits in patients with HER2-overexpressing breast cancers and gastric cancers. Herein, we established a novel anti-HER2 monoclonal antibody (mAb), H 2 Mab-119 (IgG 1 , kappa), and characterized its efficacy against pancreatic cancers using flow cytometry, Western blot, and immunohistochemical analyses. H 2 Mab-119 reacted with pancreatic cancer cell lines, such as KLM-1, Capan-2, and MIA PaCa-2, but did not react with PANC-1 in flow cytometry analysis. Western blot analysis also revealed a moderate signal for KLM-1 and a weak signal for MIA PaCa-2, although H 2 Mab-119 reacted strongly with LN229/HER2 cells. Finally, immunohistochemical analyses with H 2 Mab-119 revealed sensitive and specific reactions against breast and colon cancers but did not react with pancreatic cancers, indicating that H 2 Mab-119 is useful for detecting HER2 overexpression in pancreatic cancers using flow cytometry and Western blot analyses.
Zhou, Yu; Tian, Xiang-Li; Li, Yan-Song; Pan, Feng-Guang; Zhang, Yuan-Yuan; Zhang, Jun-Hui; Wang, Xin-Rui; Ren, Hong-Lin; Lu, Shi-Ying; Li, Zhao-Hui; Liu, Zeng-Shan; Chen, Qi-Jun; Liu, Jing-Qiu
2012-12-15
Abrin is a plant toxin, which can be easily isolated from the seeds of Abrus precatorius. It may be used as a biological warfare agent. In order to detect abrin in food samples, a two-layer sandwich format enzyme-linked immunosorbent assay based on the monoclonal antibody (mAb) (as capture antibody) and rabbit polyclonal serum (as detecting antibody) was developed and applied for the determination of abrin in some food matrices. The linear range of the mAb was 1-100 μg L(-1) with a detection limit of 0.5 μg L(-1) for abrin in phosphate buffered saline (PBS). The recoveries of abrin from sausage, beer and milk samples ranged 97.5-98.6%, 95.8-98.4% and 94.8-9.6%, respectively, with a coefficient of variation (CV) of 3.7% or less. The newly developed sandwich ELISA using the mAb appears to be a reliable and useful method for detection of abrin in sausage, beer and milk. Copyright © 2012 Elsevier Ltd. All rights reserved.
Prophylactic and therapeutic efficacy of human monoclonal antibodies against H5N1 influenza.
Directory of Open Access Journals (Sweden)
Cameron P Simmons
2007-05-01
Full Text Available New prophylactic and therapeutic strategies to combat human infections with highly pathogenic avian influenza (HPAI H5N1 viruses are needed. We generated neutralizing anti-H5N1 human monoclonal antibodies (mAbs and tested their efficacy for prophylaxis and therapy in a murine model of infection.Using Epstein-Barr virus we immortalized memory B cells from Vietnamese adults who had recovered from infections with HPAI H5N1 viruses. Supernatants from B cell lines were screened in a virus neutralization assay. B cell lines secreting neutralizing antibodies were cloned and the mAbs purified. The cross-reactivity of these antibodies for different strains of H5N1 was tested in vitro by neutralization assays, and their prophylactic and therapeutic efficacy in vivo was tested in mice. In vitro, mAbs FLA3.14 and FLD20.19 neutralized both Clade I and Clade II H5N1 viruses, whilst FLA5.10 and FLD21.140 neutralized Clade I viruses only. In vivo, FLA3.14 and FLA5.10 conferred protection from lethality in mice challenged with A/Vietnam/1203/04 (H5N1 in a dose-dependent manner. mAb prophylaxis provided a statistically significant reduction in pulmonary virus titer, reduced associated inflammation in the lungs, and restricted extrapulmonary dissemination of the virus. Therapeutic doses of FLA3.14, FLA5.10, FLD20.19, and FLD21.140 provided robust protection from lethality at least up to 72 h postinfection with A/Vietnam/1203/04 (H5N1. mAbs FLA3.14, FLD21.140 and FLD20.19, but not FLA5.10, were also therapeutically active in vivo against the Clade II virus A/Indonesia/5/2005 (H5N1.These studies provide proof of concept that fully human mAbs with neutralizing activity can be rapidly generated from the peripheral blood of convalescent patients and that these mAbs are effective for the prevention and treatment of H5N1 infection in a mouse model. A panel of neutralizing, cross-reactive mAbs might be useful for prophylaxis or adjunctive treatment of human cases of H5N1
LpMab-19 Recognizes Sialylated O-Glycan on Thr76 of Human Podoplanin.
Ogasawara, Satoshi; Kaneko, Mika K; Kato, Yukinari
2016-08-26
Human podoplanin (hPDPN) is expressed in lymphatic vessels, pulmonary type-I alveolar cells, and renal glomerulus. The hPDPN/C-type lectin-like receptor-2 (CLEC-2) interaction is involved in platelet aggregation and cancer metastasis. High expression of hPDPN in cancer cells or cancer-associated fibroblasts (CAFs) leads to a poor prognosis for cancer patients. In our previous research, we reported on several anti-hPDPN monoclonal antibodies (mAbs), including LpMab-2, LpMab-3, LpMab-7, LpMab-9, LpMab-12, LpMab-13, and LpMab-17 of mouse IgG 1 subclass, which were produced using CasMab technology. Here we produced a novel anti-hPDPN mAb LpMab-19 of mouse IgG 2b subclass. Flow cytometry revealed that the epitope of LpMab-19 includes O-glycan, which is attached to Thr76 of hPDPN. We further identified the minimum epitope of LpMab-19 as Thr76-Arg79 of hPDPN. Immunohistochemistry revealed that LpMab-19 is useful for detecting not only normal cells, including lymphatic vessels, but also glioblastoma and oral squamous cell carcinoma cells. LpMab-19 could be useful for investigating the physiological function of O-glycosylated hPDPN.
Neutron Reflection Study of Surface Adsorption of Fc, Fab, and the Whole mAb.
Li, Zongyi; Li, Ruiheng; Smith, Charles; Pan, Fang; Campana, Mario; Webster, John R P; van der Walle, Christopher F; Uddin, Shahid; Bishop, Steve M; Narwal, Rojaramani; Warwicker, Jim; Lu, Jian Ren
2017-07-12
Characterizing the influence of fragment crystallization (Fc) and antigen-binding fragment (Fab) on monoclonal antibody (mAb) adsorption at the air/water interface is an important step to understanding liquid mAb drug product stability during manufacture, shipping, and storage. Here, neutron reflection is used to study the air/water adsorption of a mAb and its Fc and Fab fragments. By varying the isotopic contrast, the adsorbed amount, thickness, orientation, and immersion of the adsorbed layers could be determined unambiguously. While Fc adsorption reached saturation within the hour, its surface adsorbed amount showed little variation with bulk concentration. In contrast, Fab adsorption was slower and the adsorbed amount was concentration dependent. The much higher Fc adsorption, as compared to Fab, was linked to its lower surface charge. Time and concentration dependence of mAb adsorption was dominated by Fab behavior, although both Fab and Fc behaviors contributed to the amount of mAb adsorbed. Changing the pH from 5.5 to 8.8 did not much perturb the adsorbed amount of Fc, Fab, or mAb. However, a small decrease in adsorption was observed for the Fc over pH 8-8.8 and vice versa for the Fab and mAb, consistent with a dominant Fab behavior. As bulk concentration increased from 5 to 50 ppm, the thicknesses of the Fc layers were almost constant at 40 Å, while Fab and mAb layers increased from 45 to 50 Å. These results imply that the adsorbed mAb, Fc, and Fab all retained their globular structures and were oriented with their short axial lengths perpendicular to the interface.
Bis(arene) actinide sandwich complexes, (η6-C6H3R3)2An: Linear or bent?
International Nuclear Information System (INIS)
Li, J.; Bursten, B.E.
1999-01-01
The syntheses of the sandwich complexes ferrocene, (η 5 -C 5 H 5 ) 2 -Fe, in 1951 and uranocene, (η 8 -C 8 H 8 ) 2 U, in 1968 ushered in the modern eras of organotransition metal and organoactinide chemistry, respectively. Ferrocene and uranocene are examples of linear sandwich complexes, that is, those in which the (ring centroid)-M-(ring centroid) angle (denoted θ) is 180 degree. In the case of (η 5 -C 5 H 5 ) 2 M chemistry, a number of bent (θ 2 An (An = Th-Am) and (η 6 -C 6 H 3 R 3 ) 2 An (An = Th, U, Pu; R = Me, t Bu) obtained by using local density approximation (LDA) and Perdew-Wang (PW91) gradient-corrected relativistic density functional theory (DFT) methods. These DFT methods are found to be able to reproduce the experimental geometries and vibrational frequencies of organoactinide complexes with satisfactory accuracy. The (TTB) 2 An calculations that are reported here are, to date, the largest full geometry optimizations to be carried out on an actinide system
He, Qigai; Velumani, Sumathy; Du, Qingyun; Lim, Chee Wee; Ng, Fook Kheong; Donis, Ruben; Kwang, Jimmy
2007-01-01
The unprecedented spread of highly pathogenic avian influenza virus subtype H5N1 in Asia and Europe is threatening animals and public health systems. Effective diagnosis and control management are needed to control the disease. To this end, we developed a panel of monoclonal antibodies (MAbs) against the H5N1 avian influenza virus (AIV) and implemented an antigen-capture enzyme-linked immunosorbent assay (AC-ELISA) to detect the H5 viral antigen. Mice immunized with denatured hemagglutinin (H...
Hasegawa, Koutaro; Minakata, Kayoko; Gonmori, Kunio; Nozawa, Hideki; Yamagishi, Itaru; Watanabe, Kanako; Suzuki, Osamu
2018-02-01
An autopsy case in which the cause of death was judged as drug poisoning by two synthetic cannabinoids, including MAB-CHMINACA, was investigated. Although unchanged MAB-CHMINACA could be detected from solid tissues, blood and stomach contents in the case, the compound could not be detected from a urine specimen. We obtained six kinds of reference standards of MAB-CHMINACA metabolites from a commercial source. The MAB-CHMINACA metabolites from the urine specimen of the abuser were extracted using a QuEChERS method including dispersive solid-phase extraction, and analyzed by liquid chromatography-tandem mass spectrometry with or without hydrolysis with β-glucuronidase. Among the six MAB-CHMINACA metabolites tested, two predominant metabolites could be identified and quantified in the urine specimen of the deceased. After hydrolysis with β-glucuronidase, an increase of the two metabolites was not observed. The metabolites detected were a 4-monohydroxycyclohexylmethyl metabolite M1 (N-(1-amino-3,3-dimethyl-1-oxobutan-2-yl)-1-((4-hydroxycyclohexyl)methyl)-1H-indazole-3-carboxamide) and a dihydroxyl (4-hydroxycyclohexylmethyl and tert-butylhydroxyl) metabolite M11 (N-(1-amino-4-hydroxy-3,3-dimethyl-1-oxobutan-2-yl)-1-((4-hydroxycyclohexyl)methyl)-1H-indazole-3-carboxamide). Their concentrations were 2.17 ± 0.15 and 10.2 ± 0.3 ng/mL (n = 3, each) for M1 and M11, respectively. Although there is one previous in vitro study showing the estimation of metabolism of MAB-CHMINACA using human hepatocytes, this is the first report dealing with in vivo identification and quantification of MAB-CHMINACA metabolites in an authentic human urine specimen. Copyright © 2017 John Wiley & Sons, Ltd.
5,11-Ditosyl-5H,11H-dibenzo[b,f][1,5]diazocine-6,12-dione acetic acid hemisolvate
Directory of Open Access Journals (Sweden)
Najat Abbassi
2013-04-01
Full Text Available The molecular structure of the title compound, C28H22N2O6S2·0.5CH3COOH, is built up from three fused rings, two six and one eight membered. The eight-membered ring shows a boat conformation and the dihedral angle between the two benzene groups attached thereto is 66.43 (11°, resulting in a V-shaped geometry. Two tosyl substituents are bound to the N atoms. The planes through the tolyl rings are roughly perpendicular, as indicated by the dihedral angle of 82.44 (12°. In the crystal, the molecule and its inversion-related symmetry-equivalent are linked to the acetic acid solvent molecule by non-classical O—H...O and C—H...O hydrogen bonds. Two half-occupied acetic acid solvent molecules are disordered at the same site and linked by a center of symmetry.
Leaching of CCA-treated wood: implications for waste disposal
International Nuclear Information System (INIS)
Townsend, Timothy; Tolaymat, Thabet; Solo-Gabriele, Helena; Dubey, Brajesh; Stook, Kristin; Wadanambi, Lakmini
2004-01-01
Leaching of arsenic, chromium, and copper from chromated copper arsenate (CCA)-treated wood poses possible environmental risk when disposed. Samples of un-weathered CCA-treated wood were tested using a variety of the US regulatory leaching procedures, including the toxicity characteristic leaching procedure (TCLP), synthetic precipitation leaching procedure (SPLP), extraction procedure toxicity method (EPTOX), waste extraction test (WET), multiple extraction procedure (MEP), and modifications of these procedures which utilized actual MSW landfill leachates, a construction and demolition (C and D) debris leachate, and a concrete enhanced leachate. Additional experiments were conducted to assess factors affecting leaching, such as particle size, pH, and leaching contact time. Results from the regulatory leaching tests provided similar results with the exception of the WET, which extracted greater quantities of metals. Experiments conducted using actual MSW leachate, C and D debris leachate, and concrete enhanced leachate provided results that were within the same order of magnitude as results obtained from TCLP, SPLP, and EPTOX. Eleven of 13 samples of CCA-treated dimensional lumber exceeded the US EPA's toxicity characteristic (TC) threshold for arsenic (5 mg/L). If un-weathered arsenic-treated wood were not otherwise excluded from the definition of hazardous waste, it frequently would require management as such. When extracted with simulated rainwater (SPLP), 9 of the 13 samples leached arsenic at concentrations above 5 mg/L. Metal leachability tended to increase with decreasing particle size and at pH extremes. All three metals leached above the drinking water standards thus possibly posing a potential risk to groundwater. Arsenic is a major concern from a disposal point of view with respect to ground water quality
Detection of high CD44 expression in oral cancers using the novel monoclonal antibody, C44Mab-5
Directory of Open Access Journals (Sweden)
Shinji Yamada
2018-07-01
Full Text Available CD44 is a transmembrane glycoprotein that regulates a variety of genes related to cell-adhesion, migration, proliferation, differentiation, and survival. A large number of alternative splicing isoforms of CD44, containing various combinations of alternative exons, have been reported. CD44 standard (CD44s, which lacks variant exons, is widely expressed on the surface of most tissues and all hematopoietic cells. In contrast, CD44 variant isoforms show tissue-specific expression patterns and have been extensively studied as both prognostic markers and therapeutic targets in cancer and other diseases. In this study, we immunized mice with CHO-K1 cell lines overexpressing CD44v3-10 to obtain novel anti-CD44 mAbs. One of the clones, C44Mab-5 (IgG1, kappa, recognized both CD44s and CD44v3-10. C44Mab-5 also reacted with oral cancer cells such as Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4 using flow cytometry. Moreover, immunohistochemical analysis revealed that C44Mab-5 detected 166/182 (91.2% of oral cancers. These results suggest that the C44Mab-5 antibody may be useful for investigating the expression and function of CD44 in various cancers.
Detection of high CD44 expression in oral cancers using the novel monoclonal antibody, C44Mab-5.
Yamada, Shinji; Itai, Shunsuke; Nakamura, Takuro; Yanaka, Miyuki; Kaneko, Mika K; Kato, Yukinari
2018-07-01
CD44 is a transmembrane glycoprotein that regulates a variety of genes related to cell-adhesion, migration, proliferation, differentiation, and survival. A large number of alternative splicing isoforms of CD44, containing various combinations of alternative exons, have been reported. CD44 standard (CD44s), which lacks variant exons, is widely expressed on the surface of most tissues and all hematopoietic cells. In contrast, CD44 variant isoforms show tissue-specific expression patterns and have been extensively studied as both prognostic markers and therapeutic targets in cancer and other diseases. In this study, we immunized mice with CHO-K1 cell lines overexpressing CD44v3-10 to obtain novel anti-CD44 mAbs. One of the clones, C 44 Mab-5 (IgG 1 , kappa), recognized both CD44s and CD44v3-10. C 44 Mab-5 also reacted with oral cancer cells such as Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4 using flow cytometry. Moreover, immunohistochemical analysis revealed that C 44 Mab-5 detected 166/182 (91.2%) of oral cancers. These results suggest that the C 44 Mab-5 antibody may be useful for investigating the expression and function of CD44 in various cancers.
Synthesis-based approach toward direct sandwich immunoassay for ciguatoxin CTX3C.
Oguri, Hiroki; Hirama, Masahiro; Tsumuraya, Takeshi; Fujii, Ikuo; Maruyama, Megumi; Uehara, Hisatoshi; Nagumo, Yoko
2003-06-25
Ciguatoxins are the major causative toxins of ciguatera seafood poisoning. Limited availability of ciguatoxins has hampered the development of a reliable and specific immunoassay for detecting these toxins in contaminated fish. Monoclonal antibodies (mAbs) specific against both ends of ciguatoxin CTX3C were prepared by immunization of mice with protein conjugates of rationally designed synthetic haptens, 3 and 4, in place of the natural toxin. Haptenic groups that possess a surface area larger than 400 A(2) were required to produce mAbs that can bind strongly to CTX3C itself. A direct sandwich enzyme-linked immunosorbent assay (ELISA) using these mAbs was established to detect CTX3C at the ppb level with no cross-reactivity against other related marine toxins, including brevetoxin A, brevetoxin B, okadaic acid, or maitotoxin.
Directory of Open Access Journals (Sweden)
Huan H Nguyen
Full Text Available BACKGROUND: Pandemic influenza poses a serious threat to global health and the world economy. While vaccines are currently under development, passive immunization could offer an alternative strategy to prevent and treat influenza virus infection. Attempts to develop monoclonal antibodies (mAbs have been made. However, passive immunization based on mAbs may require a cocktail of mAbs with broader specificity in order to provide full protection since mAbs are generally specific for single epitopes. Chicken immunoglobulins (IgY found in egg yolk have been used mainly for treatment of infectious diseases of the gastrointestinal tract. Because the recent epidemic of highly pathogenic avian influenza virus (HPAIV strain H5N1 has resulted in serious economic losses to the poultry industry, many countries including Vietnam have introduced mass vaccination of poultry with H5N1 virus vaccines. We reasoned that IgY from consumable eggs available in supermarkets in Vietnam could provide protection against infections with HPAIV H5N1. METHODS AND FINDINGS: We found that H5N1-specific IgY that are prepared from eggs available in supermarkets in Vietnam by a rapid and simple water dilution method cross-protect against infections with HPAIV H5N1 and related H5N2 strains in mice. When administered intranasally before or after lethal infection, the IgY prevent the infection or significantly reduce viral replication resulting in complete recovery from the disease, respectively. We further generated H1N1 virus-specific IgY by immunization of hens with inactivated H1N1 A/PR/8/34 as a model virus for the current pandemic H1N1/09 and found that such H1N1-specific IgY protect mice from lethal influenza virus infection. CONCLUSIONS: The findings suggest that readily available H5N1-specific IgY offer an enormous source of valuable biological material to combat a potential H5N1 pandemic. In addition, our study provides a proof-of-concept for the approach using virus
Zhu, Min; Gong, Xue; Hu, Yonghong; Ou, Weijun; Wan, Yakun
2014-12-20
Influenza H5N1 is one subtype of the influenza A virus which can infect human bodies and lead to death. Timely diagnosis before its breakout is vital to the human health. The current clinical biochemical diagnosis for influenza virus are still flawed, and the diagnostic kits of H5N1 are mainly based on traditional monoclonal antibodies that hardly meet the requirements for clinical applications. Nanobody is a promising tool for diagnostics and treatment due to its smallest size, high specificity and stability. In this study, a novel Nanobody-based bioassay was developed for rapid, low-cost and sensitive detection of the influenza H5N1 virus. Nanobodies specific to H5N1 virus were selected from a VHH library by phage display technology. In this system, the biotinylated Nanobody was directionally captured by streptavidin coated on ELISA plate, which can specifically capture the H5N1 virus. Another Nanobody conjugated with HRP was used as a detector. A novel directional enzyme-linked immunosorbent assay for H5N1 using specific Nanobodies was established and compared to the conventional undirected ELISA assay. We have successfully constructed a high quality phage display Nanobody library and isolated two Nanobodies against H5N1 with high affinity and specificity. These two Nanobodies were further used to prepare the biosensor detection system. This streptavidin-biotin-based directional double Nanobodies sandwich ELISA for H5N1 detection showed superiority over the commonly undirectional ELISA protocol. The linear range of detection for standards in this immunoassay was approximately 50-1000 ng/mL and the detection limit was 14.1 ng/mL. The average recoveries of H5N1 virus from human serum samples were in the range from 94.58% to 114.51%, with a coefficient of variation less than 6.5%. Collectively, these results demonstrated that the proposed detection system is an alternative diagnostic tool that enables a rapid, inexpensive, sensitive and specific detection of the
Monoclonal Antibody L1Mab-13 Detected Human PD-L1 in Lung Cancers.
Yamada, Shinji; Itai, Shunsuke; Nakamura, Takuro; Yanaka, Miyuki; Chang, Yao-Wen; Suzuki, Hiroyoshi; Kaneko, Mika K; Kato, Yukinari
2018-04-01
Programmed cell death ligand-1 (PD-L1) is a type I transmembrane glycoprotein expressed on antigen-presenting cells. It is also expressed in several tumor cells such as melanoma and lung cancer cells. A strong correlation has been reported between human PD-L1 (hPD-L1) expression in tumor cells and negative prognosis in cancer patients. Here, a novel anti-hPD-L1 monoclonal antibody (mAb) L 1 Mab-13 (IgG 1 , kappa) was produced using a cell-based immunization and screening (CBIS) method. We investigated hPD-L1 expression in lung cancer using flow cytometry, Western blot, and immunohistochemical analyses. L 1 Mab-13 specifically reacted hPD-L1 of hPD-L1-overexpressed Chinese hamster ovary (CHO)-K1 cells and endogenous hPD-L1 of KMST-6 (human fibroblast) in flow cytometry and Western blot. Furthermore, L 1 Mab-13 reacted with lung cancer cell lines (EBC-1, Lu65, and Lu99) in flow cytometry and stained lung cancer tissues in a membrane-staining pattern in immunohistochemical analysis. These results indicate that a novel anti-hPD-L1 mAb, L 1 Mab-13, is very useful for detecting hPD-L1 of lung cancers in flow cytometry, Western blot, and immunohistochemical analyses.
Production of monoclonal antibodies for sandwich immunoassay detection of Pacific ciguatoxins.
Tsumuraya, Takeshi; Fujii, Ikuo; Hirama, Masahiro
2010-10-01
Ciguatoxins are the major causative toxins of ciguatera seafood poisoning. Limited availability of ciguatoxins has hampered the development of a reliable and specific immunoassay for detecting these toxins in contaminated fish. Monoclonal antibodies (mAbs) specific against both ends of Pacific ciguatoxins CTX3C and 51-hydroxyCTX3C were prepared by immunization of mice with the protein conjugates of rationally designed synthetic haptens in place of the natural toxin. Haptenic groups that possess a surface area larger than 400 A(2) were required to produce mAbs that can bind strongly to CTX3C or 51-hydroxyCTX3C. A direct sandwich enzyme-linked immunosorbent assay (ELISA) using these mAbs was established to detect CTX3C and 51-hydroxyCTX3C at the ppb level with no cross-reactivity against the other marine toxins, including brevetoxin A, brevetoxin B, okadaic acid, or maitotoxin. Copyright 2009 Elsevier Ltd. All rights reserved.
Search for 4H, 5H and 6H nuclei in the 11B-induced reaction on 9Be
International Nuclear Information System (INIS)
Belozerov, A.V.; Borcea, C.; Dlouhy, Z.
1985-01-01
In the 11 B(88.0 MeV)+ 9 Be reaction the energy spectra of the 14 O, 15 O and 16 O nuclei have been measured to obtain some information about their partners in the exit channel - the neutron-rich hydrogen isotopes 4 H, 5 H and 6 H. The unbound levels in the 4 H and 6 H systems have been observed at excitation energies of 3.5 +- 0.5 MeV (GITA approximately 1 MeV) and 2.6 +- 0.5 MeV (GITA=1.5 +- 0.3 MeV), respectively
International Nuclear Information System (INIS)
Tang Lin; Zhuang Yumei; Zhou Zhaohua; Yu Gehua; Pan Jianzhong; Zhang Xueguang
2002-01-01
Objective: To study the expression of CD 40 molecule and the biological effects mediated by CD 40 molecules on malignant B cells. Methods: Agonistic anti-human CD 40 monoclonal antibody (clone 5C11) was added to cell culture system. Cell counting, PI staining, Annexin-V staining and flow cytometric analysis were used to study the behavior of malignant B cell lines after treatment with mAb clone 5C11. Results: 5C11 induced homotypic aggregation and proliferation arrest and mediated apoptosis in multiple myeloma cell line XG2 that expressed CD 40 strongly; 5C11 induced B lymphoma cell line Daudi homotypic aggregation and proliferation arrest and apoptosis, the apoptosis of XG2 and Daudi by CD40 activation was not mediated by TNF. Conclusion: Agonistic anti-CD 40 mAb 5C11 can inhibit the proliferation of malignant B cells by inducing them to die apoplectically
Kamchanawong, S; Veerakajohnsak, C
2010-04-01
This study looks into the potential risks of arsenic, chromium, and copper leaching from disposed hardwoods treated with chromated copper arsenate (CCA) in a tropical climate. The Toxicity Characteristic Leaching Procedure (TCLP) and the Waste Extraction Test (WET) were employed to examine new CCA-treated Burseraceae and Keruing woods, weathered CCA-treated teak wood, and ash from new CCA-treated Burseraceae wood. In addition, a total of six lysimeters, measuring 2 m high and 203 mm in diameter were prepared to compare the leachate generated from the wood monofills, construction and demolition (C&D) debris landfills and municipal solid waste (MSW) landfills, containing CCA-treated Burseraceae wood. The TCLP and WET results showed that the CCA-treated Burseraceae wood leached higher metal concentrations (i.e. 9.19-17.70 mg/L, 1.14-5.89 mg/L and 4.83-23.89 mg/L for arsenic, chromium, and copper, respectively) than the CCA-treated Keruing wood (i.e. 1.74-11.34 mg/L, 0.26-3.57 mg/L and 0.82-13.64 mg/L for arsenic, chromium and copper, respectively). Ash from the CCA-treated Burseraceae wood leached significantly higher metal concentrations (i.e. 108.5-116.9 mg/L, 1522-3862 mg/L and 84.03-114.4 mg/L for arsenic, chromium and copper, respectively), making this type of ash of high concern. The lysimeter study results showed that the MSW lysimeter exhibited higher reducing conditions, more biological activities and more dissolved ions in their leachates than the wood monofill and C&D debris lysimeters. All leachates generated from the lysimeters containing the CCA-treated Burseraceae wood contained significantly higher concentrations of arsenic in comparison to those of the untreated wood: in the range of 0.53-15.7 mg/L. It can be concluded that the disposal of CCA-treated Burseraceae wood in an unlined C&D landfill or a MSW landfill has the potential to contaminate groundwater.
Kato, Yukinari; Ogasawara, Satoshi; Oki, Hiroharu; Honma, Ryusuke; Takagi, Michiaki; Fujii, Yuki; Nakamura, Takuro; Saidoh, Noriko; Kanno, Hazuki; Umetsu, Mitsuo; Kamata, Satoshi; Kubo, Hiroshi; Yamada, Mitsuhiro; Sawa, Yoshihiko; Morita, Kei-Ichi; Harada, Hiroyuki; Suzuki, Hiroyoshi; Kaneko, Mika Kato
2016-04-01
Podoplanin (PDPN) is a type-I transmembrane sialoglycoprotein, which possesses a platelet aggregation-stimulating (PLAG) domain in its N-terminus. Among the three PLAG domains, O-glycan on Thr52 of PLAG3 is critical for the binding with C-type lectin-like receptor-2 (CLEC-2) and is essential for platelet-aggregating activity of PDPN. Although many anti-PDPN monoclonal antibodies (mAbs) have been established, almost all mAbs bind to PLAG domains. We recently established CasMab technology to produce mAbs against membranous proteins. Using CasMab technology, we produced a novel anti-PDPN mAb, LpMab-17, which binds to non-PLAG domains. LpMab-17 clearly detected endogenous PDPN of cancer cells and normal cells in Western-blot, flow cytometry, and immunohistochemistry. LpMab-17 recognized glycan-deficient PDPN in flow cytometry, indicating that the interaction between LpMab-17 and PDPN is independent of its glycosylation. The minimum epitope of LpMab-17 was identified as Gly77-Asp82 of PDPN using enzyme-linked immunosorbent assay. Of interest, LpMab-17 did not bind to monkey PDPN, whereas the homology is 94% between human PDPN and monkey PDPN, indicating that the epitope of LpMab-17 is unique compared with the other anti-PDPN mAbs. The combination of different epitope-possessing mAbs could be advantageous for the PDPN-targeting diagnosis or therapy.
Alizadeh, M. H.; Eshtiagh-Hosseini, H.; Khoshnavazi, R.
2004-01-01
The rational synthesis of the new sandwich-type arsenotungstocerate [As 2W 18Ce 3O 71(H 2O) 3] 12- is reported for the first time by reaction of the trivacant lacunary species A-α-[AsW 9O 34] 9- with appropriate Ce IV. The single crystal structure analysis was carried out on K 7(H 3O) 5[As 2W 18Ce 3O 71(H 2O) 3]·9H 2O; H 39As 2Ce 3K 7O 88W 18; ( 2) which crystallizes in triclinic system, space group P overline1 with a=11.615(5) Å, b=17.638(7) Å, c=19.448(8) Å, α=73.643(7)°, β=88.799(7)°, γ=88.078(7)° and Z=2. The anion consists on two lacunary A-α-[AsW 9O 34] 9- Keggin moieties linked via a (H 2OCeO) 3 belt leading to a sandwich-type structure. Each cerium atom adopts tri-capped trigonal-prismatic coordination achieved by two terminal oxygen of an edge shared paired of WO 6 octahedra to each A-α-AsW 9O 349- moiety and two oxygen from the belt and the cap by one μ 3-O (As, W 2) to each A-α-AsW 9O 349- moiety and one external water ligand. The Ce-O bond lengths average in CeO 6 group, Ce-O(As, W 2) and Ce-O(nW) are 2.300(9), 2.887(3) and 2.682(5) Å, respectively. The acid/base titration curve reveals that the anion has two different titrable protons.
Kaneko, Mika K; Yamada, Shinji; Nakamura, Takuro; Abe, Shinji; Nishioka, Yasuhiko; Kunita, Akiko; Fukayama, Masashi; Fujii, Yuki; Ogasawara, Satoshi; Kato, Yukinari
2017-04-01
Human podoplanin (hPDPN), a platelet aggregation-inducing transmembrane glycoprotein, is expressed in different types of tumors, and it binds to C-type lectin-like receptor 2 (CLEC-2). The overexpression of hPDPN is involved in invasion and metastasis. Anti-hPDPN monoclonal antibodies (mAbs) such as NZ-1 have shown antitumor and antimetastatic activities by binding to the platelet aggregation-stimulating (PLAG) domain of hPDPN. Recently, we developed a novel mouse anti-hPDPN mAb, LpMab-2, using the cancer-specific mAb (CasMab) technology. In this study we developed chLpMab-2, a human-mouse chimeric anti-hPDPN antibody, derived from LpMab-2. chLpMab-2 was produced using fucosyltransferase 8-knockout (KO) Chinese hamster ovary (CHO)-S cell lines. By flow cytometry, chLpMab-2 reacted with hPDPN-expressing cancer cell lines including glioblastomas, mesotheliomas, and lung cancers. However, it showed low reaction with normal cell lines such as lymphatic endothelial and renal epithelial cells. Moreover, chLpMab-2 exhibited high antibody-dependent cellular cytotoxicity (ADCC) against PDPN-expressing cells, despite its low complement-dependent cytotoxicity. Furthermore, treatment with chLpMab-2 abolished tumor growth in xenograft models of CHO/hPDPN, indicating that chLpMab-2 suppressed tumor development via ADCC. In conclusion, chLpMab-2 could be useful as a novel antibody-based therapy against hPDPN-expressing tumors. © 2017 The Authors. Cancer Medicine published by John Wiley & Sons Ltd.
Anti-CD25 mAb administration prevents spontaneous liver transplant tolerance.
Li, W; Carper, K; Liang, Y; Zheng, X X; Kuhr, C S; Reyes, J D; Perkins, D L; Thomson, A W; Perkins, J D
2006-12-01
Liver allografts are accepted spontaneously in all mouse strain combinations without immunosuppressive therapy. The mechanisms underlying this phenomenon remain largely undefined. In this study, we examined the effect of CD4+ CD25+ T regulatory cells (Treg) on the induction of mouse liver transplant tolerance. Orthotopic liver transplantation was performed from B10 (H2b) to C3H (H2k) mice. Depleting rat anti-mouse CD25 mAb (PC61) was given to the donors or recipients (250 microg/d IP) pretransplant or to the recipients postoperatively. At day 5 posttransplantation, both effector T cells (mainly CD8) and CD4+ CD25+ Treg were increased in the liver allografts and host spleens compared to naïve mice. Anti-CD25 mAb administration, either pretransplantation or posttransplantation, reduced the ratio of CD4+ CD25+ Treg to the CD3 T cells of liver grafts and recipient spleens and induced liver allograft acute rejection compared to IgG treatment. Anti-CD25 mAb administration elevated anti-donor T-cell proliferative responses and CTL and NK activities of graft infiltrates and host splenocytes; reduced CTLA4, Foxp3, and IDO mRNA levels; increased IL-10 and IFN-gamma; and decreased IL-4 mRNA levels in the livers or host spleens. The number of apoptotic T cells was reduced significantly in the liver grafts and treated host spleens. Therefore, anti-CD25 mAb administration changed the balance of CD4+ CD25+ Treg to activated T cells of liver graft recipients, preventing liver transplant tolerance. This was associated with enhanced anti-donor immune reactivity, downregulated Treg gene expression, and reduced T cell apoptosis in the grafts and host spleens.
Molecular biology of Neisseria meningitidis class 5 and H. 8 outer membrane proteins
Energy Technology Data Exchange (ETDEWEB)
Kawula, T.H.
1987-01-01
One of the surface structures responsible for inter- and intrastrain antigenic variability in meningococci is the heat-modifiable class 5 (C.5) protein. Neisseria meningitidis strain FAM18 (a meningococcal disease isolate) expressed two different C.5 proteins (C.5a and C.5b) identifiable by sodium dodecyl sulfate polyacrylamide gel electrophoresis. We generated two monoclonal antibodies (MAbs), each specific for one of the identified C.5 proteins. The MAbs, which were bactericidal for variants expressing the appropriate C.5 protein, were used to study C.5 expression changes in FAM18. The H.8 protein is an antigenically conserved outer membrane protein expressed almost exclusively by the pathogenic Neisseria. We have cloned and sequenced an H.8 gene from N. meningitidis FAM18. The predicted H.8 amino acid sequence indicated that the most probable signal peptide processing site matched the consensus prokaryotic lipoprotein processing/modification sequence. We then showed that the H.8 protein could be labeled with {sup 14}C-palmitic acid, confirming that H.8 was a lipoprotein. Processing of the H.8 protein was inhibited by globomycin in E. coli indicating that H.8 was modified by the described lipoprotein processing/modifying pathway described in both gram negative and gram positive genera.
Sorbitol crystallization-induced aggregation in frozen mAb formulations.
Piedmonte, Deirdre Murphy; Hair, Alison; Baker, Priti; Brych, Lejla; Nagapudi, Karthik; Lin, Hong; Cao, Wenjin; Hershenson, Susan; Ratnaswamy, Gayathri
2015-02-01
Sorbitol crystallization-induced aggregation of mAbs in the frozen state was evaluated. The effect of protein aggregation resulting from sorbitol crystallization was measured as a function of formulation variables such as protein concentration and pH. Long-term studies were performed on both IgG1 and IgG2 mAbs over the protein concentration range of 0.1-120 mg/mL. Protein aggregation was measured by size-exclusion HPLC (SE-HPLC) and further characterized by capillary-electrophoresis SDS. Sorbitol crystallization was monitored and characterized by subambient differential scanning calorimetry and X-ray diffraction. Aggregation due to sorbitol crystallization is inversely proportional to both protein concentration and formulation pH. At high protein concentrations, sorbitol crystallization was suppressed, and minimal aggregation by SE-HPLC resulted, presumably because of self-stabilization of the mAbs. The glass transition temperature (Tg ') and fragility index measurements were made to assess the influence of molecular mobility on the crystallization of sorbitol. Tg ' increased with increasing protein concentration for both mAbs. The fragility index decreased with increasing protein concentration, suggesting that it is increasingly difficult for sorbitol to crystallize at high protein concentrations. © 2014 Wiley Periodicals, Inc. and the American Pharmacists Association.
Energy Technology Data Exchange (ETDEWEB)
Fortin, Marc-Andre [Centre Hospitalier Universitaire de Quebec and Laval University, Laboratory for Biomaterials and Bioengineering, Quebec City (Canada); Uppsala University, Biomedical Radiation Sciences, Department of Oncology, Radiology, and Clinical Immunology, Rudbeck Laboratory, Uppsala (Sweden); Salnikov, Alexei V. [Uppsala University, BMC, Department of Medical Biochemistry and Microbiology, Uppsala (Sweden); German Cancer Research Center, Division of Molecular Immunology, Heidelberg (Germany); Nestor, Marika [Uppsala University, Division of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Heldin, Nils-Erik [Uppsala University, Department of Genetics and Pathology, Rudbeck Laboratory, Uppsala (Sweden); Rubin, Kristofer [Uppsala University, BMC, Department of Medical Biochemistry and Microbiology, Uppsala (Sweden); Lundqvist, Hans [Uppsala University, Biomedical Radiation Sciences, Department of Oncology, Radiology, and Clinical Immunology, Rudbeck Laboratory, Uppsala (Sweden)
2007-09-15
We tested the suitability of the chimeric monoclonal anti-human CD44 splice version 6 antibody (cMAb U36) for targeting and visualising human anaplastic thyroid carcinoma with PET. We also performed experiments aimed at elucidating the relation between tumour interstitial fluid pressure (TIFP) and the tumour uptake of antibodies. The affinity and specificity of the cMAb U36 for KAT-4 cells were evaluated in vitro, as was the Na{sup +}/I{sup -} symporter (NIS) expression. Biodistribution studies were performed on KAT-4 carcinoma-bearing mice injected with {sup 124}I-cMAb U36 or free iodine. Biodistribution studies were also performed in animals treated with the specific TGF-{beta}1 and -{beta}3 inhibitor Fc:T{beta}RII, which lowers TIFP. Treated and non-treated animals were scanned by microPET. Cultured human undifferentiated/anaplastic thyroid carcinoma KAT-4 cells expressed low levels of NIS and uptake of free iodine was insignificant. The cMAb U36 expressed an affinity (K{sub D}) of 11 {+-} 2 nM. Tumour radioactivity uptake reached maximum values 48 h after injection of {sup 124}I-cMAb U36 ({proportional_to}22%IA/g). KAT-4 carcinomas were readily identified in all {sup 124}I-immuno-PET images. Radioactivity tumour uptake in Fc:T{beta}RII-treated animals was significantly lower at 24 and 48 h after injection, and five times higher thyroid uptake was also noted. We successfully used {sup 124}I-cMAb U36 to visualise CD44v6-expressing human anaplastic thyroid carcinoma. Given the lack of NIS expression in KAT-4, tumour visualisation is not due to free iodine uptake. Lowering the TIFP in KAT-4 carcinomas did not increase the uptake of mAbs into tumour tissue. (orig.)
PRESERVATIVE LEACHING FROM WEATHERED CCA-TREATED WOOD
Disposal of discarded CCA-treated wood in landfills raises concerns with respect to leaching of preservative compounds. When unweathered CCA-treated wood is leached using the toxicity characteristic leaching procedure (TCLP), arsenic concentrations exceed the toxicity characteris...
Energy Technology Data Exchange (ETDEWEB)
Pereira Junior, Sergio Matias, E-mail: matias@ipt.br [Instituto de Pesquisas Tecnologicas (IPT), Sao Paulo, SP (Brazil); Salvador, Vera Lucia Ribeiro; Sato, Ivone Mulako, E-mail: imsato@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
Brazil produces around 1,2 mi m{sup 3} of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most used wood species are eucalyptus (Eucaliptus ssp)and pine (Pinus ssp). The most wood preservative products used in Brazil are CCA (Chromated Copper Arsenate) and CCB (Copper Chromium and Boron Salt). The analytical methods, such as Flame Atomic Absorption Spectrometry (FAAS) and Plasma Inductively Coupled Optical Emission Spectrometry (ICPOES) have been used for the evaluation of those treatment processes. In this work, the sapwood sample was obtained from eucalyptus trees (Eucaliptus ssp) obtained from Minas Gerais State, Brazil, cut plantation areas. Sawdust sapwood sample was grounded and submitted to different additions of CCA solutions (0.2, 0.7, 1.3, 2.3, 3.6, 6.3, 11.7and17.9 kg m{sup -3}). Power and pressed pellets sapwood samples, analyzed by EDXRFS, showed a good linear relation (r{sup 2}>0.99) between the characteristic intensity fluorescent lines (CuΚα, CrΚαand AsΚΒ) and their concentration, also, showed adequate sensitivity (LQ < 5mgkg{sup -1}) for Cu, Cr and As determination in treated woods. Cu, Cr and As were determined in powdered sawdust samples by FAA spectrometry, using the AWPA A11-93 standard method; the relation between the CCA retention and their concentration showed a lower linear relation than EDXRFS; the FAAS spreading result could be attributed to laboratorial CCA addition process. (author)
Székely, Andrea; Szekrényes, Akos; Kerékgyártó, Márta; Balogh, Attila; Kádas, János; Lázár, József; Guttman, András; Kurucz, István; Takács, László
2014-08-01
Molecular heterogeneity of mAb preparations is the result of various co- and post-translational modifications and to contaminants related to the production process. Changes in molecular composition results in alterations of functional performance, therefore quality control and validation of therapeutic or diagnostic protein products is essential. A special case is the consistent production of mAb libraries (QuantiPlasma™ and PlasmaScan™) for proteome profiling, quality control of which represents a challenge because of high number of mAbs (>1000). Here, we devise a generally applicable multicapillary SDS-gel electrophoresis process for the analysis of fluorescently labeled mAb preparations for the high throughput quality control of mAbs of the QuantiPlasma™ and PlasmaScan™ libraries. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
5,11-Ditosyl-5H,11H-dibenzo[b,f][1,5]diazo-cine-6,12-dione acetic acid hemisolvate.
Abbassi, Najat; Bassou, Oulemda; Rakib, El Mostapha; Saadi, Mohamed; El Ammari, Lahcen
2013-04-01
The mol-ecular structure of the title compound, C28H22N2O6S2·0.5CH3COOH, is built up from three fused rings, two six and one eight membered. The eight-membered ring shows a boat conformation and the dihedral angle between the two benzene groups attached thereto is 66.43 (11)°, resulting in a V-shaped geometry. Two tosyl substituents are bound to the N atoms. The planes through the tolyl rings are roughly perpendicular, as indicated by the dihedral angle of 82.44 (12)°. In the crystal, the mol-ecule and its inversion-related symmetry-equivalent are linked to the acetic acid solvent mol-ecule by non-classical O-H⋯O and C-H⋯O hydrogen bonds. Two half-occupied acetic acid solvent mol-ecules are disordered at the same site and linked by a center of symmetry.
Reuse of poles treated with CCA; CCA-kyllaestettyjen puupylvaeiden uudelleenkaeyttoe
Energy Technology Data Exchange (ETDEWEB)
Lehmus, E. [Vtt Building and Transport, Espoo (Finland)
2005-07-01
This study investigated the feasibility of re-using utility poles or parts of poles for structural use in construction. There are more than 10 million poles in Finland and about 200 000 poles will be removed from service yearly during the next few years. The directive 2003/2/EY will restrict the use of poles treated with CCA. This will change the practice that the energy and telecommunication companies have given the removed poles to the land owners. The present study launched by the Technical Research Centre of Finland (VTT) was carried out to determine the technical condition of CCA impregnated poles removed from service and the concentration levels and leaching of remaining preservatives. To summarize the results of the tests, it is safe to say that re-use of recovered poles of 30 to 50 years of age is possible. Both the preservative concentrations and strength/load-bearing capacity are high enough to allow the use of the poles as load-bearing structures. (orig.)
Feasibility study of a SiC sandwich neutron spectrometer
Energy Technology Data Exchange (ETDEWEB)
Wu, Jian, E-mail: caepwujian@163.com [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900, Sichuan Province (China); Lei, Jiarong, E-mail: jiarong_lei@163.com [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900, Sichuan Province (China); Jiang, Yong; Chen, Yu; Rong, Ru; Zou, Dehui; Fan, Xiaoqiang [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621900, Sichuan Province (China); Chen, Gang; Li, Li; Bai, Song [Nanjing Electronic Devices Institute, Nanjing 210016 (China)
2013-04-21
Semiconductor sandwich neutron spectrometers are suitable for in-pile measurements of fast reactor spectra thanks to their compact and relatively simple design. We have assembled and tested a sandwich neutron spectrometer based on 4H-silicon carbide (4H-SiC) Schottky diodes. The SiC diodes detect neutrons via neutron-induced charged particles (tritons and alpha particles) produced by {sup 6}Li(n,α){sup 3}H reaction. {sup 6}LiF neutron converter layers are deposited on the front surface of Schottky diodes by magnetron sputtering. The responses of SiC diodes to charged particles were investigated with an {sup 241}Am alpha source. A sandwich neutron spectrometer was assembled with two SiC Schottky diodes selected based on the charged-particle-response experimental results. The low-energy neutron response of the sandwich spectrometer was measured in the neutron field of the Chinese Fast Burst Reactor-II (CFBR-II). Spectra of alpha particles and tritons from {sup 6}Li(n,α){sup 3}H reaction were obtained with two well-resolved peaks. The energy resolution of the sum spectrum was 8.8%. The primary experimental results confirmed the 4H-SiC sandwich neutron spectrometer's feasibility. -- Highlights: ► Sandwich neutron spectrometer employing 4H-SiC as a detecting material has been developed for the first time. ► {sup 6}LiF neutron converter has been deposited on the surface of 4H-SiC Schottky diode. ► Preliminary testing results obtained with the 4H-SiC sandwich neutron spectrometer are presented.
International Nuclear Information System (INIS)
Liu, Yingjie; Cao, Jing; Wang, Yujie; Li, Yanzhou; Zhao, Junwei; Chen, Lijuan; Ma, Pengtao; Niu, Jingyang
2014-01-01
An organic–inorganic hybrid sandwich-type tungstoantimonate [Cu(en) 2 (H 2 O)] 4 [Cu(en) 2 (H 2 O) 2 ][Cu 2 Na 4 (α-SbW 9 O 33 ) 2 ]·6H 2 O (1) has been synthesized by reaction of Sb 2 O 3 , Na 2 WO 4 ·2H 2 O, CuCl 2 ·2H 2 O with en (en=ethanediamine) under hydrothermal conditions and structurally characterized by elemental analysis, inductively coupled plasma atomic emission spectrometry, IR spectrum and single-crystal X-ray diffraction. 1 displays a centric dimeric structure formed by two equivalent trivacant Keggin [α-SbW 9 O 33 ] 9− subunits sandwiching a hexagonal (Cu 2 Na 4 ) cluster. Moreover, those related hexagonal hexa-metal cluster sandwiched tungstoantimonates have been also summarized and compared. The variable-temperature magnetic measurements of 1 exhibit the weak ferromagnetic exchange interactions within the hexagonal (Cu 2 Na 4 ) cluster mediated by the oxygen bridges. - Graphical abstract: An organic–inorganic hybrid (Cu 2 Na 4 ) sandwiched tungstoantimonate [Cu(en) 2 (H 2 O)] 4 [Cu (en) 2 (H 2 O) 2 ][Cu 2 Na 4 (α-SbW 9 O 33 ) 2 ]·6H 2 O was synthesized and magnetic properties was investigated. Display Omitted - Highlights: • Organic–inorganic hybrid sandwich-type tungstoantimonate. • (Cu 2 Na 4 sandwiched) tungstoantimonate [Cu 2 Na 4 (α-SbW 9 O 33 ) 2 ] 10− . • Ferromagnetic tungstoantimonate
Detection of high PD-L1 expression in oral cancers by a novel monoclonal antibody L1Mab-4.
Yamada, Shinji; Itai, Shunsuke; Kaneko, Mika K; Kato, Yukinari
2018-03-01
Programmed cell death-ligand 1 (PD-L1), which is a ligand of programmed cell death-1 (PD-1), is a type I transmembrane glycoprotein that is expressed on antigen-presenting cells and several tumor cells, including melanoma and lung cancer cells. There is a strong correlation between human PD-L1 (hPD-L1) expression on tumor cells and negative prognosis in cancer patients. In this study, we produced a novel anti-hPD-L1 monoclonal antibody (mAb), L 1 Mab-4 (IgG 2b , kappa), using cell-based immunization and screening (CBIS) method and investigated hPD-L1 expression in oral cancers. L 1 Mab-4 reacted with oral cancer cell lines (Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4) in flow cytometry and stained oral cancers in a membrane-staining pattern. L 1 Mab-4 stained 106/150 (70.7%) of oral squamous cell carcinomas, indicating the very high sensitivity of L 1 Mab-4. These results indicate that L 1 Mab-4 could be useful for investigating the function of hPD-L1 in oral cancers.
5,11-Ditosyl-5H,11H-dibenzo[b,f][1,5]diazocine-6,12-dione acetic acid hemisolvate
Abbassi, Najat; Bassou, Oulemda; Rakib, El Mostapha; Saadi, Mohamed; El Ammari, Lahcen
2013-01-01
The molecular structure of the title compound, C28H22N2O6S2·0.5CH3COOH, is built up from three fused rings, two six and one eight membered. The eight-membered ring shows a boat conformation and the dihedral angle between the two benzene groups attached thereto is 66.43 (11)°, resulting in a V-shaped geometry. Two tosyl substituents are bound to the N atoms. The planes through the tolyl rings are roughly perpendicular, as indicated by the dihedral angle of 82.44 (12)°. In the crystal, the molecule and its inversion-related symmetry-equivalent are linked to the acetic acid solvent molecule by non-classical O—H⋯O and C—H⋯O hydrogen bonds. Two half-occupied acetic acid solvent molecules are disordered at the same site and linked by a center of symmetry. PMID:23634138
Hfq stimulates the activity of the CCA-adding enzyme
Directory of Open Access Journals (Sweden)
Betat Heike
2007-10-01
Full Text Available Abstract Background The bacterial Sm-like protein Hfq is known as an important regulator involved in many reactions of RNA metabolism. A prominent function of Hfq is the stimulation of RNA polyadenylation catalyzed by E. coli poly(A polymerase I (PAP. As a member of the nucleotidyltransferase superfamily, this enzyme shares a high sequence similarity with an other representative of this family, the tRNA nucleotidyltransferase that synthesizes the 3'-terminal sequence C-C-A to all tRNAs (CCA-adding enzyme. Therefore, it was assumed that Hfq might not only influence the poly(A polymerase in its specific activity, but also other, similar enzymes like the CCA-adding enzyme. Results Based on the close evolutionary relation of these two nucleotidyltransferases, it was tested whether Hfq is a specific modulator acting exclusively on PAP or whether it also influences the activity of the CCA-adding enzyme. The obtained data indicate that the reaction catalyzed by this enzyme is substantially accelerated in the presence of Hfq. Furthermore, Hfq binds specifically to tRNA transcripts, which seems to be the prerequisite for the observed effect on CCA-addition. Conclusion The increase of the CCA-addition in the presence of Hfq suggests that this protein acts as a stimulating factor not only for PAP, but also for the CCA-adding enzyme. In both cases, Hfq interacts with RNA substrates, while a direct binding to the corresponding enzymes was not demonstrated up to now (although experimental data indicate a possible interaction of PAP and Hfq. So far, the basic principle of these stimulatory effects is not clear yet. In case of the CCA-adding enzyme, however, the presented data indicate that the complex between Hfq and tRNA substrate might enhance the product release from the enzyme.
Detection of high PD-L1 expression in oral cancers by a novel monoclonal antibody L1Mab-4
Directory of Open Access Journals (Sweden)
Shinji Yamada
2018-03-01
Full Text Available Programmed cell death-ligand 1 (PD-L1, which is a ligand of programmed cell death-1 (PD-1, is a type I transmembrane glycoprotein that is expressed on antigen-presenting cells and several tumor cells, including melanoma and lung cancer cells. There is a strong correlation between human PD-L1 (hPD-L1 expression on tumor cells and negative prognosis in cancer patients. In this study, we produced a novel anti-hPD-L1 monoclonal antibody (mAb, L1Mab-4 (IgG2b, kappa, using cell-based immunization and screening (CBIS method and investigated hPD-L1 expression in oral cancers. L1Mab-4 reacted with oral cancer cell lines (Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4 in flow cytometry and stained oral cancers in a membrane-staining pattern. L1Mab-4 stained 106/150 (70.7% of oral squamous cell carcinomas, indicating the very high sensitivity of L1Mab-4. These results indicate that L1Mab-4 could be useful for investigating the function of hPD-L1 in oral cancers. Keywords: Programmed cell death-ligand 1, Monoclonal antibody, Oral cancer
Factors affecting sodium hypochlorite extraction of CCA from treated wood.
Gezer, E D; Cooper, P A
2009-12-01
Significant amounts of chromated copper arsenate (CCA) treated wood products, such as utility poles and residential construction wood, remain in service. There is increasing public concern about environmental contamination from CCA-treated wood when it is removed from service for reuse or recycling, placed in landfills or burned in commercial incinerators. In this paper, we investigated the effects of time, temperature and sodium hypochlorite concentration on chromium oxidation and extraction of chromated copper arsenate from CCA-treated wood (Type C) removed from service. Of the conditions evaluated, reaction of milled wood with sodium hypochlorite for one hour at room temperature followed by heating at 75 degrees C for two hours gave the highest extraction efficiency. An average of 95% Cr, 99% Cu and 96% As could be removed from CCA-treated, milled wood by this process. Most of the extracted chromium was oxidized to the hexavalent state and could therefore be recycled in a CCA treating solution. Sodium hypochlorite extracting solutions could be reused several times to extract CCA components from additional treated wood samples.
Nachbagauer, Raffael; Shore, David; Yang, Hua; Johnson, Scott K; Gabbard, Jon D; Tompkins, S Mark; Wrammert, Jens; Wilson, Patrick C; Stevens, James; Ahmed, Rafi; Krammer, Florian; Ellebedy, Ali H
2018-06-13
Broadly cross-reactive antibodies that recognize conserved epitopes within the influenza virus hemagglutinin (HA) stalk domain are of particular interest for their potential use as therapeutic and prophylactic agents against multiple influenza virus subtypes including zoonotic virus strains. Here, we characterized four human HA stalk-reactive monoclonal antibodies (mAbs) for their binding breadth and affinity, in vitro neutralization capacity, and in vivo protective potential against an highly pathogenic avian influenza virus. The monoclonal antibodies were isolated from individuals shortly following infection with (70-1F02 and 1009-3B05) or vaccination against (05-2G02 and 09-3A01) A(H1N1)pdm09. Three of the mAbs bound HAs from multiple strains of group 1 viruses, and one mAb, 05-2G02, bound to both group 1 and group 2 influenza A HAs. All four antibodies prophylactically protected mice against a lethal challenge with the highly pathogenic A/Vietnam/1203/04 (H5N1) strain. Two mAbs, 70-1F02 and 09-3A01, were further tested for their therapeutic efficacy against the same strain and showed good efficacy in this setting as well. One mAb, 70-1F02, was co-crystallized with H5 HA and showed similar heavy chain only interactions as a the previously described anti-stalk antibody CR6261. Finally, we showed that antibodies that compete with these mAbs are prevalent in serum from an individual recently infected with A(H1N1)pdm09 virus. The antibodies described here can be developed into broad-spectrum antiviral therapeutics that could be used to combat infections with zoonotic or emerging pandemic influenza viruses. IMPORTANCE The rise in zoonotic infections of humans with emerging influenza viruses is a worldwide public health concern. The majority of recent zoonotic human influenza cases were caused by H7N9 and H5Nx viruses and were associated with high morbidity and mortality. In addition, seasonal influenza viruses are estimated to cause up to 650,000 deaths annually
de Oliveira Mann, Carina C; Kiefersauer, Reiner; Witte, Gregor; Hopfner, Karl-Peter
2016-06-08
The exceptionally conserved metazoan MAB21 proteins are implicated in cell fate decisions and share considerable sequence homology with the cyclic GMP-AMP synthase. cGAS is the major innate immune sensor for cytosolic DNA and produces the second messenger 2'-5', 3'-5' cyclic GMP-AMP. Little is known about the structure and biochemical function of other proteins of the cGAS-MAB21 subfamily, such as MAB21L1, MAB21L2 and MAB21L3. We have determined the crystal structure of human full-length MAB21L1. Our analysis reveals high structural conservation between MAB21L1 and cGAS but also uncovers important differences. Although monomeric in solution, MAB21L1 forms a highly symmetric double-pentameric oligomer in the crystal, raising the possibility that oligomerization could be a feature of MAB21L1. In the crystal, MAB21L1 is in an inactive conformation requiring a conformational change - similar to cGAS - to develop any nucleotidyltransferase activity. Co-crystallization with NTP identified a putative ligand binding site of MAB21 proteins that corresponds to the DNA binding site of cGAS. Finally, we offer a structure-based explanation for the effects of MAB21L2 mutations in patients with eye malformations. The underlying residues participate in fold-stabilizing interaction networks and mutations destabilize the protein. In summary, we provide a first structural framework for MAB21 proteins.
Vassbotn, F S; Langeland, N; Hagen, I; Holmsen, H
1990-09-01
A monoclonal antibody (MAb 6D11) against platelet-derived growth factor (PDGF) was studied. We found that the MAb 6D11 in concentrations equimolar to PDGF blocked the [3H]thymidine incorporation in C3H/10T1/2 C18 fibroblasts stimulated by PDGF B-B and PDGF A-B. This inhibition was overcome by high doses of PDGF. The [3H]thymidine incorporation stimulated by other growth factors (aFGF, bFGF and bombesin) was not inhibited by the antibody. The MAb 6D11 blocked receptor binding of PDGF B-B, but not PDGF A-A. These findings suggest that the MAb 6D11 abolishes PDGF-induced DNA synthesis by blocking PDGF receptor binding. In this communication we demonstrate an isoform-specific monoclonal antibody against PDGF.
Impact of chromated copper arsenate (CCA) in wood mulch.
Townsend, Timothy G; Solo-Gabriele, Helena; Tolaymat, Thabet; Stook, Kristin
2003-06-20
The production of landscape mulch is a major market for the recycling of yard trash and waste wood. When wood recovered from construction and demolition (C&D) debris is used as mulch, it sometimes contains chromated copper arsenate (CCA)-treated wood. The presence of CCA-treated wood may cause some potential environmental problems as a result of the chromium, copper, and arsenic present. Research was performed to examine the leachability of the three metals from a variety of processed wood mixtures in Florida. The mixtures tested included mixed wood from C&D debris recycling facilities and mulch purchased from retail outlets. The synthetic precipitation leaching procedure (SPLP) was performed to examine the leaching of chromium, copper and arsenic. Results were compared to Florida's groundwater cleanup target levels (GWCTLs). Eighteen of the 22 samples collected from C&D debris processing facilities leached arsenic at concentrations greater than Florida's GWCTL of 50 microg/l. The mean leachable arsenic concentration for the C&D debris samples was 153 microg/l with a maximum of 558 microg/l. One of the colored mulch samples purchased from a retail outlet leached arsenic above 50 microg/l, while purchased mulch samples derived from virgin materials did not leach detectable arsenic (<5 microg/l). A mass balance approach was used to compute the potential metal concentrations (mg/kg) that would result from CCA-treated wood being present in wood mulch. Less than 0.1% CCA-treated wood would cause a mulch to exceed Florida's residential clean soil guideline for arsenic (0.8 mg/kg).
Electrodialytic remediation of CCA treated waste wood in pilot scale
DEFF Research Database (Denmark)
Pedersen, Anne Juul; Christensen, Iben Vernegren; Ottosen, Lisbeth M.
2005-01-01
study the utility of the method Electrodialytic Remediation was demonstrated for handling of CCA treated waste wood in pilot scale. The electrodialytic remediation method, which uses a low level DC current as the cleaning agent, combines elektrokinetic movement of ions in the wood matrix with the princi......-ples of electrodialysis. It has previously been shown that it is possible to remove Cu, Cr and As from CCA treated wood using electrodialytic remediation in laboratory scale (Ribeiro et al., 2000; Kristensen et al., 2003), but until now, the method had not been studied in larger scale. The pilot scale plant used...... in this study was designed to contain up to 2 m3 wood chips. Six remediation experiments were carried out. In these experiments, the process was up-scaled stepwise by increasing the distance between the electrodes from initially 60 cm to fi-nally 150 cm. The remediation time was varied between 11 and 21 days...
Outcome of the TURP-TUVP sandwich procedure for minimally ...
African Journals Online (AJOL)
shanker
TURP–TUVP sandwich procedure for the surgical treatment of BPH larger than 40cc in volume. 23 used was 21.5 L (SD = 4.9).The mean post-operative hospital stay was 3.5 days (range 3- 4 days). Overall,. 11 (19%) patients had blood transfusion, there was no incidence of TUR syndrome and one mortality was recorded ...
International Nuclear Information System (INIS)
Huh, Gil Cha; Suh, Hyun Suk; Lee, Hyuk Sang; Kim, Re Hwe; Kim, Chul Soo; Kim, Hong Yong; Kim, Sung Rok
1996-01-01
Purpose : To evaluate the potential advantage for 'sandwich' technique radiotherapy compared to postoperative radiotherapy in respectable rectal cancer. Between January 1989 and May 1994, 60 patients with respectable rectal cancer were treated at Inje University Seoul and Sanggye Paik Hospital.Fifty one patients were available for analysis : 20 patients were treated with sandwich technique radiotherapy and 31 patients were treated with postoperative radiotherapy. In sandwich technique radiotherapy(RT), patients were treated with preoperative RT 1500 cGy/5fx followed by immediate curative resection. Patients staged as Astler-Coller B2, C were considered for postoperative RT with 2500-4500 cGy. In postoperative RT, total radiation dose of 4500-6120 cGy, 180 cGy daily at 4-6 weeks was delivered. Patients were followed for median period of 25 months. Results : The overall 5-year survival rates for sandwich technique RT group and postoperative RT group were 60% and 71%, respectively(p>0.05). The 5-year disease free survival rates for each group were 63%. There was no difference in local failure rate between two groups(11% versus 7%). Incidence of distant metastasis was 11%(2/20) in the sandwich technique RT group and 20%(6/31) in the postoperative RT group(p>0.05). The frequencies of acute and chronic complications were comparable in both groups. Conclusion : The sandwich technique radiotherapy group shows local recurrence and survival similar to those of postoperative RT alone group but reduced distant metastasis compared to postoperative RT group. But long term follow-up and large number of patients is needed to make an any firm conclusion regarding the value of this sandwich technique RT
Giuntini, Serena; Reason, Donald C; Granoff, Dan M
2011-09-01
Binding of the complement-downregulating protein factor H (fH) to the surface of the meningococcus is important for survival of the organism in human serum. The meningococcal vaccine candidate factor H binding protein (fHbp) is an important ligand for human fH. While some fHbp-specific monoclonal antibodies (MAbs) block binding of fH to fHbp, the stoichiometry of blocking in the presence of high serum concentrations of fH and its effect on complement-mediated bactericidal activity are unknown. To investigate this question, we constructed chimeric antibodies in which the human IgG1 constant region was paired with three murine fHbp-specific binding domains designated JAR 3, JAR 5, and MAb502. By surface plasmon resonance, the association rates for binding of all three MAbs to immobilized fHbp were >50-fold higher than that for binding of fH to fHbp, and the MAb dissociation rates were >500-fold lower than that for fH. While all three MAbs elicited similar C1q-dependent C4b deposition on live bacteria (classical complement pathway), only those antibodies that inhibited binding of fH to fHbp (JAR 3 and JAR 5) had bactericidal activity with human complement. MAb502, which did not inhibit fH binding, had complement-mediated bactericidal activity only when tested with fH-depleted human complement. When an IgG1 anti-fHbp MAb binds to sparsely exposed fHbp on the bacterial surface, there appears to be insufficient complement activation for bacteriolysis unless fH binding also is inhibited. The ability of fHbp vaccines to elicit protective antibodies, therefore, is likely to be enhanced if the antibody repertoire is of high avidity and includes fH-blocking activity.
Utility poles not affected by CCA decision
Energy Technology Data Exchange (ETDEWEB)
De Venzio, H. [Arch Wood Protection Canada, Mississauga, ON (Canada)
2002-08-01
A voluntary decision by industry to move non-industrial use of treated lumber products away from pressure-treated wood containing chromated copper arsenate (CCA) preservative was announced by the Environmental Protection Agency on February 12, 2002. Although new alternative wood preservatives would be used, this decision does not affect utility poles, which will continue to be sold and installed. The author provides a brief historical outline concerning the creation of CCA in 1933 and its subsequent uses. CCA has many advantages, including clean surface of the poles, ground line treatment that is not required thus eliminating the requirement to rotate the poles during extended storage periods. Conductivity is low, as is corrosivity without affecting the bending characteristics of the wood. The injection of a refined hydrocarbon oil emulsion in the outer layer of the pole after the treatment with CCA is offered by some pole producers to facilitate gaff penetration. Sawing, drilling and nailing are also made easier. Water repellents can be added to the treating solution to improve climbability, slowing down the absorption and release of moisture. Warranties, extending for 50-year periods, are offered by some companies against wood-destroying organisms. The North American Wood Pole Coalition (NAWPC) was formed in 1998 to promote the use of wood poles, and publishes brochures and technical bulletins to that effect.
Histone H1(0) mapping using monoclonal antibodies.
Dousson, S; Gorka, C; Gilly, C; Lawrence, J J
1989-06-01
Monoclonal antibodies (mAb) to ox liver histone H1 degree were produced and characterized. Two sets of mice were immunized either with pure H1(0) or with an H1(0)-yeast tRNA complex. Eleven hybridomas of various clonal origin were selected. Typing of the antibodies indicated that all but three IgM belonged to the IgG1 class and contained kappa light chains. Immunoblotting experiments using peptides derived from H1(0) or H5 treated by various proteolytic agents (trypsin, N-bromosuccinimide, cyanogen bromide, acetic acid), revealed that nine of the mAb reacted with the globular part of H1(0). More advanced characterization of the antigenic determinants allowed us to determine distinct regions within this globular part which are involved in the antigenic recognition. The peptopes could be subdivided into two groups. Three mAb bound to residues 24-27 and were specific for H1(0). Six mAb bound to residues 27-30 and were specific for H1(0) except one of them which strongly cross-reacted with H5 and GH5. Two mAb reacted with the entire histone H1(0) but failed to react with any of the peptides, suggesting that the corresponding epitope is a conformational antigenic determinant. In order to confirm the localization of the two distinct regions which are involved in the antigenic recognition, a synthetic decapeptide corresponding to the beginning of human H1(0) globular part (from residue 19 to residue 28) was synthesized. Inhibition experiments of the reaction between H1(0) and the various IgG1 mAb by increasing amounts of peptide-bovine serum albumin conjugates were then performed.
Directory of Open Access Journals (Sweden)
Krzysztof Lyczko
2013-01-01
Full Text Available The asymmetric unit of the title compound, C11H12N2O·C25H28N4O2, contains two different molecules. The smaller is known as antipyrine [systematic name: 1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one] and the larger is built up from two antypirine molecules which are connected through a C atom of the pyrazolone ring to a central propanyl part [systematic name: 4,4′-(propane-2,2-diylbis[1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one]. Intramolecular C—H...O hydrogen bonds occur in the latter molecule. In the crystal, C—H...O hydrogen bonds link the molecules into a two-dimensional network parallel to (001.
Graphene/h-BN/GaAs sandwich diode as solar cell and photodetector.
Li, Xiaoqiang; Lin, Shisheng; Lin, Xing; Xu, Zhijuan; Wang, Peng; Zhang, Shengjiao; Zhong, Huikai; Xu, Wenli; Wu, Zhiqian; Fang, Wei
2016-01-11
In graphene/semiconductor heterojunction, the statistic charge transfer between graphene and semiconductor leads to decreased junction barrier height and limits the Fermi level tuning effect in graphene, which greatly affects the final performance of the device. In this work, we have designed a sandwich diode for solar cells and photodetectors through inserting 2D hexagonal boron nitride (h-BN) into graphene/GaAs heterostructure to suppress the static charge transfer. The barrier height of graphene/GaAs heterojunction can be increased from 0.88 eV to 1.02 eV by inserting h-BN. Based on the enhanced Fermi level tuning effect with interface h-BN, through adopting photo-induced doping into the device, power conversion efficiency (PCE) of 10.18% has been achieved for graphene/h-BN/GaAs compared with 8.63% of graphene/GaAs structure. The performance of graphene/h-BN/GaAs based photodetector is also improved with on/off ratio increased by one magnitude compared with graphene/GaAs structure.
Protective mAbs and Cross-Reactive mAbs Raised by Immunization with Engineered Marburg Virus GPs.
Directory of Open Access Journals (Sweden)
Marnie L Fusco
2015-06-01
Full Text Available The filoviruses, which include the marburg- and ebolaviruses, have caused multiple outbreaks among humans this decade. Antibodies against the filovirus surface glycoprotein (GP have been shown to provide life-saving therapy in nonhuman primates, but such antibodies are generally virus-specific. Many monoclonal antibodies (mAbs have been described against Ebola virus. In contrast, relatively few have been described against Marburg virus. Here we present ten mAbs elicited by immunization of mice using recombinant mucin-deleted GPs from different Marburg virus (MARV strains. Surprisingly, two of the mAbs raised against MARV GP also cross-react with the mucin-deleted GP cores of all tested ebolaviruses (Ebola, Sudan, Bundibugyo, Reston, but these epitopes are masked differently by the mucin-like domains themselves. The most efficacious mAbs in this panel were found to recognize a novel "wing" feature on the GP2 subunit that is unique to Marburg and does not exist in Ebola. Two of these anti-wing antibodies confer 90 and 100% protection, respectively, one hour post-exposure in mice challenged with MARV.
Rajak, Poonam; Vijayalakshmi, M A; Jayaprakash, N S
2013-05-05
Proteins present in human serum are of immense importance in the field of biomarker discovery. But, the presence of high-abundant proteins like albumin makes the analysis more challenging because of masking effect on low-abundant proteins. Therefore, removal of albumin using highly specific monoclonal antibodies (mAbs) can potentiate the discovery of low-abundant proteins. In the present study, mAbs against human serum albumin (HSA) were developed and integrated in to an immunoaffinity based system for specific removal of albumin from the serum. Hybridomas were obtained by fusion of Sp2/0 mouse myeloma cells with spleen cells from the mouse immunized with HSA. Five clones (AHSA1-5) producing mAbs specific to HSA were established and characterized by enzyme linked immunosorbent assay (ELISA) and immunoblotting for specificity, sensitivity and affinity in terms of antigen binding. The mAbs were able to bind to both native albumin as well as its glycated isoform. Reactivity of mAbs with different mammalian sera was tested. The affinity constant of the mAbs ranged from 10(8) to 10(9)M(-1). An approach based on oriented immobilization was followed to immobilize purified anti-HSA mAbs on hydrazine activated agarose gel and the dynamic binding capacity of the column was determined. Copyright © 2013 Elsevier B.V. All rights reserved.
Evaluation of commercial landscaping mulch for possible contamination from CCA.
Jacobi, Gary; Solo-Gabriele, Helena; Dubey, Brajesh; Townsend, Timothy; Shibata, Tomoyuki
2007-01-01
Wood treated with chromated copper arsenate (CCA) is found in construction and demolition (C&D) debris, and a common use for wood recycled from C&D debris is the production of mulch. Given the high metals concentrations in CCA-treated wood, a small fraction of CCA-treated wood can increase the metal concentrations in the mulch above regulatory thresholds. The objective of this study was to determine the extent of contamination of CCA-treated wood in consumer landscaping mulch and to determine whether visual methods or rapid X-ray fluorescence (XRF) technology can be used to identify suspect mulch. Samples were collected throughout the State of Florida (USA) and evaluated both visually and chemically. Visual analysis focused on documenting wood-chip size distribution, whether the samples were artificially colored, and whether they contained plywood chips which is an indication that the sample was, in part, made from recycled C&D wood. Chemical analysis included measurements of total recoverable metals, leachable metals as per the standardized synthetic precipitation leaching procedure (SPLP), and XRF analysis. Visual identification methods, such as colorant addition or presence of plywood, were found effective to preliminarily screen suspect mulch. XRF analysis was found to be effective for identifying mulch containing higher than 75 mg/kg arsenic. For mulch samples that were not colored and did not contain evidence of C&D wood, none exceeded leachable metal concentrations of 50 microg/L and only 3% exceeded 10 mg/kg for recoverable metals. The majority of the colored mulch made from recycled C&D wood contained from 1% to 5% CCA-treated wood (15% maximum fraction) resulting in leachable metals in excess of 50 microg/L and total recoverable metals in excess of 10 mg/kg. The maximum arsenic concentration measured in the mulch samples evaluated was 230 mg/kg, which was above the Florida residential direct exposure regulatory guideline of 2.1 mg/kg.
Satoh, Ryoichi; Kaku, Ayumi; Satomura, Megumi; Kohori, Michiyo; Noura, Kanako; Furukawa, Tomoko; Kotake, Masako; Takano, Tomomi; Hohdatsu, Tsutomu
2011-06-01
Feline infectious peritonitis virus (FIPV) can cause a lethal disease in cats, feline infectious peritonitis (FIP). The antibody-dependent enhancement (ADE) of FIPV infection has been recognised in experimentally infected cats, and cellular immunity is considered to play an important role in preventing the onset of FIP. To evaluate the importance of cellular immunity for FIPV infection, monoclonal antibodies (MAbs) against feline interferon (fIFN)-γ were first created to establish fIFN-γ detection systems using the MAbs. Six anti-fIFN-γ MAbs were created. Then, the difference in epitope which those MAbs recognise was demonstrated by competitive enzyme-linked immunosorbent assay (ELISA) and IFN-γ neutralisation tests. Detection systems for fIFN-γ (sandwich ELISA, ELISpot assay, and two-colour flow cytometry) were established using anti-fIFN-γ MAbs that recognise different epitopes. In all tests, fIFN-γ production from peripheral blood mononuclear cells (PBMCs) obtained from cats experimentally infected with an FIPV isolate that did not develop the disease was significantly increased by heat-inactivated FIPV stimulation in comparison with medium alone. Especially, CD8(+)fIFN-γ(+) cells, but not CD4(+)fIFN-γ(+) cells, were increased. In contrast, fIFN-γ production from PBMCs isolated from cats that had developed FIP and specific pathogen-free (SPF) cats was not increased by heat-inactivated FIPV stimulation. These results suggest that cellular immunity plays an important role in preventing the development of FIP. Measurement of fIFN-γ production with the anti-fIFN-γ MAbs created in this study appeared to be useful in evaluating cellular immunity in cats. Copyright © 2011 ISFM and AAFP. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wang, Jian-Zheng, E-mail: wppzheng@126.com [Laboratory of Biomedical Material Engineering, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, 457 Zhongshan Road, Dalian 116023 (China); Affiliated General Hospital, Tianguan Group Co., Ltd, Nanyang 473000 (China); Testing Center of Henan Tianguan Group Co., Ltd, Nanyang 473000 (China); Zhu, Yu-Xia [Laboratory of Biomedical Material Engineering, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, 457 Zhongshan Road, Dalian 116023 (China); Affiliated General Hospital, Tianguan Group Co., Ltd, Nanyang 473000 (China); Testing Center of Henan Tianguan Group Co., Ltd, Nanyang 473000 (China); Ma, Hui-Chao; Chen, Si-Nan; Chao, Ji-Ye; Ruan, Wen-Ding; Wang, Duo; Du, Feng-guang [Affiliated General Hospital, Tianguan Group Co., Ltd, Nanyang 473000 (China); Testing Center of Henan Tianguan Group Co., Ltd, Nanyang 473000 (China); Meng, Yue-Zhong [State Key Laboratory of Optoelectronic Materials and Technologies, Sun Yat-sen University, Guangzhou 510275 (China)
2016-05-01
In this work, a 3D MCTS-CCA system was constructed by culturing multi-cellular tumor spheroid (MCTS) in the chitosan/collagen/alginate (CCA) fibrous scaffold for anticancer drug screening. The CCA scaffolds were fabricated by spray-spinning. The interactions between the components of the spray-spun fibers were evidenced by methods of Coomassie Blue stain, X-ray diffraction (XRD) and Fourier transform-infrared spectroscopy (FTIR). Co-culture indicated that MCF-7 cells showed a spatial growth pattern of multi-cellular tumor spheroid (MCTS) in the CCA fibrous scaffold with increased proliferation rate and drug-resistance to MMC, ADM and 5-Aza comparing with the 2D culture cells. Significant increases of total viable cells were found in 3D MCTS groups after drug administration by method of apoptotic analysis. Glucose–lactate analysis indicated that the metabolism of MCTS in CCA scaffold was closer to the tumor issue in vivo than the monolayer cells. In addition, MCTS showed the characteristic of epithelial mesenchymal transition (EMT) which is subverted by carcinoma cells to facilitate metastatic spread. These results demonstrated that MCTS in CCA scaffold possessed a more conservative phenotype of tumor than monolayer cells, and anticancer drug screening in 3D MCTS-CCA system might be superior to the 2D culture system. - Highlights: • Chitosan/collagen/alginate (CCA) scaffolds were fabricated by spray-spinning. • MCF-7 cells presented a multi-cellular tumor spheroid model (MCTS) in CCA scaffold. • MCTS in CCA possessed a more conservative phenotype of tumor than monolayer cells. • Anticancer drug screening in MCTS-CCA system is superior to 2D culture system.
International Nuclear Information System (INIS)
Wang, Jian-Zheng; Zhu, Yu-Xia; Ma, Hui-Chao; Chen, Si-Nan; Chao, Ji-Ye; Ruan, Wen-Ding; Wang, Duo; Du, Feng-guang; Meng, Yue-Zhong
2016-01-01
In this work, a 3D MCTS-CCA system was constructed by culturing multi-cellular tumor spheroid (MCTS) in the chitosan/collagen/alginate (CCA) fibrous scaffold for anticancer drug screening. The CCA scaffolds were fabricated by spray-spinning. The interactions between the components of the spray-spun fibers were evidenced by methods of Coomassie Blue stain, X-ray diffraction (XRD) and Fourier transform-infrared spectroscopy (FTIR). Co-culture indicated that MCF-7 cells showed a spatial growth pattern of multi-cellular tumor spheroid (MCTS) in the CCA fibrous scaffold with increased proliferation rate and drug-resistance to MMC, ADM and 5-Aza comparing with the 2D culture cells. Significant increases of total viable cells were found in 3D MCTS groups after drug administration by method of apoptotic analysis. Glucose–lactate analysis indicated that the metabolism of MCTS in CCA scaffold was closer to the tumor issue in vivo than the monolayer cells. In addition, MCTS showed the characteristic of epithelial mesenchymal transition (EMT) which is subverted by carcinoma cells to facilitate metastatic spread. These results demonstrated that MCTS in CCA scaffold possessed a more conservative phenotype of tumor than monolayer cells, and anticancer drug screening in 3D MCTS-CCA system might be superior to the 2D culture system. - Highlights: • Chitosan/collagen/alginate (CCA) scaffolds were fabricated by spray-spinning. • MCF-7 cells presented a multi-cellular tumor spheroid model (MCTS) in CCA scaffold. • MCTS in CCA possessed a more conservative phenotype of tumor than monolayer cells. • Anticancer drug screening in MCTS-CCA system is superior to 2D culture system.
International Nuclear Information System (INIS)
Pereira Junior, Sergio Matias; Salvador, Vera Lucia Ribeiro; Sato, Ivone Mulako
2013-01-01
Brazil produces around 1,2 mi m 3 of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most used wood species are eucalyptus (Eucaliptus ssp)and pine (Pinus ssp). The most wood preservative products used in Brazil are CCA (Chromated Copper Arsenate) and CCB (Copper Chromium and Boron Salt). The analytical methods, such as Flame Atomic Absorption Spectrometry (FAAS) and Plasma Inductively Coupled Optical Emission Spectrometry (ICPOES) have been used for the evaluation of those treatment processes. In this work, the sapwood sample was obtained from eucalyptus trees (Eucaliptus ssp) obtained from Minas Gerais State, Brazil, cut plantation areas. Sawdust sapwood sample was grounded and submitted to different additions of CCA solutions (0.2, 0.7, 1.3, 2.3, 3.6, 6.3, 11.7and17.9 kg m -3 ). Power and pressed pellets sapwood samples, analyzed by EDXRFS, showed a good linear relation (r 2 >0.99) between the characteristic intensity fluorescent lines (CuΚα, CrΚαand AsΚΒ) and their concentration, also, showed adequate sensitivity (LQ -1 ) for Cu, Cr and As determination in treated woods. Cu, Cr and As were determined in powdered sawdust samples by FAA spectrometry, using the AWPA A11-93 standard method; the relation between the CCA retention and their concentration showed a lower linear relation than EDXRFS; the FAAS spreading result could be attributed to laboratorial CCA addition process. (author)
Caracterización de las cibercomunidades de aprendizaje (cCA
Directory of Open Access Journals (Sweden)
Iñaki Murua Anzola
2015-01-01
Full Text Available En este artículo se presentan los principales resultados de la investigación exploratoria llevada a cabo sobre las cibercomunidades de aprendizaje (cCA y la formación del profesorado aplicando , entre otros, el método Delphi; e l marco teórico y contextual de la misma se presentó en el número 43 de la revista RED. Los participantes de l panel de expertos han sido 31 encuestados online con el instrumento Delphi - cCA, y 19 respo nsables de comunidades que han contestado al cuestionario - cCA. Entre los principales resultados se destacan las condiciones para la creación y desarrollo de cCA, las herramientas y funcionalidades de las comunidades y las tipologías de participación ( perso nas implicadas, activas, pasivas y ausentes.
International Nuclear Information System (INIS)
Polyanskaya, T.M.
2006-01-01
A monocrystal X-ray diffraction study of a new iodine-containing cluster compound 9-(pyridine)-11-iodo-decahydro-7,8-dicarba-nido-undecaborane [9-C 5 H 5 N-11-I-7,8-C 2 B 9 H 10 ] has been performed. Crystal data: C 7 H 15 B 9 NI, M = 337.39, monoclinic, space group P2 1 /c, unit cell parameters: a=9.348(1) A, b=11.159(1) A, c=13.442(2) A, β=98.13(1) deg, V=1388.1(5) A 3 , Z=4, d calc = 1.614 g/cm 3 , T = 295 K, F(000)=648, μ=2.276 mm -1 . The structure was solved by a direct method and refined in the full-matrix anisotropic approximation (isotropic for hydrogen atoms) to final agreement factors R 1 = 0.0254, wR 2 = 0.0454 for 2437 I hkl >2σ I from 3590 measured I hkl (an Enraf-Nonius CAD-4 diffractometer, λMoK α , graphite monochromator, θ/2θ-scanning). The molecules are joined into a supramolecular assembly by hydrogen bonds X-H...I (X = B, C) [ru
Testing of the scintillation sandwich prototype
International Nuclear Information System (INIS)
Vashkevich, V.
1995-06-01
The 3 m 2 prototype of the surface detector using optical fiber readout was completely prepared for testing measurements in February 1995 at Fermilab. Two 25 mm thick, 3 m 2 acrylic scintillation plates (1.2 x 2.5 m 2 ) are used for light collection in the upper (above the 25 mm steel plate) and lower (below the steel) counters of the sandwich. The light is collected with the help of 1 mm diameter wavelength shifter fiber loops 3 m long inserted in the grooves on the top surface of the scintillator, 3 fibers per groove. We used Kurary Y11, 200 ppm of shifter dye, and double clad fibers. 1.5 m of clear fibers spliced to each end of the shifter fiber transport the light to the phototube. Spacing between the grooves is 5 cm. The counter's edges were painted with BICRON (BC620) white reflective paint. The scintillation plates were wrapped with Dupont Tyvek. The glued bundle of fibers is connected to an EMI-9902KB 38 mm phototube through the simple light mixer bar. Used PM has a ''green extended'' rubidium bialkali photocathode. The report contains information on the testing of the scintillation sandwich
Half-sandwich cobalt complexes in the metal-organic chemical vapor deposition process
Energy Technology Data Exchange (ETDEWEB)
Georgi, Colin [Technische Universität Chemnitz, Faculty of Natural Science, Institute of Chemistry, Inorganic Chemistry, Chemnitz 09107 (Germany); Hapke, Marko; Thiel, Indre [Leibniz-Institut für Katalyse e.V. an der Universität Rostock (LIKAT), Albert-Einstein-Straße 29a, Rostock 18059 (Germany); Hildebrandt, Alexander [Technische Universität Chemnitz, Faculty of Natural Science, Institute of Chemistry, Inorganic Chemistry, Chemnitz 09107 (Germany); Waechtler, Thomas; Schulz, Stefan E. [Fraunhofer Institute of Electronic Nano Systems (ENAS), Technologie-Campus 3, Chemnitz 09126 (Germany); Technische Universität Chemnitz, Center for Microtechnologies (ZfM), Chemnitz 09107 (Germany); Lang, Heinrich, E-mail: heinrich.lang@chemie.tu-chemnitz.de [Technische Universität Chemnitz, Faculty of Natural Science, Institute of Chemistry, Inorganic Chemistry, Chemnitz 09107 (Germany)
2015-03-02
A series of cobalt half-sandwich complexes of type [Co(η{sup 5}-C{sub 5}H{sub 5})(L)(L′)] (1: L, L′ = 1,5-hexadiene; 2: L = P(OEt){sub 3}, L′ = H{sub 2}C=CHSiMe{sub 3}; 3: L = L′ = P(OEt){sub 3}) has been studied regarding their physical properties such as the vapor pressure, decomposition temperature and applicability within the metal-organic chemical vapor deposition (MOCVD) process, with a focus of the influence of the phosphite ligands. It could be shown that an increasing number of P(OEt){sub 3} ligands increases the vapor pressure and thermal stability of the respective organometallic compound. Complex 3 appeared to be a promising MOCVD precursor with a high vapor pressure and hence was deposited onto Si/SiO{sub 2} (100 nm) substrates. The resulting reflective layer is closed, dense and homogeneous, with a slightly granulated surface morphology. X-ray photoelectron spectroscopy (XPS) studies demonstrated the formation of metallic cobalt, cobalt phosphate, cobalt oxide and cobalt carbide. - Highlights: • Thermal studies and vapor pressure measurements of cobalt half-sandwich complexes was carried out. • Chemical vapor deposition with cobalt half-sandwich complexes is reported. • The use of Co-phosphites results in significant phosphorous-doped metallic layers.
Podocyte changes upon induction of albuminuria in Thy-1.1 transgenic mice.
Smeets, Bart; Dijkman, Henry B P M; te Loeke, Nathalie A J M; van Son, Jacco P H F; Steenbergen, Eric J; Assmann, Karel J M; Wetzels, Jack F M; Groenen, Patricia J T A
2003-12-01
Thy-1.1 transgenic mice, characterized by ectopic expression of the Thy-1.1 protein on podocytes, spontaneously develop proteinuria and focal glomerulosclerosis (FGS). Injection of a monoclonal antibody (mAb) directed against the Thy-1.1 protein in young transgenic mice induces a massive albuminuria that is followed by an accelerated FGS within 3 weeks. This albuminuria is complement and leukocyte independent. The time course of proteinuria, the pathogenesis of the acute proteinuria and the dose dependency of FGS are unknown. Albuminuria was measured in Thy-1.1 transgenic mice after injection of different doses of anti-Thy-1.1 mAb and at different time points within the first 24 h after injection. Podocytic foot processes and slit pore diameter were quantitated by electron microscopy. Changes in expression of slit pore constituents (podocin, CD2AP, nephrin and ZO-1), cytoskeleton-associated proteins (actin, alpha-actinin, ezrin and synaptopodin), the GDH-podocyte adhesion molecules alpha(3)-integrin, and heparan sulfate were studied by immunofluorescence. FGS was scored by light microscopy at 3 weeks after induction of albuminuria. Albuminuria in Thy-1.1 transgenic mice was observed within 10 min after anti-Thy-1.1 mAb injection. This rapid development of albuminuria was accompanied by a reduction in number of podocytic foot processes from 20.0 +/- 0.7/10 microm glomerular basement membrane (GBM) in saline-treated transgenic mice to 8.0 +/- 0.5 and 2.2 +/- 0.2 in anti-Thy-1.1-treated mice, at 10 min and 8 h after treatment, respectively. In addition, we observed a significant decrease in width of remaining slit pores, from 32.7 +/- 1.1 to 26.8 +/- 1.4 nm at 10 min after mAb injection. By immunofluorescence, we did not observe major changes in the expression pattern of any of the proteins studied. There was no correlation between the injected dose of the anti-Thy-1.1 mAb and the acute albuminuria. In contrast, the percentage of FGS at 3 weeks correlated with the
Energy Technology Data Exchange (ETDEWEB)
Janin, Amelie, E-mail: amelie.janin@ete.inrs.ca [University of Toronto, Faculty of Forestry, 33, Willcocks St., Toronto, ON, M5S 3B3 (Canada); Coudert, Lucie, E-mail: lucie.coudert@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Riche, Pauline, E-mail: pauline.riche@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Mercier, Guy, E-mail: guy_mercier@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Cooper, Paul, E-mail: p.cooper@utoronto.ca [University of Toronto, Faculty of Forestry, 33, Willcocks St., Toronto, ON, M5S 3B3 (Canada); Blais, Jean-Francois, E-mail: blaisjf@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada)
2011-02-28
Research highlights: {yields} This paper describes a process for the metal removal from treated (CA-, ACQ- or MCQ-) wood wastes. {yields} This sulfuric acid leaching process is simple and economic. {yields} The remediated wood could be recycled in the industry. - Abstract: Chromated copper arsenate (CCA)-treated wood was widely used until 2004 for residential and industrial applications. Since 2004, CCA was replaced by alternative copper preservatives such as alkaline copper quaternary (ACQ), copper azole (CA) and micronized copper quaternary (MCQ), for residential applications due to health concerns. Treated wood waste disposal is becoming an issue. Previous studies identified a chemical process for decontaminating CCA-treated wood waste based on sulfuric acid leaching. The potential application of this process to wood treated with the copper-based preservatives (alkaline copper quaternary (ACQ), copper azole (CA) and micronized copper quaternary (MCQ)) is investigated here. Three consecutive leaching steps with 0.1 M sulfuric acid at 75 deg, C for 2 h were successful for all the types of treated wood and achieved more than 98% copper solubilisation. The different acidic leachates produced were successively treated by coagulation using ferric chloride and precipitation (pH = 7) using sodium hydroxide. Between 94 and 99% of copper in leachates could be recovered by electrodeposition after 90 min using 2 A electrical current. Thus, the process previously developed for CCA-treated wood waste decontamination could be efficiently applied for CA-, ACQ- or MCQ-treated wood.
Lifescience Database Archive (English)
Full Text Available H00660 Congenital contractural arachnodactyly (CCA); Beals syndrome Congenital contract...-like appearance and arachnodactyly. Most affected individuals have 'crumpled' ears, contractures of major j...z DM ... TITLE ... Fibrillin-2 (FBN2) mutations result in the Marfan-like disorder, congenital contractural arachnodactyly. ... JOURNAL ... Nat Genet 11:456-8 (1995) DOI:10.1038/ng1295-456 ...
Measuring Cohesive Laws for Interfaces in Sandwich Structures
DEFF Research Database (Denmark)
Lundsgaard-Larsen, Christian; Sørensen, Bent F.; Berggreen, Carl Christian
2006-01-01
mixities. The sandwich specimens consists of glass fiber faces and Divinycell H200 foam core with a pre-crack between face and core made with teflon film. Arbitrary stiffening of the sandwich faces with steel bars adhered to the faces reduces rotations and ensures that the method is useable for a wide...
Mechanical and chemical properties of CCA-treated lumber removed from spent residential decks
Robert L. Smith; David Bailey; Philip A. Araman
2007-01-01
The amount of chromated copper arsenate (CCA)- treated wood being removed from spent residential decks is increasing at a tremendous rate. While most spent CCA-treated wood is being disposed in landfills, further useful and environmentally beneficial alternatives have to be met. If the volume of CCA-treated wood reaching landfills continues to rise, stricter disposal...
Wang, Jian-Zheng; Zhu, Yu-Xia; Ma, Hui-Chao; Chen, Si-Nan; Chao, Ji-Ye; Ruan, Wen-Ding; Wang, Duo; Du, Feng-guang; Meng, Yue-Zhong
2016-05-01
In this work, a 3D MCTS-CCA system was constructed by culturing multi-cellular tumor spheroid (MCTS) in the chitosan/collagen/alginate (CCA) fibrous scaffold for anticancer drug screening. The CCA scaffolds were fabricated by spray-spinning. The interactions between the components of the spray-spun fibers were evidenced by methods of Coomassie Blue stain, X-ray diffraction (XRD) and Fourier transform-infrared spectroscopy (FTIR). Co-culture indicated that MCF-7 cells showed a spatial growth pattern of multi-cellular tumor spheroid (MCTS) in the CCA fibrous scaffold with increased proliferation rate and drug-resistance to MMC, ADM and 5-Aza comparing with the 2D culture cells. Significant increases of total viable cells were found in 3D MCTS groups after drug administration by method of apoptotic analysis. Glucose-lactate analysis indicated that the metabolism of MCTS in CCA scaffold was closer to the tumor issue in vivo than the monolayer cells. In addition, MCTS showed the characteristic of epithelial mesenchymal transition (EMT) which is subverted by carcinoma cells to facilitate metastatic spread. These results demonstrated that MCTS in CCA scaffold possessed a more conservative phenotype of tumor than monolayer cells, and anticancer drug screening in 3D MCTS-CCA system might be superior to the 2D culture system. Copyright © 2016 Elsevier B.V. All rights reserved.
Carcinogenic risk of chromium, copper and arsenic in CCA-treated wood
International Nuclear Information System (INIS)
Ohgami, Nobutaka; Yamanoshita, Osamu; Thang, Nguyen Dinh; Yajima, Ichiro; Nakano, Chihiro; Wenting, Wu; Ohnuma, Shoko
2015-01-01
We showed that 2.1% of 233 pieces of lumber debris after the Great East Japan Earthquake was chromated copper arsenate (CCA)-treated wood. Since hexavalent chromium (Cr), copper (Cu) and pentavalent arsenic (As) in the debris may be diffused in the air via incineration, we exposed human lung normal (BEAS-2B) and carcinoma (A549) cells to Cr, Cu and As at the molar ratio in a representative CCA-treated wood. Co-exposure to 0.10 μM Cr and 0.06 μM As, which solely had no effect on colony formation, synergistically promoted colony formation in BEAS-2B cells, but not A549 cells, with activation of the PI3K/AKT pathway. Sole exposure and co-exposure to Cu showed limited effects. Since previous reports showed Cr and As concentrations to which human lungs might be exposed, our results suggest the importance to avoid diffusion of Cr and As in the air via incineration of debris including CCA-treated wood after the disaster. - Highlights: • CCA-treated wood was found in debris after the Great East Japan Earthquake in 2011. • Carcinogenic risk of CCA-treated woods was evaluated with human lung cell lines. • Co-exposure to Cr and As synergistically promoted colony formation. • Co-exposure to Cr and As synergistically activated the PI3/AKT pathway. • Effects of sole exposure and co-exposure to Cu on colony formation were limited. - Co-exposure to Cr and As, but not Cu, in CCA-treated wood debris from the Great East Japan Earthquake showed carcinogenicity in vitro.
Seepiban, Channarong; Charoenvilaisiri, Saengsoon; Warin, Nuchnard; Bhunchoth, Anjana; Phironrit, Namthip; Phuangrat, Bencharong; Chatchawankanphanich, Orawan; Attathom, Supat; Gajanandana, Oraprapai
2017-05-30
Tomato yellow leaf curl Thailand virus, TYLCTHV, is a begomovirus that causes severe losses of tomato crops in Thailand as well as several countries in Southeast and East Asia. The development of monoclonal antibodies (MAbs) and serological methods for detecting TYLCTHV is essential for epidemiological studies and screening for virus-resistant cultivars. The recombinant coat protein (CP) of TYLCTHV was expressed in Escherichia coli and used to generate MAbs against TYLCTHV through hybridoma technology. The MAbs were characterized and optimized to develop triple antibody sandwich enzyme-linked immunosorbent assays (TAS-ELISAs) for begomovirus detection. The efficiency of TAS-ELISAs for begomovirus detection was evaluated with tomato, pepper, eggplant, okra and cucurbit plants collected from several provinces in Thailand. Molecular identification of begomoviruses in these samples was also performed through PCR and DNA sequence analysis of the CP gene. Two MAbs (M1 and D2) were generated and used to develop TAS-ELISAs for begomovirus detection. The results of begomovirus detection in 147 field samples indicated that MAb M1 reacted with 2 begomovirus species, TYLCTHV and Tobacco leaf curl Yunnan virus (TbLCYnV), whereas MAb D2 reacted with 4 begomovirus species, TYLCTHV, TbLCYnV, Tomato leaf curl New Delhi virus (ToLCNDV) and Squash leaf curl China virus (SLCCNV). Phylogenetic analyses of CP amino acid sequences from these begomoviruses revealed that the CP sequences of begomoviruses recognized by the narrow-spectrum MAb M1 were highly conserved, sharing 93% identity with each other but only 72-81% identity with MAb M1-negative begomoviruses. The CP sequences of begomoviruses recognized by the broad-spectrum MAb D2 demonstrated a wider range of amino acid sequence identity, sharing 78-96% identity with each other and 72-91% identity with those that were not detected by MAb D2. TAS-ELISAs using the narrow-specificity MAb M1 proved highly efficient for the detection of
Extant contents of chromium, copper and arsenic in waste CCA-treated timber
International Nuclear Information System (INIS)
Chiba, Keiko; Uchida, Shinpei; Honma, Yoshinori; Sera, Koichiro; Saitoh, Katsumi
2009-01-01
The segregation and disposal of chromated copper arsenate (CCA)-treated wood waste when recycling building waste materials is a serious issue. We examined the contents of CCA preserved cedar timber by PIXE analysis. CCA preserved timber contained large amounts of these metals both on the surface and core of the wood. The ratio of chromium, copper and arsenic contained on the surface was 1:2:1, and in contrast, the ratio in the core was 1:1:2. In other words, the arsenic content was highest in the core. Moreover, the chemical form of arsenic in both parts of the wood was only inorganic arsenic; the same form of arsenic in preservative components known as carcinogenic substances. These findings mean that the complete separation of waste CCA preserved timber from construction and demolition wood is needed. (author)
REMOVAL COPPER, CHROMIUM, ARSENIC FROM OUT-OF- SERVICE CCA-TREATED WOOD MATERIALS
Directory of Open Access Journals (Sweden)
Engin Derya Gezer
2004-11-01
Full Text Available Remediation can be defined as removing copper, chromium and arsenic from out-of-service CCA treated wood products. There are some various remediation methods that can be applied to remove copper, chromium and arsenic from out-of service CCA treated wood products in order to re-use that wooden materials and minimize adverse impacts of those out-of service CCA treated wood to environment, human health, animals and other living organisms. In this study, those applied various remediation methods to remove copper, chromium and arsenic were summarized.
Directory of Open Access Journals (Sweden)
Ayele B.
2008-03-01
Full Text Available A total of 206 urine samples collected from Hassoba Elementary schoolchildren, Afar, Ethiopia, a low Schistosoma haematobium endemic setting, was diagnosed to evaluate the performance of CCA strip using double references, urine filtration technique and urinalysis dipstick (Combur 10 Test® that detect schistosome eggs and blood in urine, respectively. The former was used as a gold standard reference method. Sensitivity, specificity, positive and negative predictive values for the CCA were 52%, 63.8%, 56.7% and 59% respectively, with reference to urine filtration technique whereas these parameters were 50.4%, 62.4%, 55.6% and 57.5% respectively, with reference to Combur 10 Test®. 47 S. haematobium egg-positive children were found negative by CCA strip while 38 egg-negative children were found positive by CCA strip. Moreover, among the pre-tests done in duplicate, inconsistent results were also recorded. Assays were also compared with regard to the cost of equipment and reagents, speed and simplicity of use. Though CCA strip was found to be rapid and could be performed with minimal training, it was found to be expensive (US $ 4.95 per test to use it for large-scale field use even if its diagnostic value would have been satisfactory. Further development and standardization of the CCA strip are required for its applicability for field use. It is also recommended that its cost per strip should be substantially cut down if it is to be used in poor schistosomiasis endemic countries.
Jiao, Yong; Zhang, Yu; Wang, Yu; Wang, Bei; Jin, Jing; Wang, Xingyu
2018-05-01
Multiset canonical correlation analysis (MsetCCA) has been successfully applied to optimize the reference signals by extracting common features from multiple sets of electroencephalogram (EEG) for steady-state visual evoked potential (SSVEP) recognition in brain-computer interface application. To avoid extracting the possible noise components as common features, this study proposes a sophisticated extension of MsetCCA, called multilayer correlation maximization (MCM) model for further improving SSVEP recognition accuracy. MCM combines advantages of both CCA and MsetCCA by carrying out three layers of correlation maximization processes. The first layer is to extract the stimulus frequency-related information in using CCA between EEG samples and sine-cosine reference signals. The second layer is to learn reference signals by extracting the common features with MsetCCA. The third layer is to re-optimize the reference signals set in using CCA with sine-cosine reference signals again. Experimental study is implemented to validate effectiveness of the proposed MCM model in comparison with the standard CCA and MsetCCA algorithms. Superior performance of MCM demonstrates its promising potential for the development of an improved SSVEP-based brain-computer interface.
Cao, Zhen; Zhang, Wei; Ning, Xiangxue; Wang, Baomin; Liu, Yunjun; Li, Qing X
2017-11-22
Bacillus thuringiensis Cry1Ac, Cry1Ia1, and Cry1Ie are δ-endotoxin insecticidal proteins widely implemented in genetically modified organisms (GMO), such as cotton, maize, and potato. Western blot assay integrates electrophoresis separation power and antibody high specificity for monitoring specific exogenous proteins expressed in GMO. Procedures for evoking monoclonal antibody (mAb) for Western blot were poorly documented. In the present study, Cry1Ac partially denatured at 100 °C for 5 min was used as an immunogen to develop mAbs selectively recognizing a linear epitope of Cry1Ac for Western blot. mAb 5E9C6 and 3E6E2 selected with sandwich ELISA strongly recognized the heat semidenatured Cry1Ac. Particularly, 3E6E2 recognized both E. coli and cotton seed expressed Cry1Ac in Western blot. Such strategy of using partially denatured proteins as immunogens and using sandwich ELISA for mAb screening was also successfully demonstrated with production of mAbs against Cry1Ie for Western blot assay in maize.
Directory of Open Access Journals (Sweden)
Larry H. Stanker
2013-11-01
Full Text Available Botulism is a serious foodborne neuroparalytic disease, caused by botulinum neurotoxin (BoNT, produced by the anaerobic bacterium Clostridium botulinum. Seven toxin serotypes (A–H have been described. The majority of human cases of botulism are caused by serotypes A and B followed by E and F. We report here a group of serotype B specific monoclonal antibodies (mAbs capable of binding toxin under physiological conditions. Thus, they serve as capture antibodies for a sandwich (capture ELISA. The antibodies were generated using recombinant peptide fragments corresponding to the receptor-binding domain of the toxin heavy chain as immunogen. Their binding properties suggest that they bind a complex epitope with dissociation constants (KD’s for individual antibodies ranging from 10 to 48 × 10−11 M. Assay performance for all possible combinations of capture-detector antibody pairs was evaluated and the antibody pair resulting in the lowest level of detection (L.O.D., ~20 pg/mL was determined. Toxin was detected in spiked dairy samples with good recoveries at concentrations as low as 0.5 pg/mL and in ground beef samples at levels as low as 2 ng/g. Thus, the sandwich ELISA described here uses mAb for both the capture and detector antibodies (binding different epitopes on the toxin molecule and readily detects toxin in those food samples tested.
Stanker, Larry H; Scotcher, Miles C; Cheng, Luisa; Ching, Kathryn; McGarvey, Jeffery; Hodge, David; Hnasko, Robert
2013-11-18
Botulism is a serious foodborne neuroparalytic disease, caused by botulinum neurotoxin (BoNT), produced by the anaerobic bacterium Clostridium botulinum. Seven toxin serotypes (A-H) have been described. The majority of human cases of botulism are caused by serotypes A and B followed by E and F. We report here a group of serotype B specific monoclonal antibodies (mAbs) capable of binding toxin under physiological conditions. Thus, they serve as capture antibodies for a sandwich (capture) ELISA. The antibodies were generated using recombinant peptide fragments corresponding to the receptor-binding domain of the toxin heavy chain as immunogen. Their binding properties suggest that they bind a complex epitope with dissociation constants (KD's) for individual antibodies ranging from 10 to 48 × 10-11 M. Assay performance for all possible combinations of capture-detector antibody pairs was evaluated and the antibody pair resulting in the lowest level of detection (L.O.D.), ~20 pg/mL was determined. Toxin was detected in spiked dairy samples with good recoveries at concentrations as low as 0.5 pg/mL and in ground beef samples at levels as low as 2 ng/g. Thus, the sandwich ELISA described here uses mAb for both the capture and detector antibodies (binding different epitopes on the toxin molecule) and readily detects toxin in those food samples tested.
A Debonded Sandwich Specimen Under Mixed Mode Bending (MMB)
DEFF Research Database (Denmark)
Quispitupa, Amilcar; Berggreen, Christian; Carlsson, Leif A.
2008-01-01
Face/core interface crack propagation in sandwich specimens is analyzed. A thorough analysis of the typical failure modes in sandwich composites was performed in order to design the MMB specimen to promote face/core debond fracture. Displacement, compliance and energy release rate expressions...... for the MMB specimen were derived from a superposition analysis. An experimental verification of the methodology proposed was performed using MMB sandwich specimens with H100 PVC foam core and E-glass/polyester non-crimp quadro-axial [0/45/90/-45]s DBLT-850 faces. Different mixed mode loadings were applied...
Tsumuraya, Takeshi; Fujii, Ikuo; Hirama, Masahiro
2014-01-01
Ciguatera fish poisoning (CFP) is a form of food poisoning caused by the consumption of fish that have accumulated a type of sodium channel activator toxin called ciguatoxins (CTXs), which are produced by dinoflagellates of the genus Gambierdiscus through the food chain. CFP affects more than 50000 people each year. The extremely low level of CTXs in tainted fish has hampered the development of antibodies for the detection of these toxins. Monoclonal antibodies (mAbs) specific against major congeners of CTX3C, 51-hydroxyCTX3C, CTX1B, and 54-deoxyCTX1B were prepared by immunization of mice with protein conjugates of rationally designed synthetic haptens in place of the natural toxins. We found that haptenic groups possessing a surface area larger than 400 angstroms2 were required to produce mAbs that can bind strongly to CTXs. Direct sandwich ELISA utilizing two different monoclonal antibodies that bind specifically to one of the two wings of a CTX were established to detect CTXs. No cross-reactivity was observed against the other marine toxins tested, including brevetoxin A, brevetoxin B, okadaic acid, and maitotoxin.
Determination of critical epitope of PcMab-47 against human podocalyxin
Directory of Open Access Journals (Sweden)
Shunsuke Itai
2018-07-01
Full Text Available Podocalyxin (PODXL is a type I transmembrane protein, which is highly glycosylated. PODXL is expressed in some types of human cancer tissues including oral, breast, and lung cancer tissues and may promote tumor growth, invasion, and metastasis. We previously produced PcMab-47, a novel anti-PODXL monoclonal antibody (mAb which reacts with endogenous PODXL-expressing cancer cell lines and normal cells independently of glycosylation in Western blot, flow cytometry, and immunohistochemical analysis. In this study, we used enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of PcMab-47. The minimum epitope of PcMab-47 was found to be Asp207, His208, Leu209, and Met210. A blocking peptide containing this minimum epitope completely neutralized PcMab-47 reaction against oral cancer cells by flow cytometry and immunohistochemical analysis. These findings could lead to the production of more functional anti-PODXL mAbs, which are advantageous for antitumor activities.
Determination of critical epitope of PcMab-47 against human podocalyxin.
Itai, Shunsuke; Yamada, Shinji; Kaneko, Mika K; Kato, Yukinari
2018-07-01
Podocalyxin (PODXL) is a type I transmembrane protein, which is highly glycosylated. PODXL is expressed in some types of human cancer tissues including oral, breast, and lung cancer tissues and may promote tumor growth, invasion, and metastasis. We previously produced PcMab-47, a novel anti-PODXL monoclonal antibody (mAb) which reacts with endogenous PODXL-expressing cancer cell lines and normal cells independently of glycosylation in Western blot, flow cytometry, and immunohistochemical analysis. In this study, we used enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of PcMab-47. The minimum epitope of PcMab-47 was found to be Asp207, His208, Leu209, and Met210. A blocking peptide containing this minimum epitope completely neutralized PcMab-47 reaction against oral cancer cells by flow cytometry and immunohistochemical analysis. These findings could lead to the production of more functional anti-PODXL mAbs, which are advantageous for antitumor activities.
Evaluation of Strength Characteristics of Laterized Concrete with Corn Cob Ash (CCA) Blended Cement
Ikponmwosa, E. E.; Salau, M. A.; Kaigama, W. B.
2015-11-01
Agricultural wastes are dumped in landfills or left on land in which they constitute nuisance. This study presents the results of investigation of strength characteristics of reinforced laterized concrete beams with cement partially replaced with corn cob (agricultural wastes) ash (CCA). Laterized concrete specimen of 25% laterite and 75% sharp sand were made by blending cement with corn cob ash at 0 to 40% in steps of 10%. A concrete mix ratio of 1:2:4 was used to cast 54 cubes of 150×150×150mm size and 54 beams of dimension 750×150×150mm. The results show that the consistency and setting time of cement increased as the percentage replacement of cement with CCA increased while the workability and density of concrete decreased as the percentage of CCA increased. There was a decrease in compressive strength when laterite was introduced to the concrete from 25.04 to 22.96N/mm2 after 28 days and a continual reduction in strength when CCA was further added from 10% to 40% at steps of 10%. Generally, the beam specimens exhibited majorly shear failure with visible diagonal cracks extending from support points to the load points. The corresponding central deflection in beams, due to two points loading, increased as the laterite was added to the concrete mix but reduced and almost approaching that of the control as 10% CCA was added. The deflection then increased as the CCA content further increased to 20%, 30% and 40% in the mix. It was also noted that the deflection of all percentage replacement including 40% CCA is less than the standard recommended maximum deflection of the beam. The optimal flexural strength occurred with 10% CCA content.
2D-3D Face Recognition Method Basedon a Modified CCA-PCA Algorithm
Directory of Open Access Journals (Sweden)
Patrik Kamencay
2014-03-01
Full Text Available This paper presents a proposed methodology for face recognition based on an information theory approach to coding and decoding face images. In this paper, we propose a 2D-3D face-matching method based on a principal component analysis (PCA algorithm using canonical correlation analysis (CCA to learn the mapping between a 2D face image and 3D face data. This method makes it possible to match a 2D face image with enrolled 3D face data. Our proposed fusion algorithm is based on the PCA method, which is applied to extract base features. PCA feature-level fusion requires the extraction of different features from the source data before features are merged together. Experimental results on the TEXAS face image database have shown that the classification and recognition results based on the modified CCA-PCA method are superior to those based on the CCA method. Testing the 2D-3D face match results gave a recognition rate for the CCA method of a quite poor 55% while the modified CCA method based on PCA-level fusion achieved a very good recognition score of 85%.
Efficient KDM-CCA Secure Public-Key Encryption via Auxiliary-Input Authenticated Encryption
Directory of Open Access Journals (Sweden)
Shuai Han
2017-01-01
Full Text Available KDM[F]-CCA security of public-key encryption (PKE ensures the privacy of key-dependent messages f(sk which are closely related to the secret key sk, where f∈F, even if the adversary is allowed to make decryption queries. In this paper, we study the design of KDM-CCA secure PKE. To this end, we develop a new primitive named Auxiliary-Input Authenticated Encryption (AIAE. For AIAE, we introduce two related-key attack (RKA security notions, including IND-RKA and weak-INT-RKA. We present a generic construction of AIAE from tag-based hash proof system (HPS and one-time secure authenticated encryption (AE and give an instantiation of AIAE under the Decisional Diffie-Hellman (DDH assumption. Using AIAE as an essential building block, we give two constructions of efficient KDM-CCA secure PKE based on the DDH and the Decisional Composite Residuosity (DCR assumptions. Specifically, (i our first PKE construction is the first one achieving KDM[Faff]-CCA security for the set of affine functions and compactness of ciphertexts simultaneously. (ii Our second PKE construction is the first one achieving KDM[Fpolyd]-CCA security for the set of polynomial functions and almost compactness of ciphertexts simultaneously. Our PKE constructions are very efficient; in particular, they are pairing-free and NIZK-free.
Physical and mechanical properties of flakeboard produced from recycled CCA-treated wood
W. Li; T.F. Shupe; Chung-Yun Hse
2004-01-01
Chromated copper arsenate (CCA) treated wood has been most widely used in North America since the 1970s for many exterior applications such as decks, fences, playground equipment, utility poles, and others. A large volume of CCA-treated wood is currently coming out of service. Traditional disposal methods such as landfilling and incineration are not without adverse...
Hedinger, Roman; Ghisletta, Michele; Hegetschweiler, Kaspar; Tóth, Eva; Merbach, André E.; Sessoli, Roberta; Gatteschi, Dante; Gramlich, Volker
1998-12-28
A variety of trinuclear complexes [M(3)(H(-)(3)L)(2)](3+) [M = Y, La, Eu, Gd, Dy; L = 1,3,5-triamino-1,3,5-trideoxy-cis-inositol (taci) and 1,3,5-trideoxy-1,3,5-tris(dimethylamino)-cis-inositol (tdci)] was prepared as solid materials of the composition M(3)(H(-)(3)L)(2)X(3).pH(2)O.qEtOH (X = Cl, NO(3); 2.5 = p = 9; q = 0, 0.33) and characterized by elemental analyses, NMR spectroscopy, and FAB(+) mass spectrometry. The crystal structures of [La(3)(H(-)(3)taci)(2)(H(2)O)(4)Cl]Cl(2).3H(2)O and [Gd(3)(H(-)(3)taci)(2)(H(2)O)(6)]Cl(3).3H(2)O were elucidated by single-crystal X-ray diffraction studies. The La complex crystallizes in the orthorhombic space group Pbca, a = 17.10(2) Å, b = 16.20(4) Å, c = 20.25(4) Å, Z = 8 for C(12)Cl(3)H(38)La(3)N(6)O(13). The Gd complex crystallizes in the monoclinic space group P2(1)/n, a = 10.294(3) Å, b = 15.494(5) Å, c = 19.994(6) Å, beta = 95.36(2) degrees, Z = 4 for C(12)Cl(3)Gd(3)H(42)N(6)O(15). The two complexes exhibited a unique, sandwich-type cage structure, where the two triply deprotonated taci ligands encapsulate an equilateral triangle of the three metal centers. The metal cations are coordinated to the equatorial, terminal amino groups and are bridged by the axial &mgr;(2)-alkoxo groups. The coordination spheres are completed by additional peripheral ligands such as H(2)O or Cl(-) counterions. The coordination number of the metal cations is 8. Magnetic susceptibility measurements of the Gd complex revealed very weak antiferromagnetic coupling interactions between the three Gd centers. Complex formation and species distribution in aqueous solution was investigated by potentiometry and pD-dependent NMR spectroscopy. An exclusive formation of the [Eu(3)(H(-)(3)taci)(2)](3+) unit in solution was found in the range 7 = pH = 10. The formation constants were determined for the Y, Eu, Gd, Dy, and Lu complexes with taci. The stability of the lanthanoid complexes increased monotonically with decreasing ionic radius of
Finishability of CCA pressure-treated wood
Alan Ross; Richard Carlson; William Feist; Steven Bussjaeger
2000-01-01
Thus, a need arose for the development of surface finishes for CCA-treated wood that could address the special requirements of this substrate and provide protection against the ravages of water, sunlight, mildew, and other aspects of weathering and wear. Initially, this need was not addressed, most wood preserving companies had little expertise in surface finishes and...
Hui Pan; Chung-Yun Hse; Robert Gambrell; Todd F. Shupe
2009-01-01
Chromated copper arsenate (CCA)-treated wood was liquefied with polyethylene glycol/glycerin and sulfuric acid. After liquefaction, most CCA metals (98% As, 92% Cr, and 83% Cu) were removed from liquefied CCA-treated wood by precipitation with calcium hydroxide. The original CCA-treated wood and liquefied CCA-treated wood sludge were fractionated by a modified...
Doki, Tomoyoshi; Takano, Tomomi; Nishiyama, Yuri; Nakamura, Michiyo; Hohdatsu, Tsutomu
2013-12-01
Feline infectious peritonitis (FIP) is a lethal infectious disease affecting domestic and wild cats. Several reports suggested that TNF-alpha is related to the progression of FIP. Thus, the administration of a feline TNF-alpha-neutralizing antibody to cats with FIP may reduce the disease progression. In this study, we have prepared nine monoclonal antibodies (MAbs) that recognize feline TNF-alpha. All MAbs neutralized recombinant TNF-alpha. The 50% inhibitory concentrations (IC50) of the MAbs for the cytotoxicity of recombinant TNF-alpha were 5-684 ng/ml. MAb 2-4 exhibited high neutralizing activity against natural TNF-alpha derived from FIPV-infected macrophages, and was confirmed to inhibit the following feline TNF-alpha-induced conditions in vitro: (i) an increase in the survival rate of neutrophils from cats with FIP, (ii) aminopeptidase N (APN) mRNA expression in macrophages, and (iii) apoptosis of a feline T-lymphocyte cell line. Copyright © 2013 Elsevier Ltd. All rights reserved.
Synthesis of 11-(Piperazin-1-yl-5H-dibenzo[b,e] [1,4]diazepine on Kilo Scale
Directory of Open Access Journals (Sweden)
Rahul S. Kalhapure
2011-01-01
Full Text Available A synthesis of 11-(piperazin-1yl-5 H-dibenzo[b,e][1,4]diazepine on kilo scale without any chromatographic purification step is reported. Key steps involved are Ullmann condensation, catalytic hydrogenation, and catalyzed cyclization.
Face/core interface fracture characterization of mixed mode bending sandwich specimens
DEFF Research Database (Denmark)
Quispitupa, Amilcar; Berggreen, Christian; Carlsson, L.A.
2011-01-01
and PVC H45, H100 and H250 foam core materials were evaluated. A methodology to perform precracking on fracture specimens in order to achieve a sharp and representative crack front is outlined. The mixed mode loading was controlled in the mixed mode bending (MMB) test rig by changing the loading......Debonding of the core from the face sheets is a critical failure mode in sandwich structures. This paper presents an experimental study on face/core debond fracture of foam core sandwich specimens under a wide range of mixed mode loading conditions. Sandwich beams with E‐glass fibre face sheets...... application point (lever arm distance). Finite element analysis was performed to determine the mode‐mixity at the crack tip. The results showed that the face/core interface fracture toughness increased with increased mode II loading. Post failure analysis of the fractured specimens revealed that the crack...
Gu, Haibin; Ciganda, Roberto; Hernandez, Ricardo; Castel, Patricia; Zhao, Pengxiang; Ruiz, Jaime; Astruc, Didier
2016-04-01
Diblock metallopolymer polyelectrolytes containing the two redox-robust cationic sandwich units [CoCp'Cp](+) and [FeCp'(η(6)-C6 Me6)](+) (Cp = η(5)-C5 H5; Cp' = η(5)-C5H4-) as hexafluorophosphate ([PF6](-)) salts are synthesized by ring-opening metathesis polymerization using Grubbs' third generation catalyst. Their electrochemical properties show full chemical and electrochemical reversibilities allowing fine determination of the copolymer molecular weight using Bard-Anson's electrochemical method by cyclic voltammetry. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Structures and Stability of Metal Amidoboranes (MAB): Density Functional Calculations
International Nuclear Information System (INIS)
Li Cailin; Wu Chaoling; Chen Yungui; Zhou Jingjing; Zheng Xin; Pang Lijuan; Deng Gang
2010-01-01
Molecule geometry structures, frequencies, and energetic stabilities of ammonia borane (AB, NH 3 BH 3 ) and metal amidoboranes (MAB, MNH 2 BH 3 ), formed by substituting H atom in AB with one of main group metal atoms, have been investigated by density-functional theory and optimized at the B3LYP levels with 6-311G++ (3df, 3pd) basic set. Their structural parameters and infrared spectrum characteristic peaks have been predicted, which should be the criterion of a successfully synthesized material. Several parameters such as binding energies, vibrational frequencies, and the energy gaps between the HOMO and the LUMO have been adopted to characterize and evaluate their structure stabilities. It is also found that the binding energies and HOMO-LUMO energy gaps of the MAB obviously change with the substitution of the atoms. MgAB has the lowest binding energy and is easier to decompose than any other substitutional structures under same conditions, while CaAB has the highest chemical activity. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Wang, F; Zhu, W; Liu, T; Sun, Z; Ju, S; Ju, S; Yu, G; Xie, W; Deng, Z; Lu, B; Zhang, X
2007-01-01
ICOS-L, a newly identified member of B7 superfamily, plays an important role in immune responses. In this article, we report on two novel mouse anti-human ICOS-L monoclonal antibodies (mAbs) named as 11C4 and 12B11, whose specificities were verified by methods of flow cytometry, western blotting, and epitope competition assay. The two mAbs bound to distinct ICOS-L epitopes on B cells. Interestingly, mAb 11C4 could well recognize ICOS-L molecule on activated T cells and Jurkat cell lines, which is different from commercial anti-ICOS-L mAb (clone number MIH12) and the other mAb 12B11. In addition, we found that the expression of ICOS-L molecule was only detected on the surface of immature monocyte-derived dendritic cells (Mo-DCs) and was sharply decreased after induction of mature Mo-DCs activated by tumor necrosis factor-alpha or CD40. Furthermore, we showed that 11C4 could effectively suppress the maturation of Mo-DCs in vitro as evidenced by the low expression of CD80, CD86, CD83, and human leukocyte antigen-DR, which suggested that ICOS-L may be involved in the maturation of Mo-DCs. Using immunohistochemistry staining with mAb 11C4, the expression of ICOS-L was found in B lymphoma tissues and thyroid tissues from the Grave's disease but not in thyroid adenoma and normal thyroid tissues.
Directory of Open Access Journals (Sweden)
Mara Lúcia Agostini Valle
2013-06-01
Full Text Available http://dx.doi.org/10.5902/198050989292This study aimed to evaluate the retention and penetration of copper chrome arsenate (CCA type C as well as some wood properties of two rotations of two natural hybrid of Eucalyptus urophylla S. T. Blake, aiming their use as treated wood. The study was conducted with material from commercial plantations, with 63 months of age. For the wood characterization, the relationship sapwood-heartwood, the basic density and the size of fibers and vessels were evaluated. For the evaluation of treated wood, the penetration and retention of copper chrome arsenate (CCA type C were determined. Four trees per rotation and genetic material were used, which subsequently were split into three logs, in a total of 12 logs for each treatment. The preservative treatment was performed using the full cell process in autoclave using CCA solution with 2% concentration of active ingredients. The treatment process used was effective under the conditions required by the NBR 9480, with retention values higher than the minimum required by the standard, which is 6.5 kg/m3 of CCA per treated wood, and in addition, provided deep penetration and regular condom in sapwood of all timber treated. There are no restrictions on the use of wood from the first and second rotation for preservative treatment, based on the properties evaluated. There was no correlation between the type C CCA retention and wood properties evaluated.
First experiences with the AMERLEX-MAB FREE T4 assay
International Nuclear Information System (INIS)
Nijhof, W.A.; Penders, T.J.
1989-01-01
The new Amerlex-MAB FT 4 is a quick direct free T 4 assay with good reproducability. The correlation between the Amerlex-MAB FT 4 and the free T 4 of Byk is good. In the non-thyreoidal illness patient group no deviation for the values were found. Amerlex-MAB FT 4 is cheaper, because no total T4 has to be measured. More research has to be done for special patient sera. Disturbing influences as free fatty acids, heparin and auto-antibodies have to be checked. (R.B.). 3 refs.; 3 figs.; 4 tabs
Energy Technology Data Exchange (ETDEWEB)
Jambeck, Jenna R. [Department of Environmental Engineering Sciences, University of Florida, Gainesville, FL 32611-6450 (United States); Townsend, Timothy [Department of Environmental Engineering Sciences, University of Florida, Gainesville, FL 32611-6450 (United States)]. E-mail: ttown@ufl.edu; Solo-Gabriele, Helena [Department of Civil, Architectural, and Environmental Engineering, University of Miami, Coral Gables, FL 33146-0630 (United States)
2006-07-31
The proper end-of-life management of chromated copper arsenate (CCA)-treated wood, which contains arsenic, copper, and chromium, is a concern to the solid waste management community. Landfills are often the final repository of this waste stream, and the impacts of CCA preservative metals on leachate quality are not well understood. Monofills are a type of landfill designed and operated to dispose a single waste type, such as ash, tires, mining waste, or wood. The feasibility of managing CCA-treated wood in monofills was examined using a simulated landfill (a leaching lysimeter) that contained a mix of new and weathered CCA-treated wood. The liquid to solid ratio (LS) reached in the experiment was 0.63:1. Arsenic, chromium, and copper leached from the lysimeter at average concentrations of 42 mg/L for arsenic, 9.4 mg/L for chromium, and 2.4 mg/L for copper. Complementary batch leaching studies using deionized water were performed on similar CCA-treated wood samples at LS of 5:1 and 10:1. When results from the lysimeter were compared to the batch test results, copper and chromium leachability appeared to be reduced in the lysimeter disposal environment. Of the three metals, arsenic leached to the greatest extent and was found to have the best correlation between the batch and the lysimeter experiments.
Podocyte changes after induction of acute albuminuria in mice by anti-aminopeptidase A mAb.
Dijkman, Henry B P M; Gerlofs-Nijland, Miriam E; van der Laak, Jeroen A W M; Wetzels, Jack F M; Groenen, Patricia J T A; Assmann, Karel J M
2003-01-01
Administration of a specific combination of anti-aminopeptidase A (APA) mAb (ASD-37/41) in mice induces an acute albuminuria which is independent of angiotensin II, a well-known substrate of APA. In the present experiments, we examined whether binding of the mAb initiated changes in the podocytic expression of cytoskeleton (-associated), adhesion and slit-diaphragm proteins in relation to the time course of albuminuria. In addition, we measured ultrastructurally the extent of foot process retraction (the number of foot processes per microm GBM) and the width of the slit pore between the podocytes by morphometric methods. An injection of the mAb combination ASD-37/41 induced a massive but transient albuminuria that started at 6 h, and peaked at 8 h, after which it declined. However, even at day 7 after injection of the mAbs some albuminuria was present. Injection of the combination ASD-3/41 or saline did not induce an albuminuria. Notably, we observed changes in the staining of CD2AP and podocin, two slit-pore-associated proteins that coincided with the start of the albuminuria. Nephrin staining was reduced and podocytic actin staining became more granular only at a time albuminuria was declining (24 h). The number of foot processes per microm GBM was already decreased at 4 h with a further reduction thereafter. The width of the slit pore was unchanged at the time of peak albuminuria and gradually decreased thereafter. At day 7, podocytic foot process effacement was even more prominent although albuminuria was only slightly abnormal. Expression of CD2AP was still granular. We observed however a change toward normal in the expression of podocin. Injection of saline or ASD-3/41 had no effect on the expression of podocytic proteins, the number of foot processes or width of the slit pore. Our data show that the onset of albuminuria in the anti-APA model is related to alterations in CD2AP and podocin, proteins that are important for maintaining slit-diaphragm structure
Modeling Banking, Sovereign, and Macro Risk in a CCA Global VAR
Dale F. Gray
2013-01-01
The purpose of this paper is to develop a model framework for the analysis of interactions between banking sector risk, sovereign risk, corporate sector risk, real economic activity, and credit growth for 15 European countries and the United States. It is an integrated macroeconomic systemic risk model framework that draws on the advantages of forward-looking contingent claims analysis (CCA) risk indicators for the banking systems in each country, forward-looking CCA risk indicators for sover...
DEFF Research Database (Denmark)
Moslemian, Ramin; Quispitupa, Amilcar; Berggreen, Christian
2012-01-01
This paper deals with the failure of compression-loaded sandwich panels with an implanted circular face/core debond. Uniform compression tests were conducted on intact sandwich panels with three different types of core material (H130, H250 and PMI) and on similar panels with circular face...
African Journals Online (AJOL)
The sandwich sign is demonstrated on cross-sectional imaging, commonly on CT or ultrasound. It refers to homogeneous soft- tissue masses representing mesenteric lymphadenopathy as the two halves of a sandwich bun, encasing the mesenteric fat and tubular mesenteric vessels that constitute the 'sandwich filling' (Figs ...
Transgenic plants expressing GLK1 and CCA1 having increased nitrogen assimilation capacity
Coruzzi, Gloria [New York, NY; Gutierrez, Rodrigo A [Santiago, CL; Nero, Damion C [Woodside, NY
2012-04-10
Provided herein are compositions and methods for producing transgenic plants. In specific embodiments, transgenic plants comprise a construct comprising a polynucleotide encoding CCA1, GLK1 or bZIP1, operably linked to a plant-specific promote, wherein the CCA1, GLK1 or bZIP1 is ectopically overexpressed in the transgenic plants, and wherein the promoter is optionally a constitutive or inducible promoter. In other embodiments, transgenic plants in which express a lower level of CCA1, GLK1 or bZIP1 are provided. Also provided herein are commercial products (e.g., pulp, paper, paper products, or lumber) derived from the transgenic plants (e.g., transgenic trees) produced using the methods provided herein.
Liu, Changqi; Chhabra, Guneet S; Sathe, Shridhar K
2015-10-21
A commercially available direct sandwich enzyme-linked immunosorbent assay (ELISA) (BioFront Technologies, Tallahassee, FL, USA) using murine anti-pistachio monoclonal antibodies (mAbs) as capture and detection antibodies was evaluated. The assay was sensitive (limit of detection = 0.09 ± 0.02 ppm full fat pistachio, linear detection range = 0.5-36 ppm, 50% maximum signal concentration = 7.9 ± 0.7 ppm), reproducible (intra- and inter-assay variability pistachio seeds subjected to autoclaving (121 °C, 15 psi, 15, 30 min), blanching (100 °C, 5, 10 min), frying (191 °C, 1 min), microwaving (500, 1000 W, 3 min), and dry roasting (140 °C, 30 min; 168 °C, 12 min). No cross-reactivity was observed in 156 food matrices, each tested at 100,000 ppm, suggesting the ELISA to be pistachio specific. The pistachio recovery ranges for spiked (10 ppm) and incurred (10-50000 ppm) food matrices were 93.1-125.6% and 35.7-112.2%, respectively. The assay did not register any false-positive or -negative results among the tested commercial and laboratory prepared samples.
Directory of Open Access Journals (Sweden)
Laurie C Hofmann
Full Text Available Presently, an incomplete mechanistic understanding of tropical reef macroalgae photosynthesis and calcification restricts predictions of how these important autotrophs will respond to global change. Therefore, we investigated the mechanistic link between inorganic carbon uptake pathways, photosynthesis and calcification in a tropical crustose coralline alga (CCA using microsensors. We measured pH, oxygen (O2, and calcium (Ca2+ dynamics and fluxes at the thallus surface under ambient (8.1 and low (7.8 seawater pH (pHSW and across a range of irradiances. Acetazolamide (AZ was used to inhibit extracellular carbonic anhydrase (CAext, which mediates hydrolysis of HCO3-, and 4,4' diisothiocyanatostilbene-2,2'-disulphonate (DIDS that blocks direct HCO3- uptake by anion exchange transport. Both inhibited photosynthesis, suggesting both diffusive uptake of CO2 via HCO3- hydrolysis to CO2 and direct HCO3- ion transport are important in this CCA. Surface pH was raised approximately 0.3 units at saturating irradiance, but less when CAext was inhibited. Surface pH was lower at pHSW 7.8 than pHSW 8.1 in the dark, but not in the light. The Ca2+ fluxes were large, complex and temporally variable, but revealed net Ca2+ uptake under all conditions. The temporal variability in Ca2+ dynamics was potentially related to localized dissolution during epithallial cell sloughing, a strategy of CCA to remove epiphytes. Simultaneous Ca2+ and pH dynamics suggest the presence of Ca2+/H+ exchange. Rapid light-induced H+ surface dynamics that continued after inhibition of photosynthesis revealed the presence of a light-mediated, but photosynthesis-independent, proton pump. Thus, the study indicates metabolic control of surface pH can occur in CCA through photosynthesis and light-inducible H+ pumps. Our results suggest that complex light-induced ion pumps play an important role in biological processes related to inorganic carbon uptake and calcification in CCA.
Hofmann, Laurie C; Koch, Marguerite; de Beer, Dirk
2016-01-01
Presently, an incomplete mechanistic understanding of tropical reef macroalgae photosynthesis and calcification restricts predictions of how these important autotrophs will respond to global change. Therefore, we investigated the mechanistic link between inorganic carbon uptake pathways, photosynthesis and calcification in a tropical crustose coralline alga (CCA) using microsensors. We measured pH, oxygen (O2), and calcium (Ca2+) dynamics and fluxes at the thallus surface under ambient (8.1) and low (7.8) seawater pH (pHSW) and across a range of irradiances. Acetazolamide (AZ) was used to inhibit extracellular carbonic anhydrase (CAext), which mediates hydrolysis of HCO3-, and 4,4' diisothiocyanatostilbene-2,2'-disulphonate (DIDS) that blocks direct HCO3- uptake by anion exchange transport. Both inhibited photosynthesis, suggesting both diffusive uptake of CO2 via HCO3- hydrolysis to CO2 and direct HCO3- ion transport are important in this CCA. Surface pH was raised approximately 0.3 units at saturating irradiance, but less when CAext was inhibited. Surface pH was lower at pHSW 7.8 than pHSW 8.1 in the dark, but not in the light. The Ca2+ fluxes were large, complex and temporally variable, but revealed net Ca2+ uptake under all conditions. The temporal variability in Ca2+ dynamics was potentially related to localized dissolution during epithallial cell sloughing, a strategy of CCA to remove epiphytes. Simultaneous Ca2+ and pH dynamics suggest the presence of Ca2+/H+ exchange. Rapid light-induced H+ surface dynamics that continued after inhibition of photosynthesis revealed the presence of a light-mediated, but photosynthesis-independent, proton pump. Thus, the study indicates metabolic control of surface pH can occur in CCA through photosynthesis and light-inducible H+ pumps. Our results suggest that complex light-induced ion pumps play an important role in biological processes related to inorganic carbon uptake and calcification in CCA.
Directory of Open Access Journals (Sweden)
Jean T Coulibaly
2011-11-01
Full Text Available BACKGROUND: Promising results have been reported for a urine circulating cathodic antigen (CCA test for the diagnosis of Schistosoma mansoni. We assessed the accuracy of a commercially available CCA cassette test (designated CCA-A and an experimental formulation (CCA-B for S. mansoni diagnosis. METHODOLOGY: We conducted a cross-sectional survey in three settings of Côte d'Ivoire: settings A and B are endemic for S. mansoni, whereas S. haematobium co-exists in setting C. Overall, 446 children, aged 8-12 years, submitted multiple stool and urine samples. For S. mansoni diagnosis, stool samples were examined with triplicate Kato-Katz, whereas urine samples were tested with CCA-A. The first stool and urine samples were additionally subjected to an ether-concentration technique and CCA-B, respectively. Urine samples were examined for S. haematobium using a filtration method, and for microhematuria using Hemastix dipsticks. PRINCIPAL FINDINGS: Considering nine Kato-Katz as diagnostic 'gold' standard, the prevalence of S. mansoni in setting A, B and C was 32.9%, 53.1% and 91.8%, respectively. The sensitivity of triplicate Kato-Katz from the first stool and a single CCA-A test was 47.9% and 56.3% (setting A, 73.9% and 69.6% (setting B, and 94.2% and 89.6% (setting C. The respective sensitivity of a single CCA-B was 10.4%, 29.9% and 75.0%. The ether-concentration technique showed a low sensitivity for S. mansoni diagnosis (8.3-41.0%. The specificity of CCA-A was moderate (76.9-84.2%; CCA-B was high (96.7-100%. The likelihood of a CCA-A color reaction increased with higher S. mansoni fecal egg counts (odds ratio: 1.07, p<0.001. A concurrent S. haematobium infection or the presence of microhematuria did not influence the CCA-A test results for S. mansoni diagnosis. CONCLUSION/SIGNIFICANCE: CCA-A showed similar sensitivity than triplicate Kato-Katz for S. mansoni diagnosis with no cross-reactivity to S. haematobium and microhematuria. The low sensitivity
Chou, Cheng-Chung; Huang, Yi-Han
2012-01-01
This paper reports a nucleic acid sandwich hybridization assay with a quantum dot (QD)-induced fluorescence resonance energy transfer (FRET) reporter system. Two label-free hemagglutinin H5 sequences (60-mer DNA and 630-nt cDNA fragment) of avian influenza viruses were used as the targets in this work. Two oligonucleotides (16 mers and 18 mers) that specifically recognize two separate but neighboring regions of the H5 sequences were served as the capturing and reporter probes, respectively. The capturing probe was conjugated to QD655 (donor) in a molar ratio of 10:1 (probe-to-QD), and the reporter probe was labeled with Alexa Fluor 660 dye (acceptor) during synthesis. The sandwich hybridization assay was done in a 20 μL transparent, adhesive frame-confined microchamber on a disposable, temperature-adjustable indium tin oxide (ITO) glass slide. The FRET signal in response to the sandwich hybridization was monitored by a homemade optical sensor comprising a single 400 nm UV light-emitting diode (LED), optical fibers, and a miniature 16-bit spectrophotometer. The target with a concentration ranging from 0.5 nM to 1 μM was successfully correlated with both QD emission decrease at 653 nm and dye emission increase at 690 nm. To sum up, this work is beneficial for developing a portable QD-based nucleic acid sensor for on-site pathogen detection. PMID:23211753
International Nuclear Information System (INIS)
Sarkadi-Priboczki, E.; Kovacs, Z.; Kumar, N.; Salmi, T.; Murzin, D.Yu
2005-01-01
Complete text of publication follows. The transformation of methanol has been investigated over alumina and H-ZSM-5 in our previous experiments by 11 C-radioisotope tracing. The main product in methanol conversion over alumina was dimethyl ether due to Lewis acid sites while over H-ZSM-5 mostly hydrocarbons were formed due to both Lewis and Brrnsted acid sites. With increasing temperature first the ethanol was dehydrated to diethyl ether followed by ethene formation over alumina and H-ZSM-5. In this work, 11 C-labelled methanol as radioisotope tracer was added to non-radioactive methanol for investigation of co-reaction with non-radioactive ethanol over alumina and H- ZSM-5. The 11 C-methanol tracer was used to distinguish the methanol derivates and co-reaction derivates of methanol with ethanol against non-radioactive ethanol derivates. The yield of methyl ethyl ether as mixed ether and the influence of ethanol for the yields of C 1 -C 5 hydrocarbons were studied as a function of reaction temperature and contact time. The 11 C-methanol was formed by a radiochemical process from 11 CO 2 produced at cyclotron. The mixture of methanol and ethanol was added to 11 C-methanol and injected to the catalyst. The catalysis was carried out in a glass tube fixed-bed reactor after its pretreatment. The derivates were analyzed by radio-gas chromatography (gas chromatograph with thermal conductivity detector coupled on-line with a radioactivity detector). The comparative analysis of yields of radioactive and non-radioactive products as a function of reaction temperature gives information about the reaction pathways. Over alumina the yields of dimethyl ether and methyl ethyl ether (co-product) as radioactive and diethyl ether with ethene as non-radioactive main products were monitored as a function of reaction temperature and reaction time in the range of 513-593 K. Alongside ethanol derivates the ethene turns into main product in contrast with methyl ethyl ether and diethyl
Electrochemical removal of CU, CR and AS from CCA-treated waste wood
Energy Technology Data Exchange (ETDEWEB)
Kristensen, I.V.; Ottosen, L.M.; Villumsen, A. [Dept. of Geology and Geotechnical Engineering, The Technical Univ. of Denmark, Lyngby (Denmark); Ribeiro, A.B. [Dept. of Geology and Geotechnical Engineering, The Technical Univ. of Denmark, Lyngby (Denmark)]|[Dept. de Ciencias e Engenharia do Ambiente, Faculdade de Ciencias e Tecnologia, Univ. Nova de Lisboa, Caparica (Portugal)
2001-07-01
CCA-treated waste wood poses a potential environmental problem due to the content of copper, chromium and arsenic. This paper presents the results obtained by electrodialytic remediation of CCA-treated waste wood. It is found that more than 90% Cu, and approximately 85% Cr and As was removed from the wood during the remediation. Thereby the concentration of copper in the wood is reduced from app. 426 ppm to app. 25 ppm, chromium is reduced from app. 837 ppm to app. 135 ppm and the arsenic content decreases from app. 589 ppm to app. 151 ppm. After remediation the removed metals are collected into liquids. The use of ion exchange membranes to separate the wood from the electrolytes result in a distribution of the metals after remediation that makes the collection of the metals easier, and reuse of the metals, for e.g. new CCA, may be possible. (orig.)
Nakata, Yuya; Usui, Toshiki; Nishikawa, Yuki; Nekelson, Fabien; Shimizu, Yo; Fujii, Akihiko; Ozaki, Masanori
2018-03-01
Sandwich-cell-type bulk-heterojunction organic solar cells utilizing the liquid crystalline phthalocyanine, 1,4,8,11,15,18,22,25-octahexylphthalocyanine (C6PcH2), have been fabricated and their photovoltaic properties have been studied. The short-circuit current (J SC) and power conversion efficiency (PCE) depended on the blend ratio of donor and acceptor molecules, and the maximum performance, such as J SC of 3.4 mA/cm2 and PCE of 0.67%, was demonstrated, when the blend ratio of the acceptor was 10 mol %. The photovoltaic properties were discussed by taking the relationship between the column axis direction of C6PcH2 and the carrier mobility in the active layer into consideration.
Development of monoclonal antibodies and quantitative ELISAs targeting insulin-degrading enzyme
Directory of Open Access Journals (Sweden)
Dickson Dennis W
2009-10-01
Full Text Available Abstract Background Insulin-degrading enzyme (IDE is a widely studied zinc-metalloprotease implicated in the pathogenesis of type 2 diabetes mellitus, Alzheimer disease (AD and varicella zoster virus infection. Despite more than six decades of research on IDE, progress has been hampered by the lack of well-characterized reagents targeting this biomedically important protease. To address this important need, we generated and characterized new mouse monoclonal antibodies (mAbs targeting natively folded human and rodent IDE. Results Eight monoclonal hybridoma cell lines were derived in house from mice immunized with full-length, natively folded, recombinant human IDE. The mAbs derived from these lines were shown to detect IDE selectively and sensitively by a wide range of methods. Two mAbs in particular—designated 6A1 and 6H9—proved especially selective for IDE in immunocytochemical and immunohistochemical applications. Using a variety of methods, we show that 6A1 selectively detects both human and rodent IDE, while 6H9 selectively detects human, but not rodent, IDE, with both mAbs showing essentially no cross reactivity with other proteins in these applications. Using these novel anti-IDE mAbs, we also developed sensitive and quantitative sandwich ELISAs capable of quantifying IDE levels present in human brain extracts. Conclusion We succeeded in developing novel mAbs that selectively detect rodent and/or human IDE, which we have shown to be suitable for a wide range of applications, including western blotting, immunoprecipitation, immunocytochemistry, immunohistochemistry, and quantitative sandwich ELISAs. These novel anti-IDE mAbs and the assays derived from them constitute important new tools for addressing many unresolved questions about the basic biology of IDE and its role in multiple highly prevalent human diseases.
International Nuclear Information System (INIS)
Boonsathorn, Naphatsawan; Panthong, Sumolrat; Koksunan, Sarawut; Chittaganpitch, Malinee; Phuygun, Siripaporn; Waicharoen, Sunthareeya; Prachasupap, Apichai; Sasaki, Tadahiro; Kubota-Koketsu, Ritsuko; Yasugi, Mayo; Ono, Ken-ichiro; Arai, Yasuha
2014-01-01
Highlights: • A human monoclonal antibody against influenza virus was produced from a volunteer. • The antibody was generated from the PBMCs of the volunteer using the fusion method. • The antibody neutralized heterosubtypically group 1 influenza A viruses (H1 and H9). • The antibody targeted a novel epitope in globular head region of the hemagglutinin. • Sequences of the identified epitope are highly conserved among H1 and H9 subtypes. - Abstract: Most neutralizing antibodies elicited during influenza virus infection or by vaccination have a narrow spectrum because they usually target variable epitopes in the globular head region of hemagglutinin (HA). In this study, we describe a human monoclonal antibody (HuMAb), 5D7, that was prepared from the peripheral blood lymphocytes of a vaccinated volunteer using the fusion method. The HuMAb heterosubtypically neutralizes group 1 influenza A viruses, including seasonal H1N1, 2009 pandemic H1N1 (H1N1pdm) and avian H9N2, with a strong hemagglutinin inhibition activity. Selection of an escape mutant showed that the HuMAb targets a novel conformational epitope that is located in the HA head region but is distinct from the receptor binding site. Furthermore, Phe114Ile substitution in the epitope made the HA unrecognizable by the HuMAb. Amino acid residues in the predicted epitope region are also highly conserved in the HAs of H1N1 and H9N2. The HuMAb reported here may be a potential candidate for the development of therapeutic/prophylactic antibodies against H1 and H9 influenza viruses
Energy Technology Data Exchange (ETDEWEB)
Boonsathorn, Naphatsawan; Panthong, Sumolrat [Medical Life Sciences Institute, Department of Medical Sciences, Ministry of Public Health, Muang, Nonthaburi (Thailand); Japan Science and Technology Agency/Japan International Cooperation Agency, Science and Technology Research Partnership for Sustainable Development (JST/JICA, SATREPS), Tokyo (Japan); Koksunan, Sarawut [Medical Life Sciences Institute, Department of Medical Sciences, Ministry of Public Health, Muang, Nonthaburi (Thailand); Chittaganpitch, Malinee; Phuygun, Siripaporn; Waicharoen, Sunthareeya [National Institute of Health, Department of Medical Sciences, Ministry of Public Health, Muang, Nonthaburi (Thailand); Prachasupap, Apichai [Medical Life Sciences Institute, Department of Medical Sciences, Ministry of Public Health, Muang, Nonthaburi (Thailand); Japan Science and Technology Agency/Japan International Cooperation Agency, Science and Technology Research Partnership for Sustainable Development (JST/JICA, SATREPS), Tokyo (Japan); Sasaki, Tadahiro [Department of Virology, Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Japan Science and Technology Agency/Japan International Cooperation Agency, Science and Technology Research Partnership for Sustainable Development (JST/JICA, SATREPS), Tokyo (Japan); Kubota-Koketsu, Ritsuko [Kanonji Institute, The Research Foundation for Microbial Diseases of Osaka University, Kanonji, Kagawa (Japan); Yasugi, Mayo [Graduate School of Life and Environmental Sciences, Osaka Prefecture University, Izumisano, Osaka (Japan); Ono, Ken-ichiro [Ina Laboratory, Medical and Biological Laboratories Corporation, Ltd., Ina, Nagano (Japan); Japan Science and Technology Agency/Japan International Cooperation Agency, Science and Technology Research Partnership for Sustainable Development (JST/JICA, SATREPS), Tokyo (Japan); Arai, Yasuha [Department of Virology, Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); and others
2014-09-26
Highlights: • A human monoclonal antibody against influenza virus was produced from a volunteer. • The antibody was generated from the PBMCs of the volunteer using the fusion method. • The antibody neutralized heterosubtypically group 1 influenza A viruses (H1 and H9). • The antibody targeted a novel epitope in globular head region of the hemagglutinin. • Sequences of the identified epitope are highly conserved among H1 and H9 subtypes. - Abstract: Most neutralizing antibodies elicited during influenza virus infection or by vaccination have a narrow spectrum because they usually target variable epitopes in the globular head region of hemagglutinin (HA). In this study, we describe a human monoclonal antibody (HuMAb), 5D7, that was prepared from the peripheral blood lymphocytes of a vaccinated volunteer using the fusion method. The HuMAb heterosubtypically neutralizes group 1 influenza A viruses, including seasonal H1N1, 2009 pandemic H1N1 (H1N1pdm) and avian H9N2, with a strong hemagglutinin inhibition activity. Selection of an escape mutant showed that the HuMAb targets a novel conformational epitope that is located in the HA head region but is distinct from the receptor binding site. Furthermore, Phe114Ile substitution in the epitope made the HA unrecognizable by the HuMAb. Amino acid residues in the predicted epitope region are also highly conserved in the HAs of H1N1 and H9N2. The HuMAb reported here may be a potential candidate for the development of therapeutic/prophylactic antibodies against H1 and H9 influenza viruses.
Potential arsenic exposures in 25 species of zoo animals living in CCA-wood enclosures
International Nuclear Information System (INIS)
Gress, J.; Silva, E.B. da; Oliveira, L.M. de; Zhao, Di; Anderson, G.; Heard, D.; Stuchal, L.D.; Ma, L.Q.
2016-01-01
Animal enclosures are often constructed from wood treated with the pesticide chromated copper arsenate (CCA), which leaches arsenic (As) into adjacent soil during normal weathering. This study evaluated potential pathways of As exposure in 25 species of zoo animals living in CCA-wood enclosures. We analyzed As speciation in complete animal foods, dislodgeable As from CCA-wood, and As levels in enclosure soils, as well as As levels in biomarkers of 9 species of crocodilians (eggs), 4 species of birds (feathers), 1 primate species (hair), and 1 porcupine species (quills). Elevated soil As in samples from 17 enclosures was observed at 1.0–110 mg/kg, and enclosures housing threatened and endangered species had As levels higher than USEPA's risk-based Eco-SSL for birds and mammals of 43 and 46 mg/kg. Wipe samples of CCA-wood on which primates sit had dislodgeable As residues of 4.6–111 μg/100 cm 2 , typical of unsealed CCA-wood. Inorganic As doses from animal foods were estimated at 0.22–7.8 μg/kg bw/d. Some As levels in bird feathers and crocodilian eggs were higher than prior studies on wild species. However, hair from marmosets had 6.37 mg/kg As, 30-fold greater than the reference value, possibly due to their inability to methylate inorganic As. Our data suggested that elevated As in soils and dislodgeable As from CCA-wood could be important sources of As exposure for zoo animals. - Highlights: • Daily inorganic As dose from zoo animal foods was 0.22–7.8 μg/kg bw/day. • Total As concentrations in soils of zoo animal enclosures were 1.0–110 mg/kg. • Endangered zoo animals live in soils with As above USEPA Eco-SSLs for avian and mammal species. • Dislodgeable As on CCA-wood beams where primates sit was 4.6–111 μg/100 cm 2 . • Marmoset hair had 6.37 mg/kg As compared to a reference value of 0.21 mg/kg.
Potential arsenic exposures in 25 species of zoo animals living in CCA-wood enclosures
Energy Technology Data Exchange (ETDEWEB)
Gress, J. [State Key Laboratory of Pollution Control and Resource Reuse, School of the Environment, Nanjing University, Jiangsu 201146 (China); Soil and Water Science Department, University of Florida, Gainesville, FL 32611 (United States); Silva, E.B. da; Oliveira, L.M. de [Soil and Water Science Department, University of Florida, Gainesville, FL 32611 (United States); Zhao, Di [State Key Laboratory of Pollution Control and Resource Reuse, School of the Environment, Nanjing University, Jiangsu 201146 (China); Anderson, G. [Virginia Polytechnic Institute and State University, Blacksburg, VA 24061 (United States); Heard, D. [Department of Small Animal Clinical Sciences, University of Florida, Gainesville, FL 32610 (United States); Stuchal, L.D. [Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Department of Environmental and Global Health, College of Public Health and Health Professions, University of Florida, Gainesville, FL 32611 (United States); Ma, L.Q., E-mail: lqma@ufl.edu [State Key Laboratory of Pollution Control and Resource Reuse, School of the Environment, Nanjing University, Jiangsu 201146 (China); Soil and Water Science Department, University of Florida, Gainesville, FL 32611 (United States)
2016-05-01
Animal enclosures are often constructed from wood treated with the pesticide chromated copper arsenate (CCA), which leaches arsenic (As) into adjacent soil during normal weathering. This study evaluated potential pathways of As exposure in 25 species of zoo animals living in CCA-wood enclosures. We analyzed As speciation in complete animal foods, dislodgeable As from CCA-wood, and As levels in enclosure soils, as well as As levels in biomarkers of 9 species of crocodilians (eggs), 4 species of birds (feathers), 1 primate species (hair), and 1 porcupine species (quills). Elevated soil As in samples from 17 enclosures was observed at 1.0–110 mg/kg, and enclosures housing threatened and endangered species had As levels higher than USEPA's risk-based Eco-SSL for birds and mammals of 43 and 46 mg/kg. Wipe samples of CCA-wood on which primates sit had dislodgeable As residues of 4.6–111 μg/100 cm{sup 2}, typical of unsealed CCA-wood. Inorganic As doses from animal foods were estimated at 0.22–7.8 μg/kg bw/d. Some As levels in bird feathers and crocodilian eggs were higher than prior studies on wild species. However, hair from marmosets had 6.37 mg/kg As, 30-fold greater than the reference value, possibly due to their inability to methylate inorganic As. Our data suggested that elevated As in soils and dislodgeable As from CCA-wood could be important sources of As exposure for zoo animals. - Highlights: • Daily inorganic As dose from zoo animal foods was 0.22–7.8 μg/kg bw/day. • Total As concentrations in soils of zoo animal enclosures were 1.0–110 mg/kg. • Endangered zoo animals live in soils with As above USEPA Eco-SSLs for avian and mammal species. • Dislodgeable As on CCA-wood beams where primates sit was 4.6–111 μg/100 cm{sup 2}. • Marmoset hair had 6.37 mg/kg As compared to a reference value of 0.21 mg/kg.
The UC Davis/NIH NeuroMab Facility
Federal Laboratory Consortium — The mission of the UC Davis/NIH NeuroMab facility is to generate and distribute high quality, validated mouse monoclonal antibodies against molecular targets found...
Concerns have been raised regarding the safety of young children contacting arsenic and chromium residues while playing on and around Chromated Copper Arsenate (CCA) treated wood playground structures and decks. Although CCA registrants voluntarily canceled treated wood for re...
Directory of Open Access Journals (Sweden)
Allaoua Kedjadja
2015-10-01
Full Text Available A new polycyclic compound, 1,1′-{1,4-phenylene bis[3-(6-chloro-2-methyl-4-phenylquinolin-3-yl-4,5-dihydro-1H-pyrazole-5,1-diyl]}dibutan-1-one (3 has been synthesized by cyclocondensation of (2E,2′E-1,1′-bis(6-chloro-2-methyl-4-phenylquinolin-3-yl-3,3′-(1,4-phenylenediprop-2-en-1-one (2 and hydrazine hydrate in butanoic acid. The structure of this compound was established by elemental analysis, 1H-NMR, 13C-NMR, mass and IR spectroscopy.
Whitehouse, Andrew J. O.; Coon, Hilary; Miller, Judith; Salisbury, Bryanna; Bishop, Dorothy V. M.
2010-01-01
This study investigated whether the Communication Checklist-Adult (CC-A) could identify subtypes of social and communication dysfunction in autism probands and their parents. The CC-A is divided into subscales measuring linguistic ability as well as two aspects of social communication: the Pragmatic Skills subscale assesses the level of pragmatic…
Role of the CCA bulge of prohead RNA of bacteriophage ø29 in DNA packaging.
Zhao, Wei; Morais, Marc C; Anderson, Dwight L; Jardine, Paul J; Grimes, Shelley
2008-11-14
The oligomeric ring of prohead RNA (pRNA) is an essential component of the ATP-driven DNA packaging motor of bacteriophage ø29. The A-helix of pRNA binds the DNA translocating ATPase gp16 (gene product 16) and the CCA bulge in this helix is essential for DNA packaging in vitro. Mutation of the bulge by base substitution or deletion showed that the size of the bulge, rather than its sequence, is primary in DNA packaging activity. Proheads reconstituted with CCA bulge mutant pRNAs bound the packaging ATPase gp16 and the packaging substrate DNA-gp3, although DNA translocation was not detected with several mutants. Prohead/bulge-mutant pRNA complexes with low packaging activity had a higher rate of ATP hydrolysis per base pair of DNA packaged than proheads with wild-type pRNA. Cryoelectron microscopy three-dimensional reconstruction of proheads reconstituted with a CCA deletion pRNA showed that the protruding pRNA spokes of the motor occupy a different position relative to the head when compared to particles with wild-type pRNA. Therefore, the CCA bulge seems to dictate the orientation of the pRNA spokes. The conformational changes observed for this mutant pRNA may affect gp16 conformation and/or subsequent ATPase-DNA interaction and, consequently, explain the decreased packaging activity observed for CCA mutants.
kCCA Transformation-Based Radiometric Normalization of Multi-Temporal Satellite Images
Directory of Open Access Journals (Sweden)
Yang Bai
2018-03-01
Full Text Available Radiation normalization is an essential pre-processing step for generating high-quality satellite sequence images. However, most radiometric normalization methods are linear, and they cannot eliminate the regular nonlinear spectral differences. Here we introduce the well-established kernel canonical correlation analysis (kCCA into radiometric normalization for the first time to overcome this problem, which leads to a new kernel method. It can maximally reduce the image differences among multi-temporal images regardless of the imaging conditions and the reflectivity difference. It also perfectly eliminates the impact of nonlinear changes caused by seasonal variation of natural objects. Comparisons with the multivariate alteration detection (CCA-based normalization and the histogram matching, on Gaofen-1 (GF-1 data, indicate that the kCCA-based normalization can preserve more similarity and better correlation between an image-pair and effectively avoid the color error propagation. The proposed method not only builds the common scale or reference to make the radiometric consistency among GF-1 image sequences, but also highlights the interesting spectral changes while eliminates less interesting spectral changes. Our method enables the application of GF-1 data for change detection, land-use, land-cover change detection etc.
Damage assessment of compression loaded debond damaged sandwich panels
DEFF Research Database (Denmark)
Moslemian, Ramin; Berggreen, Christian; Quispitupa, Amilcar
2010-01-01
with an implanted circular face/core debond. Compression tests were conducted on intact sandwich panels and panels with an implanted circular face/core debond with three different types of foam core materials (PVC H130, PVC H250 and PMI 51-IG). The strains and out-of-plane displacements of the debonded region were...
Analysis of Japanese Municipalities With Geopark, MAB, and GIAHS Certification
Directory of Open Access Journals (Sweden)
Ryo Kohsaka
2015-11-01
Full Text Available We analyzed the discussions of Japanese municipalities in their process for obtaining certifications for the Geoparks by the United Nations Educational, Scientific and Cultural Organization (UNESCO, the Man and the Biosphere Programme (MAB by the UNESCO, and the Globally Important Agricultural Heritage systems (GIAHS by the Food and Agriculture Organization (FAO of the United Nations. The official records at the municipality diet were analyzed in a quantitative manner from 2011 to 2013. As the first step, we analyzed the eight municipalities of Noto and Sado for the GIAHS, the cities Itoigawa and Hakusan for the Geopark, and Katsuyama Yamanouchi village from Nagano for the MAB. As individual examples, we analyzed City of Suzu with GIAHS, Itoigawa (Geopark, and Yamanouchi town (MAB with the text-mining approach. For the GIAHS, it was clear that the larger municipalities with city status tended to discuss certification issues more frequently than the smaller towns and villages. Terms such as conservation and certification tended to be used with GIAHS at the Suzu City. The term brand was used with GIAHS and MAB but not for the Geopark. The findings using quantitative methods are at initial stage for analysis of municipality strategies and require further future research.
Sandwich ELISA for quantitative detection of human collagen prolyl 4-hydroxylase
Directory of Open Access Journals (Sweden)
Myllyharju Johanna
2010-06-01
Full Text Available Abstract Background We describe a method for specific, quantitative and quick detection of human collagen prolyl 4-hydroxylase (C-P4H, the key enzyme for collagen prolyl-4 hydroxylation, in crude samples based on a sandwich ELISA principle. The method is relevant to active C-P4H level monitoring during recombinant C-P4H and collagen production in different expression systems. The assay proves to be specific for the active C-P4H α2β2 tetramer due to the use of antibodies against its both subunits. Thus in keeping with the method C-P4H is captured by coupled to an anti-α subunit antibody magnetic beads and an anti-β subunit antibody binds to the PDI/β subunit of the protein. Then the following holoenzyme detection is accomplished by a goat anti-rabbit IgG labeled with alkaline phosphatase which AP catalyzes the reaction of a substrate transformation with fluorescent signal generation. Results We applied an experimental design approach for the optimization of the antibody concentrations used in the sandwich ELISA. The assay sensitivity was 0.1 ng of C-P4H. The method was utilized for the analysis of C-P4H accumulation in crude cell extracts of E. coli overexpressing C-P4H. The sandwich ELISA signals obtained demonstrated a very good correlation with the detected protein activity levels measured with the standard radioactive assay. The developed assay was applied to optimize C-P4H production in E. coli Origami in a system where the C-P4H subunits expression acted under control by different promoters. The experiments performed in a shake flask fed-batch system (EnBase® verified earlier observations that cell density and oxygen supply are critical factors for the use of the inducer anhydrotetracycline and thus for the soluble C-P4H yield. Conclusions Here we show an example of sandwich ELISA usage for quantifying multimeric proteins. The method was developed for monitoring the amount of recombinant C-P4H tetramer in crude E. coli extracts. Due
Mass of 11Li from the 1H(11Li,9Li)3H reaction
International Nuclear Information System (INIS)
Roger, T.; Savajols, H.; Mittig, W.; Caamano, M.; Roussel-Chomaz, P.; Tanihata, I.; Alcorta, M.; Bandyopadhyay, D.; Bieri, R.; Buchmann, L.; Davids, B.; Galinski, N.; Howell, D.; Mills, W.; Mythili, S.; Openshaw, R.; Padilla-Rodal, E.; Ruprecht, G.; Sheffer, G.; Shotter, A. C.
2009-01-01
The mass of 11 Li has been determined from Q-value measurements of the 1 H( 11 Li, 9 Li) 3 H reaction. The experiment was performed at TRIUMF laboratory with the GANIL active target MAYA. Energy-energy and angle-angle kinematics reconstruction give a Q value of 8.119(22) MeV for the reaction. The derived 11 Li two-neutron separation energy is S 2n =363(22) keV
High sensitive photonic crystal multiplexed biosensor array using H0 sandwiched cavities
Directory of Open Access Journals (Sweden)
Arafa Safia
2017-01-01
Full Text Available We theoretically investigate a high sensitive photonic crystal integrated biosensor array structure which is potentially used for label-free multiplexed sensing. The proposed device consists of an array of three sandwiched H0 cavities patterned above silicon on insulator (SOI substrate; each cavity has been designed for different cavity spacing and different resonant wavelength. Results obtained by performing finite-difference time-domain (FDTD simulations, indicate that the response of each detection unit shifts independently in terms of refractive index variations. The optimized design makes possible the combination of sensing as a function of location, as well as a function of time in the same platform. A refractive index sensitivity of 520nm/RIU and a quality factor over 104 are both achieved with an accompanied crosstalk of less than -26 dB. In addition, the device presents an improved detection limit (DL of 1.24.10-6 RIU and a wide measurement range. These features make the designed device a promising element for performing label-free multiplexed detection in monolithic substrate for medical diagnostics and environmental monitoring.
Effects of Designer Hyper-Interleukin 11 (H11 on Hematopoiesis in Myelosuppressed Mice.
Directory of Open Access Journals (Sweden)
Hanna Dams-Kozlowska
Full Text Available The incidence of cancer is constantly increasing. Chemo/radiotherapy is one of major methods of treating cancer. Although adverse chemo/radiotherapy events, such as anemia and neutropenia, can be successfully cured, thrombocytopenia is still problematic. We constructed the Hyper-IL11 (H11 cytokine by linking soluble interleukin 11 receptor alpha (sIL-11Ralpha with IL-11. In vivo H11 activity was examined in myelosuppressed mice. Myelosuppression was induced by either i sublethal irradiation and carboplatin administration or ii sublethal irradiation. A dose of 100 μg/kg of H11 or IL-11 was administered subcutaneously for 7 days. IL-11 and H11 accelerated leukocyte, hematocrit and platelet recovery. The effect on the attenuation of thrombocytopenia was significant. Moreover, both cytokines increased the cellularity and numbers of megakaryocyte, erythroid, and granulocyte/macrophage progenitors in the bone morrow and spleen compared with the control. Although H11 was administered at a molar concentration that was three times lower, its effects were comparable with or better than those of IL-11; thus, the activity of H11 was superior to that of IL-11. Because no toxicity was observed after the intravenous administration of H11, this hyper-cytokine may be potentially useful for treatment of thrombocytopenia and other IL-11-dependent disorders.
Photodegradation of emamectin benzoate in aqueous solutions
International Nuclear Information System (INIS)
Mushtaq, M.; Chukwudebe, A.C.; Wrzesinski, C.; Allen, L.R.S.; Luffer-Atlas, D.; Arison, B.H.
1998-01-01
The half-life of [ 14 C]4'-deoxy-4'-(epi-methylamino)avermectin B1a (MAB1a) benzoate (1 ppm) photodegradation in buffer (pH 7), natural pond water, and sensitized buffer (1% acetone in pH 7 buffer) determined at Three Bridges, NJ (latitude approximately 40 degrees N) during the fall season under natural sunlight was 22, 7, and 1 days, respectively. The half-life of [ 14 C]MAB1a benzoate (10-12 ppm) photodegradation in buffer (pH 7) containing 1% (v/v) acetonitrile, ethanol, or acetone as cosolvent under continuous exposure with a xenon lamp was 64.5, 8.5, or 0.5 days, respectively. The photoisomer 8,9-Z-MAB1a, 8a-hydroxy-MAB1a, and unknown polar residues were found in light-exposed samples of MAB1a in buffer and natural pond water. In light-exposed sensitized buffer samples, 8a-oxo-MAB1a and MAB1a-10,11-14,15-diepoxide were additional products. Very polar residues found in the organic and aqueous phases after extraction increased with time, and their formation followed the order sensitized buffer natural pond water buffer. (author)
Giuntini, Serena; Reason, Donald C; Granoff, Dan M
2012-01-01
Meningococcal vaccines containing factor H binding protein (fHbp) are in clinical development. fHbp binds human fH, which enables the meningococcus to resist complement-mediated bacteriolysis. Previously, we found that chimeric human IgG1 mouse anti-fHbp monoclonal antibodies (MAbs) had human complement-mediated bactericidal activity only if the MAb inhibited fH binding. Since IgG subclasses differ in their ability to activate complement, we investigated the role of human IgG subclasses on antibody functional activity. We constructed chimeric MAbs in which three different murine fHbp-specific binding domains were each paired with human IgG1, IgG2, or IgG3. Against a wild-type group B isolate, all three IgG3 MAbs, irrespective of their ability to inhibit fH binding, had bactericidal activity that was >5-fold higher than the respective IgG1 MAbs, while the IgG2 MAbs had the least activity. Against a mutant with increased fHbp expression, the anti-fHbp MAbs elicited greater C4b deposition (classical pathway) and greater bactericidal activity than against the wild-type strain, and the IgG1 MAbs had similar or greater activity than the respective IgG3 MAbs. The bactericidal activity against both wild-type and mutant strains also was dependent, in part, on activation of the alternative complement pathway. Thus, at lower epitope density in the wild-type strain, the IgG3 anti-fHbp MAbs had the greatest bactericidal activity. At a higher epitope density in the mutant, the IgG1 MAbs had similar or greater bactericidal activity than the IgG3 MAbs, and the activity was less dependent on the inhibition of fH binding than at a lower epitope density.
Giuntini, Serena; Beernink, Peter T; Reason, Donald C; Granoff, Dan M
2012-01-01
Meningococcal factor H binding protein (fHbp) is a promising vaccine candidate. Anti-fHbp antibodies can bind to meningococci and elicit complement-mediated bactericidal activity directly. The antibodies also can block binding of the human complement down-regulator, factor H (fH). Without bound fH, the organism would be expected to have increased susceptibility to bacteriolysis. Here we describe bactericidal activity of two anti-fHbp mAbs with overlapping epitopes in relation to their different effects on fH binding and bactericidal activity. Both mAbs recognized prevalent fHbp sequence variants in variant group 1. Using yeast display and site-specific mutagenesis, binding of one of the mAbs (JAR 1, IgG3) to fHbp was eliminated by a single amino acid substitution, R204A, and was decreased by K143A but not by R204H or D142A. The JAR 1 epitope overlapped that of previously described mAb (mAb502, IgG2a) whose binding to fHbp was eliminated by R204A or R204H substitutions, and was decreased by D142A but not by K143A. Although JAR 1 and mAb502 appeared to have overlapping epitopes, only JAR 1 inhibited binding of fH to fHbp and had human complement-mediated bactericidal activity. mAb502 enhanced fH binding and lacked human complement-mediated bactericidal activity. To control for confounding effects of different mouse IgG subclasses on complement activation, we created chimeric mAbs in which the mouse mAb502 or JAR 1 paratopes were paired with human IgG1 constant regions. While both chimeric mAbs showed similar binding to fHbp, only JAR 1, which inhibited fH binding, had human complement-mediated bactericidal activity. The lack of human complement-mediated bactericidal activity by anti-fHbp mAb502 appeared to result from an inability to inhibit binding of fH. These results underscore the importance of inhibition of fH binding for anti-fHbp mAb bactericidal activity.
Directory of Open Access Journals (Sweden)
Zhao-Jun Li
Full Text Available Two novel coordination compounds of half-sandwiched ruthenium(II containing 2-(5-fluorouracil-yl-N-(pyridyl-acetamide were synthesized, and their intercalation binding modes with calf thymus DNA were revealed by hyperchromism of ultraviolet-visible spectroscopy; the binding constants were determined according to a Langmuir adsorption equation that was deduced on the base of careful cyclic voltammetry measurements. The two compounds exhibited DNA intercalation binding activities with the binding constants of 1.13×106 M-1 and 5.35 ×105 M-1, respectively.
Music recommendation according to human motion based on kernel CCA-based relationship
Ohkushi, Hiroyuki; Ogawa, Takahiro; Haseyama, Miki
2011-12-01
In this article, a method for recommendation of music pieces according to human motions based on their kernel canonical correlation analysis (CCA)-based relationship is proposed. In order to perform the recommendation between different types of multimedia data, i.e., recommendation of music pieces from human motions, the proposed method tries to estimate their relationship. Specifically, the correlation based on kernel CCA is calculated as the relationship in our method. Since human motions and music pieces have various time lengths, it is necessary to calculate the correlation between time series having different lengths. Therefore, new kernel functions for human motions and music pieces, which can provide similarities between data that have different time lengths, are introduced into the calculation of the kernel CCA-based correlation. This approach effectively provides a solution to the conventional problem of not being able to calculate the correlation from multimedia data that have various time lengths. Therefore, the proposed method can perform accurate recommendation of best matched music pieces according to a target human motion from the obtained correlation. Experimental results are shown to verify the performance of the proposed method.
Bin Yu; Chung Y. Hse; Todd F. Shupe
2009-01-01
The effects of acid concentration, reaction time, and temperature in a microwave reactor on recovery of CCA-treated wood were evaluated. Extraction of copper, chromium, and arsenic metals from chromated copper arsenate (CCA)-treated southern pine wood samples with three different acids (i.e., acetic acid, oxalic acid, and phosphoric acid) was investigated using in...
Advancing Coordination Between DRM and CCA in Integrated Flood Risk Management
DEFF Research Database (Denmark)
Jebens, Martin; Sørensen, Carlo Sass
Flood hazards in coastal regions induce risks toward lives, property, economy and the environment. In need of sustainable and holistic actions to reduce risks, these should include innovative Disaster Risk Management (DRM) and Climate Change Adaptation (CCA) measures. While differing on important...... flood events to exert pressure on the national government, and in a top-down approach the government could identify the needs among the civil society to include these in the decision-making process.......-structural measures is hampered by lack in coordination that should be improved to agree e.g. on an acceptable risk definition and to avoid duplicating efforts. To advance awareness and coordination between DRM and CCA and to improve measures, a bottom-up approach could by initiated by civil society using recent...
A novel sandwich Fe-Mn damping alloy with ferrite shell prepared by vacuum annealing
Qian, Bingnan; Peng, Huabei; Wen, Yuhua
2018-04-01
To improve the corrosion resistance of high strength Fe-Mn damping alloys, we fabricated a novel sandwich Fe-17.5Mn damping alloy with Mn-depleted ferrite shell by vacuum annealing at 1100 °C. The formation behavior of the ferrite shell obeys the parabolic law for the vacuum annealed Fe-17.5Mn alloy at 1100 °C. The sandwich Fe-17.5Mn alloy with ferrite shell exhibits not only better corrosion resistance but also higher damping capacity than the conventional annealed Fe-17.5Mn alloy under argon atmosphere. The existence of only ferrite shell on the surface accounts for the better corrosion in the sandwich Fe-17.5Mn alloy. The better damping capacity in the sandwich Fe-17.5Mn alloy is owed to more stacking faults inside both ɛ martensite and γ austenite induced by the stress from ferrite shell. Vacuum annealing is a new way to improve the corrosion resistance and damping capacity of Fe-Mn damping alloys.
Kaneko, Mika K; Nakamura, Takuro; Kunita, Akiko; Fukayama, Masashi; Abe, Shinji; Nishioka, Yasuhiko; Yamada, Shinji; Yanaka, Miyuki; Saidoh, Noriko; Yoshida, Kanae; Fujii, Yuki; Ogasawara, Satoshi; Kato, Yukinari
2017-06-01
Podoplanin is expressed in many cancers, including oral cancers and brain tumors. The interaction between podoplanin and its receptor C-type lectin-like receptor 2 (CLEC-2) has been reported to be involved in cancer metastasis and tumor malignancy. We previously established many monoclonal antibodies (mAbs) against human podoplanin using the cancer-specific mAb (CasMab) technology. LpMab-23 (IgG 1 , kappa), one of the mouse anti-podoplanin mAbs, was shown to be a CasMab. However, we have not shown the usefulness of LpMab-23 for antibody therapy against podoplanin-expressing cancers. In this study, we first determined the minimum epitope of LpMab-23 and revealed that Gly54-Leu64 peptide, especially Gly54, Thr55, Ser56, Glu57, Asp58, Arg59, Tyr60, and Leu64 of podoplanin, is a critical epitope of LpMab-23. We further produced human-mouse chimeric LpMab-23 (chLpMab-23) and investigated whether chLpMab-23 exerts antibody-dependent cellular cytotoxicity (ADCC) and antitumor activity. In flow cytometry, chLpMab-23 showed high sensitivity against a podoplanin-expressing glioblastoma cell line, LN319, and an oral cancer cell line, HSC-2. chLpMab-23 also showed ADCC activity against podoplanin-expressing CHO cells (CHO/podoplanin). In xenograft models with HSC-2 and CHO/podoplanin, chLpMab-23 exerts antitumor activity using human natural killer cells, indicating that chLpMab-23 could be useful for antibody therapy against podoplanin-expressing cancers.
Liu, Wen; Chen, Liang; Tu, Xintian
2017-10-01
This study validated a Chinese adaptation of the Emotion Regulation Questionnaire for Children and Adolescents (ERQ-CCA), a self-report instrument that evaluates two emotion regulation (ER) strategies, based on the process model of ER. The ERQ-CCA was evaluated using a sample of 1381 Chinese children aged between 7 and 12 years. The internal consistencies of the two factors indicated adequate reliability. Confirmatory factor analysis (CFA) revealed good support as the structure proved to be identical with that of the original instrument. Multigroup CFA supported an invariant factor solution of the ERQ-CCA across several demographic variations (gender, age, registered permanent residence and migrant status) in different groups. Test-retest correlations over a 2-month period were calculated using a subsample of children (N = 70). Convergent validity was evaluated in relation to the model dimensions of the ERQ-CCA, Chinese version of the Children's Depression Inventory, and Chinese version of the Eysenck Personality Questionnaire for Children and Adolescents. Results indicated that the ERQ-CCA has generally satisfactory reliability and validity in investigating the use of two ER strategies during the middle childhood developmental period. © 2015 International Union of Psychological Science.
Energy Technology Data Exchange (ETDEWEB)
Saad, Wael E. A., E-mail: ws6r@virginia.edu; Kalagher, S.; Turba, U. C.; Sabri, S. S.; Park, A.-W.; Stone, J.; Angle, J. F.; Matsumoto, A. H. [University of Virginia Health System, Department of Radiology and Medical Imaging, Division of Vascular Interventional Radiology (United States)
2013-08-01
PurposeThis study describes and evaluated the effectiveness of occluding distal ureters in the clinical setting of urinary vaginal (vesicovaginal or enterovesicovaginal) fistulae utilizing a new technique which combines Amplatzer vascular plugs and N-butyl cyanoacrylate.MaterialsThis is a retrospective study (January 2007-December 2010) of patients with urinary-vaginal fistulae undergoing distal ureter embolization utilizing an Amplatzer- N-butyl cyanoacrylate-Amplatzer sandwich technique. An 8-12-mm type-I or type-II Amplatzer vascular plug was delivered using the sheath and deployed in the ureter distal to the pelvic brim. Instillation of 0.8-1.5 cc of N-butyl cyanoacrylate into ureter proximal to the Amplatzer plug was performed. This was followed by another set of 8-12-mm type-I or type-II Amplatzer vascular plugs in a technique referred to as the 'sandwich technique.'ResultsFive ureters in three patients were occluded utilizing the above-described technique during the 4-year study period. Mean maximum size Amplatzer used per ureter was 10.8 mm (range, 8-12). One ureter required three Amplatzer plugs and the rest required two. Two patients (3 ureters) were clinically successful with complete resolution of symptoms in 36-48 h. The third patient (2 ureters) was partly successful and required a second Amplatzer- N-butyl cyanoacrylate sandwich technique embolization. The mean clinical follow-up was 11.3 months (range, 1.7-29.2).ConclusionsThe Amplatzer- N-butyl cyanoacrylate-Amplatzer sandwich technique for occluding the distal ureter is safe and effective with a quick (probably due to the N-butyl cyanoacrylate) and durable (probably due to the Amplatzer plugs) clinical response.
Energy Dissipation in Sandwich Structures During Axial Compression
DEFF Research Database (Denmark)
Urban, Jesper
2002-01-01
The purpose of this paper is to investigate the energy dissipation in sandwich structures during axial crushing. Axial crushing tests on six sandwich elements are described. The sandwich elements consist of a polyurethane core and E-glass/Polyester skin. The elements compare to full-scale structu......The purpose of this paper is to investigate the energy dissipation in sandwich structures during axial crushing. Axial crushing tests on six sandwich elements are described. The sandwich elements consist of a polyurethane core and E-glass/Polyester skin. The elements compare to full...
Dynamics of immature mAb glycoform secretion during CHO cell culture
DEFF Research Database (Denmark)
Jimenez del Val, Ioscani; Fan, Yuzhou; Weilguny, Dietmar
2016-01-01
Ensuring consistent glycosylation-associated quality of therapeutic monoclonal antibodies (mAbs) has become a priority in pharmaceutical bioprocessing given that the distribution and composition of the carbohydrates (glycans) bound to these molecules determines their therapeutic efficacy and immu......Ensuring consistent glycosylation-associated quality of therapeutic monoclonal antibodies (mAbs) has become a priority in pharmaceutical bioprocessing given that the distribution and composition of the carbohydrates (glycans) bound to these molecules determines their therapeutic efficacy...
Whitehouse, AJ; Coon, H; Miller, J; Salisbury, B; Bishop, DV
2010-01-01
This study investigated whether the Communication Checklist – Adult (CC-A) could identify subtypes of social and communication dysfunction in autism probands and their parents. The CC-A is divided into subscales measuring linguistic ability as well as two aspects of social communication: the Pragmatic Skills subscale assesses the level of pragmatic oddities (e.g., excessive talking), while the Social Engagement subscale picks up on those behaviours that reflect a more passive communication st...
Tsumuraya, Takeshi; Takeuchi, Katsutoshi; Yamashita, Shuji; Fujii, Ikuo; Hirama, Masahiro
2012-09-01
Ciguatera fish poisoning (CFP) is a form of food poisoning caused by the ingestion of a variety of reef fish that have accumulated trace amounts of ciguatoxins produced by dinoflagellates of the genus Gambierdiscus through the food chain. CFP affects more than 50,000 people each year. The extremely low level of the causative neurotoxins, ciguatoxins, in fish has hampered the preparation of antibodies for detecting the toxins. In this paper, we describe a thiol strategy for synthesizing a keyhole limpet hemocyanin (KLH)-conjugate (20) of the ABCDE-ring fragment of the Pacific ciguatoxins, CTX1B (1) and 54-deoxyCTX1B (4). We succeeded in producing a monoclonal antibody (3G8) against the left wings of these ciguatoxins by immunizing mice with the hapten-KLH conjugate (20) as the synthetic antigen. The most promising mAb, 3G8, does not cross-react with other related marine toxins. Sandwich enzyme-linked immunosorbent assay (ELISA) utilizing 3G8 and the previously prepared monoclonal antibody (8H4) enabled us to detect 1 specifically at less than 0.28 ng/mL. Copyright © 2012 Elsevier Ltd. All rights reserved.
Malberg, J.; Lupton, E.; Schnöckelborg, E.M.; de Bruin, B.; de Sutter, J.; Meyer, K.; Hartl, F.; Wolf, R.
2013-01-01
The dissymmetrical naphthalene-bridged complexes [Cp'Fe(mu-C10H8)FeCp*] (3; Cp* = eta(5)-C5Me5, Cp' = eta(5)-C5H2-1,2,4-tBu(3)) and [Cp'Fe(mu-C10H8)RuCp*] (4) were synthesized via a one-pot procedure from FeCl2(thf)(1.5), Cp'K, KC10H8, and [Cp*FeCl(tmeda)] (tmeda =
Technical Note: PLASTIMATCH MABS, an open source tool for automatic image segmentation
International Nuclear Information System (INIS)
Zaffino, Paolo; Spadea, Maria Francesca; Raudaschl, Patrik; Fritscher, Karl; Sharp, Gregory C.
2016-01-01
Purpose: Multiatlas based segmentation is largely used in many clinical and research applications. Due to its good performances, it has recently been included in some commercial platforms for radiotherapy planning and surgery guidance. Anyway, to date, a software with no restrictions about the anatomical district and image modality is still missing. In this paper we introduce PLASTIMATCH MABS, an open source software that can be used with any image modality for automatic segmentation. Methods: PLASTIMATCH MABS workflow consists of two main parts: (1) an offline phase, where optimal registration and voting parameters are tuned and (2) an online phase, where a new patient is labeled from scratch by using the same parameters as identified in the former phase. Several registration strategies, as well as different voting criteria can be selected. A flexible atlas selection scheme is also available. To prove the effectiveness of the proposed software across anatomical districts and image modalities, it was tested on two very different scenarios: head and neck (H&N) CT segmentation for radiotherapy application, and magnetic resonance image brain labeling for neuroscience investigation. Results: For the neurological study, minimum dice was equal to 0.76 (investigated structures: left and right caudate, putamen, thalamus, and hippocampus). For head and neck case, minimum dice was 0.42 for the most challenging structures (optic nerves and submandibular glands) and 0.62 for the other ones (mandible, brainstem, and parotid glands). Time required to obtain the labels was compatible with a real clinical workflow (35 and 120 min). Conclusions: The proposed software fills a gap in the multiatlas based segmentation field, since all currently available tools (both for commercial and for research purposes) are restricted to a well specified application. Furthermore, it can be adopted as a platform for exploring MABS parameters and as a reference implementation for comparing against
Technical Note: PLASTIMATCH MABS, an open source tool for automatic image segmentation
Energy Technology Data Exchange (ETDEWEB)
Zaffino, Paolo; Spadea, Maria Francesca [Department of Experimental and Clinical Medicine, Magna Graecia University of Catanzaro, Catanzaro 88100 (Italy); Raudaschl, Patrik; Fritscher, Karl [Institute for Biomedical Image Analysis, Private University of Health Sciences, Medical Informatics and Technology, Hall in Tirol 6060 (Austria); Sharp, Gregory C. [Department for Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts 02114 (United States)
2016-09-15
Purpose: Multiatlas based segmentation is largely used in many clinical and research applications. Due to its good performances, it has recently been included in some commercial platforms for radiotherapy planning and surgery guidance. Anyway, to date, a software with no restrictions about the anatomical district and image modality is still missing. In this paper we introduce PLASTIMATCH MABS, an open source software that can be used with any image modality for automatic segmentation. Methods: PLASTIMATCH MABS workflow consists of two main parts: (1) an offline phase, where optimal registration and voting parameters are tuned and (2) an online phase, where a new patient is labeled from scratch by using the same parameters as identified in the former phase. Several registration strategies, as well as different voting criteria can be selected. A flexible atlas selection scheme is also available. To prove the effectiveness of the proposed software across anatomical districts and image modalities, it was tested on two very different scenarios: head and neck (H&N) CT segmentation for radiotherapy application, and magnetic resonance image brain labeling for neuroscience investigation. Results: For the neurological study, minimum dice was equal to 0.76 (investigated structures: left and right caudate, putamen, thalamus, and hippocampus). For head and neck case, minimum dice was 0.42 for the most challenging structures (optic nerves and submandibular glands) and 0.62 for the other ones (mandible, brainstem, and parotid glands). Time required to obtain the labels was compatible with a real clinical workflow (35 and 120 min). Conclusions: The proposed software fills a gap in the multiatlas based segmentation field, since all currently available tools (both for commercial and for research purposes) are restricted to a well specified application. Furthermore, it can be adopted as a platform for exploring MABS parameters and as a reference implementation for comparing against
Analysis and Behaviour of Sandwich Panels with Profiled Metal Facings under Transverse Load
Directory of Open Access Journals (Sweden)
M. Budescu
2004-01-01
Full Text Available Sandwich panels with thin steel facings and polyurethane core combine the load-carrying capacity of metal facings and protection functions with core properties. The core separates the two facings and keeps them in a stable condition, transmits shear between external layers, provides most of the shear rigidity and occasionally makes of useful contribution to the bending stiffness of the sandwich construction as a whole [1]. An experimental program on sandwich panels has been organized to prove that the mechanical properties of core and interface satisfy the load-carrying requirements for structural sandwich panels. The analysis of sandwich panels with deep profiles facings for cladding elements, respectively the roof constructions, has been carried out according to the European design norms [1], [5].
A Pseudoproxy-Ensemble Study of Late-Holocene Climate Field Reconstructions Using CCA
Amrhein, D. E.; Smerdon, J. E.
2009-12-01
Recent evaluations of late-Holocene multi-proxy reconstruction methods have used pseudoproxy experiments derived from millennial General Circulation Model (GCM) integrations. These experiments assess the performance of a reconstruction technique by comparing pseudoproxy reconstructions, which use restricted subsets of model data, against complete GCM data fields. Most previous studies have tested methodologies using different pseudoproxy noise levels, but only with single realizations for each noise classification. A more robust evaluation of performance is to create an ensemble of pseudoproxy networks with distinct sets of noise realizations and a corresponding reconstruction ensemble that can be evaluated for consistency and sensitivity to random error. This work investigates canonical correlation analysis (CCA) as a late-Holocene climate field reconstruction (CFR) technique using ensembles of pseudoproxy experiments derived from the NCAR CSM 1.4 millennial integration. Three 200-member reconstruction ensembles are computed using pseudoproxies with signal-to-noise ratios (by standard deviation) of 1, 0.5, and 0.25 and locations that approximate the spatial distribution of real-world multiproxy networks. An important component of these ensemble calculations is the independent optimization of the three CCA truncation parameters for each ensemble member. This task is accomplished using an inexpensive discrete optimization algorithm that minimizes both RMS error in the calibration interval and the number of free parameters in the reconstruction model to avoid artificial skill. Within this framework, CCA is investigated for its sensitivity to the level of noise in the pseudoproxy network and the spatial distribution of the network. Warm biases, variance losses, and validation-interval error increase with noise level and vary spatially within the reconstructed fields. Reconstruction skill, measured as grid-point correlations during the validation interval, is lowest in
Routine production of H11CN and :11C:-1-aminocyclopentanecarboxylic acid
International Nuclear Information System (INIS)
Sambre, J.; Vandecasteele, C.; Geothals, P.; Rabi, N.A.; Haver, D. van; Slegers, G.
1985-01-01
The production of H 11 CN using the 14 N(p,α) 11 C reaction, was studied. The yield is 140 mCi/μA at saturation (EOB). From 1.8 Ci of H 11 CN 140 mCi of [ 11 C]ACPC are produced routinely and under remote-control. Chemical and pharmaceutical controls showed that the product is suitable for injection. (author)
Energy Technology Data Exchange (ETDEWEB)
Pal, Kuntal; Kumar, Shiva; Sharma, Shikha; Garg, Saurabh Kumar; Alam, Mohammad Suhail; Xu, H. Eric; Agrawal, Pushpa; Swaminathan, Kunchithapadam (NU Sinapore); (Van Andel); (IMT-India)
2010-07-13
The open reading frame Rv1326c of Mycobacterium tuberculosis (Mtb) H37Rv encodes for an {alpha}-1,4-glucan branching enzyme (MtbGlgB, EC 2.4.1.18, Uniprot entry Q10625). This enzyme belongs to glycoside hydrolase (GH) family 13 and catalyzes the branching of a linear glucose chain during glycogenesis by cleaving a 1 {yields} 4 bond and making a new 1 {yields} 6 bond. Here, we show the crystal structure of full-length MtbGlgB (MtbGlgBWT) at 2.33-{angstrom} resolution. MtbGlgBWT contains four domains: N1 {beta}-sandwich, N2 {beta}-sandwich, a central ({beta}/{alpha}){sub 8} domain that houses the catalytic site, and a C-terminal {beta}-sandwich. We have assayed the amylase activity with amylose and starch as substrates and the glycogen branching activity using amylose as a substrate for MtbGlgBWT and the N1 domain-deleted (the first 108 residues deleted) Mtb{Delta}108GlgB protein. The N1 {beta}-sandwich, which is formed by the first 105 amino acids and superimposes well with the N2 {beta}-sandwich, is shown to have an influence in substrate binding in the amylase assay. Also, we have checked and shown that several GH13 family inhibitors are ineffective against MtbGlgBWT and Mtb{Delta}108GlgB. We propose a two-step reaction mechanism, for the amylase activity (1 {yields} 4 bond breakage) and isomerization (1 {yields} 6 bond formation), which occurs in the same catalytic pocket. The structural and functional properties of MtbGlgB and Mtb{Delta}108GlgB are compared with those of the N-terminal 112-amino acid-deleted Escherichia coli GlgB (EC{Delta}112GlgB).
Development of at-line assay to monitor charge variants of MAbs during production.
St Amand, M M; Ogunnaike, B A; Robinson, A S
2014-01-01
One major challenge currently facing the biopharmaceutical industry is to understand how MAb microheterogeneity affects therapeutic efficacy, potency, immunogenicity, and clearance. MAb micro-heterogeneity can result from post-translational modifications such as sialylation, galactosylation, C-terminal lysine cleavage, glycine amidation, and tryptophan oxidation, each of which can generate MAb charge variants; such heterogeneity can affect pharmacokinetics (PK) considerably. Implementation of appropriate on-line quality control strategies may help to regulate bioprocesses, thus enabling more homogenous material with desired post-translational modifications and PK behavior. However, one major restriction to implementation of quality control strategies is the availability of techniques for obtaining on-line or at-line measurements of these attributes. In this work, we describe the development of an at-line assay to separate MAb charge variants in near real-time, which could ultimately be used to implement on-line quality control strategies for MAb production. The assay consists of a 2D-HPLC method with sequential in-line Protein A and WCX-10 HPLC column steps. To perform the 2D-HPLC assay at-line, the two columns steps were integrated into a single method using a novel system configuration that allowed parallel flow over column 1 or column 2 or sequential flow from column 1 to column 2. A bioreactor system was also developed such that media samples could be removed automatically from bioreactor vessels during production and delivered to the 2D-HPLC for analysis. With this at-line HPLC assay, we have demonstrated that MAb microheterogeneity occurs throughout the cell cycle whether the host cell line is grown under different or the same nominal culture conditions. © 2013 American Institute of Chemical Engineers.
Jambeck, Jenna; Weitz, Keith; Solo-Gabriele, Helena; Townsend, Timothy; Thorneloe, Susan
2007-01-01
Chromated copper arsenate (CCA)-treated wood is a preservative treated wood construction product that grew in use in the 1970s for both residential and industrial applications. Although some countries have banned the use of the product for some applications, others have not, and the product continues to enter the waste stream from construction, demolition and remodeling projects. CCA-treated wood as a solid waste is managed in various ways throughout the world. In the US, CCA-treated wood is disposed primarily within landfills; however some of the wood is combusted in waste-to-energy (WTE) facilities. In other countries, the predominant disposal option for wood, sometimes including CCA-treated wood, is combustion for the production of energy. This paper presents an estimate of the quantity of CCA-treated wood entering the disposal stream in the US, as well as an examination of the trade-offs between landfilling and WTE combustion of CCA-treated wood through a life-cycle assessment and decision support tool (MSW DST). Based upon production statistics, the estimated life span and the phaseout of CCA-treated wood, recent disposal projections estimate the peak US disposal rate to occur in 2008, at 9.7 million m(3). CCA-treated wood, when disposed with construction and demolition (C&D) debris and municipal solid waste (MSW), has been found to increase arsenic and chromium concentrations in leachate. For this reason, and because MSW landfills are lined, MSW landfills have been recommended as a preferred disposal option over unlined C&D debris landfills. Between landfilling and WTE for the same mass of CCA-treated wood, WTE is more expensive (nearly twice the cost), but when operated in accordance with US Environmental Protection Agency (US EPA) regulations, it produces energy and does not emit fossil carbon emissions. If the wood is managed via WTE, less landfill area is required, which could be an influential trade-off in some countries. Although metals are concentrated
DEFF Research Database (Denmark)
Manca, Marcello; Quispitupa, Amilcar; Berggreen, Christian
2012-01-01
Face/core fatigue crack growth in foam-cored sandwich composites is examined using the mixed mode bending (MMB) test method. The mixed mode loading at the debond crack tip is controlled by changing the load application point in the MMB test fixture. Sandwich specimens were manufactured using H45...... and H100 PVC foam cores and E-glass/polyester face sheets. All specimens were pre-cracked in order to define a sharp crack front. The static debond fracture toughness for each material configuration was measured at different mode-mixity phase angles. Fatigue tests were performed at 80% of the static...
Directory of Open Access Journals (Sweden)
Li H
2015-07-01
Full Text Available Hua-Fei Li,1–3,* Cong Wu,4,* Ting Chen,5,* Ge Zhang,1 He Zhao,1 Chang-Hong Ke,1 Zheng Xu21International Joint Cancer Institute, Translation Medicine Institute, 2Planning Division, Scientific Research Department, 3Tumor Immunology and Gene Therapy Center, Eastern Hepatobiliary Surgery Hospital, 4Department of Laboratory Diagnosis, Changhai Hospital, 5Department of Cardiology, Changhai Hospital, the Second Military Medical University, Shanghai, People’s Republic of China *These authors contributed equally to this work Abstract: The CD20-directed monoclonal antibody rituximab (RTX established a new era in the treatment of non-Hodgkin lymphoma (NHL; however, suboptimal response and/or resistance to RTX still limit its clinical merits. Although four effector mechanisms are validated to participate in CD20-based immunotherapy, including complement-dependent cytotoxicity, antibody-dependent cell-mediated cytotoxicity, caspase-dependent apoptosis, and lysosome-mediated programmed cell death (PCD, they could hardly be synchronously activated by any anti-CD20 mAb or mAb derivative until now. Herein, a novel mAb nanocomb (polyethylenimine polymer–RTX–tositumomab [PPRT nanocomb] was firstly constructed through mass arming two different anti-CD20 mAbs (RTX and tositumomab to one polymer by nanotechnology. Comparing with free mAbs, PPRT nanocomb possesses a comparable binding ability and reduced “off-rate” to surface CD20 of NHL cells. When treated by PPRT nanocomb, the caspase-dependent apoptosis was remarkably enhanced except for concurrently eliciting complement-dependent cytotoxicity, antibody-dependent cell-mediated cytotoxicity, and lysosome-mediated PCD. Besides, “cross-cell link”-assisted homotypic adhesion by PPRT nanocomb further enhanced the susceptibility to PCD of lymphoma cells. Pharmacokinetic assays revealed that PPRT nanocomb experienced a relatively reduced clearance from peripheral blood compared with free antibodies. With
Energy Technology Data Exchange (ETDEWEB)
Shang, Sensen [Institute of Molecular and Crystal Engineering, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); Zhao, Junwei, E-mail: zhaojunwei@henu.edu.cn [Institute of Molecular and Crystal Engineering, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China); Chen, Lijuan [Institute of Molecular and Crystal Engineering, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); Basic Experiment Teaching Center, Henan University, Kaifeng, Henan 475004 (China); Li, Yuye; Zhang, Jingli; Li, Yanzhou [Institute of Molecular and Crystal Engineering, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China); Niu, Jingyang, E-mail: jyniu@henu.edu.cn [Institute of Molecular and Crystal Engineering, College of Chemistry and Chemical Engineering, Henan University, Kaifeng, Henan 475004 (China)
2012-12-15
Three organic-inorganic hybrid TM-Ln heterometallic phosphotungstates [Cu(dap){sub 2}(H{sub 2}O)][Cu(dap){sub 2}]{sub 3.5}[La({alpha}-HPW{sub 11}O{sub 39}){sub 2}]{center_dot}6H{sub 2}O (1) [Cu(dap){sub 2}(H{sub 2}O)]{sub 0.5}[Cu(dap){sub 2}]{sub 4}[Nd({alpha}-HPW{sub 11}O{sub 39}){sub 2}]{center_dot}4H{sub 2}O (2) and [Cu(dap){sub 2}(H{sub 2}O)]{sub 2}[Cu(dap){sub 2}]{sub 3.5}[Eu({alpha}-PW{sub 11}O{sub 39}){sub 2}]{center_dot}6H{sub 2}O (3) (dap=1,2-diaminopropane) have been hydrothermally synthesized and structurally characterized by elemental analyses, IR spectra, optical diffuse reflectance spectra, powder X-ray diffraction (PXRD), thermogravimetric (TG) analyses and single-crystal X-ray diffraction. Their common features are that 1-3 all consist of asymmetric sandwich-type subunits [Ln({alpha}-PW{sub 11}O{sub 39}){sub 2}]{sup 11-} and [Cu(dap){sub 2}]{sup 2+} bridges. Both 1 and 2 display the 2-D (4,4)-topological sheets whereas 3 exhibits the 3-D 5-connected (4{sup 6}{center_dot}6{sup 4}) topological framework. The magnetic properties of 2 and 3 and the luminescence performance of 3 have been measured. - Graphical Abstract: Three TM-Ln heterometallic phosphotungstates 1-3 have been synthesized and characterized by elemental analyses, IR spectra, optical diffuse reflectance spectra, X-ray diffraction, thermogravimetric analyses magnetic susceptibility and luminescent properties. Highlights: Black-Right-Pointing-Pointer Cu{sup II}-Ln{sup III} heterometallic polyoxometalates. Black-Right-Pointing-Pointer 2-D and 3-D organic-inorganic hybrid phosphotungstates. Black-Right-Pointing-Pointer 2-D and 3-D structures consisting of Cu{sup II}-Ln{sup III} heterometals.
New "sandwich" structures conformed from three dimensional
Directory of Open Access Journals (Sweden)
Alba, Juan J.
1996-03-01
Full Text Available Poor interlaminar properties as well as poor-skin-to-core adhesion properties are very often the common existing problems we find when designing with "sandwich" structures. A new type of 3D-fabric "sandwich" structure is being developed in order to avoid these problems. Although the manufacturing process is very simple, a very complex "sandwich" structure is obtained as a result of the complexity of the 3D-fabric used. This 3D-fabric is a 3D woven glass fabric produced on velvet weaving machines with glass yarns. It is an integrally woven "sandwich" laminate for all kinds of composite products. The strength of the vertical fibers makes, that also after impregnation with a resin matrix, the "sandwich" structure is maintained. The result is a laminate with high strength and stiffness and low weight. On each side of this "sandwich" laminate additional reinforcement materials can be laminated and a synthetic foam can be injected in the hollow structure. This will allow to establish the mechanical properties of a finished product.
Las pobres propiedades, tanto interlaminares como de adhesión entre piel y núcleo, constituyen uno de los grandes problemas cuando se diseñan estructuras utilizando paneles tipo "sandwich". Un nuevo tipo de panel "sandwich", configurado a partir de tejidos tridimensionales, está siendo desarrollado en la actualidad con el objetivo de eliminar esos problemas. Aunque el proceso de fabricación es muy simple, el panel "sandwich" obtenido es de estructura compleja, como resultado de la complejidad del tejido tridimensional utilizado. Este tejido tridimensional (3D es un tejido de fibra de vidrio producido en máquinas de tejer especializadas. La resistencia de las fibras verticales hace que, después de la impregnación con una resina, se mantenga la configuración tipo "sandwich". El resultado es un laminado de alta resistencia, gran rigidez y bajo peso. Sobre cada uno de los lados del panel "sandwich" se pueden
Sound transmission loss of composite sandwich panels
Zhou, Ran
Light composite sandwich panels are increasingly used in automobiles, ships and aircraft, because of the advantages they offer of high strength-to-weight ratios. However, the acoustical properties of these light and stiff structures can be less desirable than those of equivalent metal panels. These undesirable properties can lead to high interior noise levels. A number of researchers have studied the acoustical properties of honeycomb and foam sandwich panels. Not much work, however, has been carried out on foam-filled honeycomb sandwich panels. In this dissertation, governing equations for the forced vibration of asymmetric sandwich panels are developed. An analytical expression for modal densities of symmetric sandwich panels is derived from a sixth-order governing equation. A boundary element analysis model for the sound transmission loss of symmetric sandwich panels is proposed. Measurements of the modal density, total loss factor, radiation loss factor, and sound transmission loss of foam-filled honeycomb sandwich panels with different configurations and thicknesses are presented. Comparisons between the predicted sound transmission loss values obtained from wave impedance analysis, statistical energy analysis, boundary element analysis, and experimental values are presented. The wave impedance analysis model provides accurate predictions of sound transmission loss for the thin foam-filled honeycomb sandwich panels at frequencies above their first resonance frequencies. The predictions from the statistical energy analysis model are in better agreement with the experimental transmission loss values of the sandwich panels when the measured radiation loss factor values near coincidence are used instead of the theoretical values for single-layer panels. The proposed boundary element analysis model provides more accurate predictions of sound transmission loss for the thick foam-filled honeycomb sandwich panels than either the wave impedance analysis model or the
Effect of a magnetic field on the excess resistance of SNS sandwiches
International Nuclear Information System (INIS)
Logvenov, G.Y.; Ryazanov, V.V.
1983-01-01
The contribution of superconducting plates to the resistance of Ta--Cu--Ta sandwiches in the presence of a magnetic field of up to 170 Ge is investigated. Near the superconducting transition temperature T/sub c/H, the Ta used was in a mixed (vortical) state. It is shown that the presence of gradients of the order parameter near the Abrikosov vortices appreciably changes the penetration depth of a longitudinal electric field into the superconductor and leads to a corresponding change in the excess resistance of SNS sandwiches
Directory of Open Access Journals (Sweden)
Leandro Barbiéri de Carvalho
2010-04-01
Full Text Available Studies have shown that ticks are susceptible to infection by entomopathogenic nematodes. These studies indicate different susceptibilities of ticks to infection by these fungi, depending on the tick species, development phase, entomopathogenic nematodes species and strains and the time the ticks are exposed to them. Usually this period ranges from 24 to 72 hours. The aim of this study was to evaluate the infection times in vitro of engorged Rhipicephalus (Boophilus microplus females by the entomopathogenic nematodes Steinernema glaseri CCA strain, by analysis of the ticks' biological parameters. The results show that a 2-hour exposure time was sufficient for the engorged R. microplus females to be infected by S. glaseri CCA, but that a minimum exposure time of 24 hours was necessary to generate treatment efficacy above 90%.Os carrapatos são susceptíveis à infecção por nematoides entomopatogênicos. Essa susceptibilidade diverge quanto às espécies de carrapato estudadas, à fase evolutiva, às espécies e estirpes dos nematoides e ao tempo ao qual os carrapatos ficam expostos a estes. O presente trabalho teve como objetivo avaliar os tempos de infecção in vitro de fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus pelo nematoide entomopatogênico Steinernema glaseri estirpe CCA, pela análise dos parâmetros biológicos do carrapato. Os resultados obtidos demonstraram que um período de duas horas de exposição foi suficiente para que fêmeas ingurgitadas de R. microplus fossem infectadas por S. glaseri CCA e que um período de exposição mínimo de 24h foi necessário para que houvesse infecção de fêmeas ingurgitadas de R. microplus por S. glaseri estirpe CCA, capaz de gerar, in vitro, eficácia no tratamento superior a 90%.
Azmi, M. A.; Abdullah, H. Z.; Idris, M. I.
2013-12-01
This research focuses on the fabrication and characterization of sandwich composite panels using glass fiber composite skin and polyurethane foam reinforced coconut coir fiber core. The main objectives are to characterize the physical and mechanical properties and to elucidate the effect of coconut coir fibers in polyurethane foam cores and sandwich composite panels. Coconut coir fibers were used as reinforcement in polyurethane foams in which later were applied as the core in sandwich composites ranged from 5 wt% to 20 wt%. The physical and mechanical properties found to be significant at 5 wt% coconut coir fiber in polyurethane foam cores as well as in sandwich composites. It was found that composites properties serve better in sandwich composites construction.
International Nuclear Information System (INIS)
Azmi, M A; Abdullah, H Z; Idris, M I
2013-01-01
This research focuses on the fabrication and characterization of sandwich composite panels using glass fiber composite skin and polyurethane foam reinforced coconut coir fiber core. The main objectives are to characterize the physical and mechanical properties and to elucidate the effect of coconut coir fibers in polyurethane foam cores and sandwich composite panels. Coconut coir fibers were used as reinforcement in polyurethane foams in which later were applied as the core in sandwich composites ranged from 5 wt% to 20 wt%. The physical and mechanical properties found to be significant at 5 wt% coconut coir fiber in polyurethane foam cores as well as in sandwich composites. It was found that composites properties serve better in sandwich composites construction
The degree of π electron delocalization and the formation of 3D-extensible sandwich structures.
Wang, Xiang; Wang, Qiang; Yuan, Caixia; Zhao, Xue-Feng; Li, Jia-Jia; Li, Debao; Wu, Yan-Bo; Wang, Xiaotai
2016-04-28
DFT B3LYP/6-31G(d) calculations were performed to examine the feasibility of graphene-like C42H18 and starbenzene C6(BeH)6 (SBz) polymers as ligands of 3D-extensible sandwich compounds (3D-ESCs) with uninterrupted sandwich arrays. The results revealed that sandwich compounds with three or more C42H18 ligands were not feasible. The possible reason may be the localization of π electrons on certain C6 hexagons due to π-metal interactions, which makes the whole ligand lose its electronic structure basis (higher degree of π electron delocalization) to maintain the planar structure. For comparison, with the aid of benzene (Bz) molecules, the SBz polymers can be feasible ligands for designing 3D-ESCs because the C-Be interactions in individual SBz are largely ionic, which will deter the π electrons on one C6 ring from connecting to those on neighbouring C6 rings. This means that high degree of π electron delocalization is not necessary for maintaining the planarity of SBz polymers. Such a locally delocalized π electron structure is desirable for the ligands of 3D-ESCs. Remarkably, the formation of a sandwich compound with SBz is thermodynamically more favourable than that found for bis(Bz)chromium. The assembly of 3D-ESCs is largely exothermic, which will facilitate future experimental synthesis. The different variation trends on the HOMO-LUMO gaps in different directions (relative to the sandwich axes) suggest that they can be developed to form directional conductors or semiconductors, which may be useful in the production of electronic devices.
1-[(1-Methyl-1H-imidazol-5-ylmethyl]-1H-indole-5-carbonitrile
Directory of Open Access Journals (Sweden)
Josephus Jacobus de Jager
2012-12-01
Full Text Available In the title compound, C14H12N4, the dihedral angle between the indole ring system (r.m.s. deviation = 0.010 Å and the imidazole ring is 77.70 (6°. In the crystal, molecules are linked by C—H...N hydrogen bonds. One set of hydrogen bonds forms an undulating chain running parallel to the b-axis direction, while the other undulating chain is parallel to the c-axis direction. In combination, (100 sheets result.
Advancing Coordination Between DRM and CCA in Integrated Flood Risk Management
DEFF Research Database (Denmark)
Flood hazards in coastal regions induce risks toward lives, property, economy and the environment. In need of sustainable and holistic actions to reduce risks, these should include innovative Disaster Risk Management (DRM) and Climate Change Adaptation (CCA) measures. While differing on important...
Chemical yields from low-temperature pyrolysis of CCA-treated wood
Qirong Fu; Dimitris Argyropolous; Lucian Lucia; David Tilotta; Stan Lebow
2009-01-01
Low-temperature pyrolysis offers a feasible option for wood-waste management and the recovery of a variety of useful chemicals. The effect of chromated copper arsenate (CCA) wood preservative on the yield and composition of various pyrolysis products was investigated in the present research. A novel quantitative 31P nuclear magnetic resonance (...
Geremia, N M; Hryciw, T; Bao, F; Streijger, F; Okon, E; Lee, J H T; Weaver, L C; Dekaban, G A; Kwon, B K; Brown, A
2017-09-01
We have previously reported that administration of a CD11d monoclonal antibody (mAb) improves recovery in a clip-compression model of SCI. In this model the CD11d mAb reduces the infiltration of activated leukocytes into the injured spinal cord (as indicated by reduced intraspinal MPO). However not all anti-inflammatory strategies have reported beneficial results, suggesting that success of the CD11d mAb treatment may depend on the type or severity of the injury. We therefore tested the CD11d mAb treatment in a rat hemi-contusion model of cervical SCI. In contrast to its effects in the clip-compression model, the CD11d mAb treatment did not improve forelimb function nor did it significantly reduce MPO levels in the hemi-contused cord. To determine if the disparate results using the CD11d mAb were due to the biomechanical nature of the cord injury (compression SCI versus contusion SCI) or to the spinal level of the injury (12th thoracic level versus cervical) we further evaluated the CD11d mAb treatment after a T12 contusion SCI. In contrast to the T12 clip compression SCI, the CD11d mAb treatment did not improve locomotor recovery or significantly reduce MPO levels after T12 contusion SCI. Lesion analyses revealed increased levels of hemorrhage after contusion SCI compared to clip-compression SCI. SCI that is accompanied by increased intraspinal hemorrhage would be predicted to be refractory to the CD11d mAb therapy as this approach targets leukocyte diapedesis through the intact vasculature. These results suggest that the disparate results of the anti-CD11d treatment in contusion and clip-compression models of SCI are due to the different pathophysiological mechanisms that dominate these two types of spinal cord injuries. Crown Copyright © 2017. Published by Elsevier Inc. All rights reserved.
Juranič, Martina; Srilunchang, Kanok-orn; Krohn, Nádia Graciele; Leljak-Levanic, Dunja; Sprunck, Stefanie; Dresselhaus, Thomas
2012-12-01
Germline and early embryo development constitute ideal model systems to study the establishment of polarity, cell identity, and asymmetric cell divisions (ACDs) in plants. We describe here the function of the MATH-BTB domain protein MAB1 that is exclusively expressed in the germ lineages and the zygote of maize (Zea mays). mab1 (RNA interference [RNAi]) mutant plants display chromosome segregation defects and short spindles during meiosis that cause insufficient separation and migration of nuclei. After the meiosis-to-mitosis transition, two attached nuclei of similar identity are formed in mab1 (RNAi) mutants leading to an arrest of further germline development. Transient expression studies of MAB1 in tobacco (Nicotiana tabacum) Bright Yellow-2 cells revealed a cell cycle-dependent nuclear localization pattern but no direct colocalization with the spindle apparatus. MAB1 is able to form homodimers and interacts with the E3 ubiquitin ligase component Cullin 3a (CUL3a) in the cytoplasm, likely as a substrate-specific adapter protein. The microtubule-severing subunit p60 of katanin was identified as a candidate substrate for MAB1, suggesting that MAB1 resembles the animal key ACD regulator Maternal Effect Lethal 26 (MEL-26). In summary, our findings provide further evidence for the importance of posttranslational regulation for asymmetric divisions and germline progression in plants and identified an unstable key protein that seems to be involved in regulating the stability of a spindle apparatus regulator(s).
Experimental Treatment of Bladder Cancer with Bi-213-anti-EGFR MAb
International Nuclear Information System (INIS)
Seidl, Christof; Pfost, Birgit; Müller, Felix
2013-01-01
Therapy of non-muscle-invasive bladder cancer (carcinoma in situ) comprises transurethral resection of the tumour and subsequent instillation of the chemotherapeutic drug mitomycin C in order to eradicate remaining tumour cells. Yet 15 – 40% of treated patients relapse within 5 years. Therefore, new therapeutic strategies to combat tumour recurrence are needed. Alpha-particle emitting radionuclides efficiently kill single tumour cells or small tumour cell clusters. Because the epidermal growth factor receptor (EGFR) is overexpressed on bladder cancer cells, conjugates composed of the alpha-emitter Bi-213 and the anti-EGFR antibody matuzumab should provide a powerful drug to eliminate disseminated bladder cancer cells. Therefore, the aims of our study were (i) to analyse the cytotoxic effects of Bi-213-anti-EGFR radioimmunoconjugates at the cellular level, (ii) to evaluate therapeutic efficacy of intravesically applied Bi-213- anti-EGFR-Mab in a nude mouse model with intravesical human bladder cancer xenografts, (iii) to compare Bi- 213-anti-EGFR-Mab efficacy with chemotherapy using mitomycin C and (iv) to demonstrate that radioimmunotherapy is not toxic to cells of the bladder wall and of the kidneys
Directory of Open Access Journals (Sweden)
Parlindungan Manik
2012-02-01
Full Text Available Planning of ship construction is make its having good effectivity value and efficiency. Composite as materialalternative to changes of steel feedstock and wood has many applied named FRP (fiberglass reinforcedplastics single skin. The weakness of this FRP was heavy construction and requires many production time.Therefore, will be checked comparison between single skin with sandwich constructions for shell.In this research, the way for making composite is hand lay up method with three various thickness of skinthere are : t, t/2, and t/4. To know strength comparison from the various skin of sandwich with single skin,must be test, consist of tensile test.. The result is analyzed then compared by BKI (Biro Klasifikasi Indonesiarules for the fiberglass ship.Based on the result, indicates that optimization skin thickness of sandwich construction applies Corematwhich tensile strength it is equivalent with Single Skin at 2/3t and usage of Sandwich construction causes23,12 % lighter. In economic analyze, advantage from low weight is compensation of addition 23,12 % DWT.Material cost for Sandwich about 11,35% bigger than Single Skin construction.
International Nuclear Information System (INIS)
Loginov, D.A.; Muratov, D.V.; Starikova, Z.A.; Petrovskij, P.V.; Kudinov, A.R.
2006-01-01
The reaction of the (borole)rhodium iodide complex [(η-C 4 H 4 BPh)RhI] 4 with Cp*Li afforded the sandwich compound Cp*Rh(η-C 4 H 4 BPh) (1). The reactions of compound 1 with the solvated complexes [Cp*M(MeNO 2 ) 3 ] 2+ (BF 4 - ) 2 gave triple-decker cationic complexes with the central borole ligand [Cp*Rh(μ-η 5 :η 5 -C 4 H 4 BPh)MCp*] 2+ (BF 4 - ) 2 (M = Rh or Ir). The structure of complex 1 was established by X-ray diffraction [ru
Kato, Yukinari; Kunita, Akiko; Fukayama, Masashi; Abe, Shinji; Nishioka, Yasuhiko; Uchida, Hiroaki; Tahara, Hideaki; Yamada, Shinji; Yanaka, Miyuki; Nakamura, Takuro; Saidoh, Noriko; Yoshida, Kanae; Fujii, Yuki; Honma, Ryusuke; Takagi, Michiaki; Ogasawara, Satoshi; Murata, Takeshi; Kaneko, Mika K
2017-02-01
The interaction between podoplanin (PDPN) and C-type lectin-like receptor 2 (CLEC-2) is involved in tumor malignancy. We have established many monoclonal antibodies (mAbs) against human podoplanin using the cancer-specific mAb (CasMab) technology. LpMab-21, one of the mouse antipodoplanin mAbs, is of the IgG 2a subclass, and its minimum epitope was determined to be Thr76-Arg79 of the human podoplanin. Importantly, sialic acid is linked to Thr76; therefore, LpMab-21 is an antiglycopeptide mAb (GpMab). In this study, we investigated whether LpMab-21 shows antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against human podoplanin-expressing cancer cell lines in vitro and also studied its antitumor activities using a xenograft model. LpMab-21 showed high ADCC and CDC activities against not only podoplanin-expressing Chinese hamster ovary cells but also LN319 glioblastoma cells and PC-10 lung cancer cells, both of which endogenously express podoplanin. Furthermore, LpMab-21 decreased tumor growth in vivo, indicating that LpMab-21 could be useful for antibody therapy against human podoplanin-expressing cancers.
SPECT scintigraphy with HDP and Mab BW 250/183 of loosened hip endoprothesis
Energy Technology Data Exchange (ETDEWEB)
Predic, P [Hospital Celje, Celje (Sierra Leone); Gregoric, E [Hospital Izola, Izola (Sierra Leone); Dodig, D [Clinical Hospital Centre, Zagreb (Croatia). Dept. of Nuclear Medicine and Radiation Protection
1994-10-01
Main problem of the loosened hip endoprothesis is in distinguishing between the aseptic and septic loosening of endoprothesis. The study involved 27 pts with a loosened hip; 15 pts with aseptic and 12 pts with septic loosening. The patients were injected 550-770 MBq Tc-99m-HDP and underwent SPECT scintigraphy of the hips to repeat then the examination with only 370 MBq Tc-99m-Mab Bw 230/183. HDP application evidenced positive accumulation at the endoprothesis in all patients with a loosened hip while Mab Bw 250/183 only in the patients with septic loosening. Conclusion: SPECT scintigraphy of hip endoprothesis with HDP and Mab BW 250/183 allows differential diagnosing between septic and aseptic hip loosening and hereby a correct therapeutical approach. (author).
Sandwich iridium complexes with the monoanionic carborane ligand [9-SMe2-7,8-C2B9H10]-
International Nuclear Information System (INIS)
Loginov, D.A.; Vinogradov, M.M.; Perekalin, D.S.; Starikova, Z.A.; Lysenko, K.A.; Petrovskij, P.V.; Kudinov, A.R.
2006-01-01
The reaction of the [(η-9-SMe 2 -7,8-C 2 B 9 H 10 )IrBr 2 ] 2 complex with Tl[Tl(η-7,8-C 2 B 9 H 11 )] afforded the iridacarborane compound (η-9-SMe 2 -7,8-C 2 B 9 H 10 )Ir(η-7,8-C 2 B 9 H 11 ). The cationic complex [Cp*Ir(η-9-SMe 2 -7,8-C 2 B 9 H 10 )] + PF 6 - (Cp* is pentamethylcyclopentadienyl) was synthesized by the reaction of [Cp*IrCl 2 ] 2 with Na[9-SMe 2 -7,8-C 2 B 9 H 10 ]. The structures of (η-9-SMe 2 -7,8-C 2 B 9 H 10 )Ir(η-cod) (cod is 1,5-cyclooctadiene) and [Cp*Ir(η-9-SMe 2 -7,8-C 2 B 9 H 10 ]PF 6 were established by X-ray diffraction [ru
International Nuclear Information System (INIS)
Thominiaux, C.; Damont, A.L.; Kuhnast, B.; Demphel, St.; Le Helleix, St.; Chauveau, F.; Boutin, H.; Van Camp, N.; Boisgard, R.; Tavitian, B.; Dolle, F.; Boisnard, S.; Rivron, L.; Roy, S.; Allen, J.; Chauveau, F.; Boutin, H.; Van Camp, N.; Boisgard, R.; Tavitian, B.; Rooney, T.; Benavides, J.; Hantraye, Ph.
2010-01-01
SSR180575 (7-chloro-N, N, 5-trimethyl-4-oxo-3-phenyl-3, 5-dihydro-4H-pyridazino [4, 5-b]indole-1-acetamide) is the lead compound of an original pyridazino-indole series of potent and highly selective TSPO (peripheral benzodiazepine receptor) ligands. Isotopic labeling of SSR180575 with the short-lived positron-emitter carbon-11 (T1/2: 20.38 min) at its 5-methyl-pyridazino[4, 5-b]indole moiety as well as at its N, N-dimethylacetamide function by methylation of the corresponding nor-analogues was investigated. Best results in terms of radiochemical yields and purities were obtained for the preparation of [indole-N-methyl- 11 C]SSR180575, where routine production batches of 4.5-5.0 GBq of radiochemically pure (499%) i.v. injectable solutions (specific radioactivities: 50-90 GBq/μmol) could be prepared within a total synthesis time of 25 min (HPLC purification included) starting from a 55 GBq [ 11 C]CO 2 cyclotron production batch (non decay-corrected overall radiochemical yields: 8-9%). The process comprises (1) trapping at -10 C of [ 11 C]methyl triflate in DMF (300 μl) containing 0.2-0.3 mg of the indole precursor for labeling and 4 mg of K 2 CO 3 (excess); (2) heating at 120 C for 3 min; (3) dilution of the residue with 0.5 ml of the HPLC mobile phase and (4) purification using semi-preparative reversed phase HPLC (Zorbax R SB-C-18). In vivo pharmacological properties of [indole-N-methyl- 11 C]SSR180575 as a candidate for imaging neuro-inflammation with positron emission tomography are currently evaluated. (authors)
Law, S C; Guyett, F J; King, R G; Boura, A L; Jackson, W R; Hodgson, W C
1992-01-01
We have synthesized and examined some of the pharmacological properties of 6-[N,S-dimethyl-N'-cyanoisothioureidomethyl]-6,11-dihydro-5H- dibenz(b,e)azepine hydrochloride (Fran 12), a derivative of 6-methylaminomethyl-6,11-dihydro-5H- dibenz[b,e,]azepine. In the guinea-pig isolated ileum, Fran 12 (10(-7)-10(-5) M) caused parallel rightward shifts of the concentration-response curves to histamine. A Schild plot gave a pA2 of 7.48, with a slope not significantly different from -1.0. In the rat stomach fundus strip and in endothelium-denuded aortic rings, Fran 12 inhibited contractile responses to 5-hydroxytryptamine in a non-competitive manner. In both chloralose-anaesthetized and pithed rats, it inhibited pressor responses to 5-hydroxytryptamine. It had no effect on depressor responses to 5-hydroxytryptamine in anaesthetized rats. In pithed rats, Fran 12 (0.25-2 mg/kg, i.v.) produced dose-dependent increases in blood pressure. These were not inhibited by i.v. phentolamine, prazosin, yohimbine, propranolol, methysergide, pentolinium or atropine but were inhibited by verapamil. These results indicate that Fran 12 is a histamine and 5-hydroxytryptamine antagonist which also exerts pressor effects via a peripheral action. The pressor action does not appear to be mediated via effects on alpha 1- or alpha 2-adrenoceptors, muscarinic or nicotinic cholinoceptors or 5-hydroxytryptamine receptors, although calcium channel activation may play a role.
Kandula, Syam; Shrestha, Khem Raj; Kim, Nam Hoon; Lee, Joong Hee
2018-05-10
Supercapacitors suffer from lack of energy density and impulse the energy density limit, so a new class of hybrid electrode materials with promising architectures is strongly desirable. Here, the rational design of a 3D hierarchical sandwich Co 9 S 8 /α-MnS@N-C@MoS 2 nanowire architecture is achieved during the hydrothermal sulphurization reaction by the conversion of binary mesoporous metal oxide core to corresponding individual metal sulphides core along with the formation of outer metal sulphide shell at the same time. Benefiting from the 3D hierarchical sandwich architecture, Co 9 S 8 /α-MnS@N-C@MoS 2 electrode exhibits enhanced electrochemical performance with high specific capacity/capacitance of 306 mA h g -1 /1938 F g -1 at 1 A g -1 , and excellent cycling stability with a specific capacity retention of 86.9% after 10 000 cycles at 10 A g -1 . Moreover, the fabricated asymmetric supercapacitor device using Co 9 S 8 /α-MnS@N-C@MoS 2 as the positive electrode and nitrogen doped graphene as the negative electrode demonstrates high energy density of 64.2 Wh kg -1 at 729.2 W kg -1 , and a promising energy density of 23.5 Wh kg -1 is still attained at a high power density of 11 300 W kg -1 . The hybrid electrode with 3D hierarchical sandwich architecture promotes enhanced energy density with excellent cyclic stability for energy storage. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Sound-proof Sandwich Panel Design via Metamaterial Concept
Sui, Ni
Sandwich panels consisting of hollow core cells and two face-sheets bonded on both sides have been widely used as lightweight and strong structures in practical engineering applications, but with poor acoustic performance especially at low frequency regime. Basic sound-proof methods for the sandwich panel design are spontaneously categorized as sound insulation and sound absorption. Motivated by metamaterial concept, this dissertation presents two sandwich panel designs without sacrificing weight or size penalty: A lightweight yet sound-proof honeycomb acoustic metamateiral can be used as core material for honeycomb sandwich panels to block sound and break the mass law to realize minimum sound transmission; the other sandwich panel design is based on coupled Helmholtz resonators and can achieve perfect sound absorption without sound reflection. Based on the honeycomb sandwich panel, the mechanical properties of the honeycomb core structure were studied first. By incorporating a thin membrane on top of each honeycomb core, the traditional honeycomb core turns into honeycomb acoustic metamaterial. The basic theory for such kind of membrane-type acoustic metamaterial is demonstrated by a lumped model with infinite periodic oscillator system, and the negative dynamic effective mass density for clamped membrane is analyzed under the membrane resonance condition. Evanescent wave mode caused by negative dynamic effective mass density and impedance methods are utilized to interpret the physical phenomenon of honeycomb acoustic metamaterials at resonance. The honeycomb metamaterials can extraordinarily improve low-frequency sound transmission loss below the first resonant frequency of the membrane. The property of the membrane, the tension of the membrane and the numbers of attached membranes can impact the sound transmission loss, which are observed by numerical simulations and validated by experiments. The sandwich panel which incorporates the honeycomb metamateiral as
Yu, Chuanfei; Gao, Kai; Zhu, Lei; Wang, Wenbo; Wang, Lan; Zhang, Feng; Liu, Chunyu; Li, Meng; Wormald, Mark R; Rudd, Pauline M; Wang, Junzhi
2016-01-29
Two non-human glycan epitopes, galactose-α-1,3-galactose (α-gal) and Neu5Gc-α-2-6-galactose (Neu5Gc) have been shown to be antigenic when attached to Fab oligosaccharides of monoclonal antibodies (mAbs) , while α-gal attached to Fc glycans was not. However, the antigenicity of Neu5Gc on the Fc glycans remains unclear in the context that most mAbs carry only Fc glycans. After studying two clinical mAbs carrying significant amounts of Fc Neu5Gc, we show that their binding activity with anti-Neu5Gc antibody resided in a small subset of mAbs carrying two or more Fc Neu5Gc, while mAbs harboring only one Neu5Gc showed no reactivity. Since most Neu5Gc epitopes were distributed singly on the Fc of mAbs, our results suggest that the potential antigenicity of Fc Neu5Gc is low. Our study could be referenced in the process design and optimization of mAb production in murine myeloma cells and in the quality control of mAbs for industries and regulatory authorities.
Directory of Open Access Journals (Sweden)
Kinya Okamoto
Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.
Directory of Open Access Journals (Sweden)
Hossam Murad
2017-05-01
Full Text Available BackgroundMonitoring blood levels of human growth hormone (hGH in most children with short stature deficiencies is crucial for taking a decision of treatment with extended course of daily and expensive doses of recombinant hGH (rhGH or Somatropin®. Besides, misusing of rhGH by sportsmen is banned by the World Anti-Doping Agency and thus sensitive GH-detecting methods are highly welcome in this field. Nanobodies are the tiniest antigen-binding entity derived from camel heavy chain antibodies. They were successfully generated against numerous antigens including hormones.MethodsA fully nanobody-based sandwich ELISA method was developed in this work for direct measurement of GH in biological samples.ResultsTwo major characteristics of nanobody were exploited for this goal: the robust and stable structure of the nanobody (NbGH04 used to capture hGH from tested samples, and the great ability of tailoring, enabling the display of the anti-GH detector nanobody (NbGH07 on the tip of M13-phage. Such huge, stable, and easy-to-prepare phage-Nb was used in ELISA to provide an amplified signal. Previously, NbGH04 was retrieved on immobilized hGH by phage display from a wide “immune” cDNA library prepared from a hGH-immunized camel. Here, and in order to assure epitope heterogeneity, NbGH07 was isolated from the same library using NbGH04-captured hGH as bait. Interaction of both nanobodies with hGH was characterized and compared with different anti-GH nanobodies and antibodies. The sensitivity (~0.5 ng/ml and stability of the nanobody-base sandwich ELISA were assessed using rhGH before testing in the quantification of hGH in blood sera and cell culture supernatants.ConclusionIn regard to all advantages of nanobodies; stability, solubility, production affordability in Escherichia coli, and gene tailoring, nanobody-based phage sandwich ELISA developed here would provide a valuable method for hGH detection and quantification.
Directory of Open Access Journals (Sweden)
Edgard Jauregui
2017-11-01
Full Text Available The calcium/calmodulin-dependent protein kinase (CCaMK is regulated by free Ca2+ and Ca2+-loaded calmodulin. This dual binding is believed to be involved in its regulation and associated physiological functions, although direct experimental evidence for this is lacking. Here we document that site-directed mutations in the calmodulin-binding domain of CCaMK alters its binding capacity to calmodulin, providing an effective approach to study how calmodulin regulates CCaMK in terms of kinase activity and regulation of rhizobial symbiosis in Medicago truncatula. We observed that mutating the tryptophan at position 342 to phenylalanine (W342F markedly increased the calmodulin-binding capability of the mutant. The mutant CCaMK underwent autophosphorylation and catalyzed substrate phosphorylation in the absence of calcium and calmodulin. When the mutant W342F was expressed in ccamk-1 roots, the transgenic roots exhibited an altered nodulation phenotype. These results indicate that altering the calmodulin-binding domain of CCaMK could generate a constitutively activated kinase with a negative role in the physiological function of CCaMK.
High temperature structural sandwich panels
Papakonstantinou, Christos G.
High strength composites are being used for making lightweight structural panels that are being employed in aerospace, naval and automotive structures. Recently, there is renewed interest in use of these panels. The major problem of most commercial available sandwich panels is the fire resistance. A recently developed inorganic matrix is investigated for use in cases where fire and high temperature resistance are necessary. The focus of this dissertation is the development of a fireproof composite structural system. Sandwich panels made with polysialate matrices have an excellent potential for use in applications where exposure to high temperatures or fire is a concern. Commercial available sandwich panels will soften and lose nearly all of their compressive strength temperatures lower than 400°C. This dissertation consists of the state of the art, the experimental investigation and the analytical modeling. The state of the art covers the performance of existing high temperature composites, sandwich panels and reinforced concrete beams strengthened with Fiber Reinforced Polymers (FRP). The experimental part consists of four major components: (i) Development of a fireproof syntactic foam with maximum specific strength, (ii) Development of a lightweight syntactic foam based on polystyrene spheres, (iii) Development of the composite system for the skins. The variables are the skin thickness, modulus of elasticity of skin and high temperature resistance, and (iv) Experimental evaluation of the flexural behavior of sandwich panels. Analytical modeling consists of a model for the flexural behavior of lightweight sandwich panels, and a model for deflection calculations of reinforced concrete beams strengthened with FRP subjected to fatigue loading. The experimental and analytical results show that sandwich panels made with polysialate matrices and ceramic spheres do not lose their load bearing capability during severe fire exposure, where temperatures reach several
International Nuclear Information System (INIS)
Pan, Yang; Sasaki, Tadahiro; Kubota-Koketsu, Ritsuko; Inoue, Yuji; Yasugi, Mayo; Yamashita, Akifumi; Ramadhany, Ririn; Arai, Yasuha; Du, Anariwa; Boonsathorn, Naphatsawan; Ibrahim, Madiha S.
2014-01-01
Highlights: • Influenza infection can elicit heterosubtypic antibodies to group 1 influenza virus. • Three human monoclonal antibodies were generated from an H1N1-infected patient. • The antibodies predominantly recognized α-helical stem of viral hemagglutinin (HA). • The antibodies inhibited HA structural activation during the fusion process. • The antibodies are potential candidates for future antibody therapy to influenza. - Abstract: Influenza viruses are a continuous threat to human public health because of their ability to evolve rapidly through genetic drift and reassortment. Three human monoclonal antibodies (HuMAbs) were generated in this study, 1H11, 2H5 and 5G2, and they cross-neutralize a diverse range of group 1 influenza A viruses, including seasonal H1N1, 2009 pandemic H1N1 (H1N1pdm) and avian H5N1 and H9N2. The three HuMAbs were prepared by fusing peripheral blood lymphocytes from an H1N1pdm-infected patient with a newly developed fusion partner cell line, SPYMEG. All the HuMAbs had little hemagglutination inhibition activity but had strong membrane-fusion inhibition activity against influenza viruses. A protease digestion assay showed the HuMAbs targeted commonly a short α-helix region in the stalk of the hemagglutinin. Furthermore, Ile45Phe and Glu47Gly double substitutions in the α-helix region made the HA unrecognizable by the HuMAbs. These two amino acid residues are highly conserved in the HAs of H1N1, H5N1 and H9N2 viruses. The HuMAbs reported here may be potential candidates for the development of therapeutic antibodies against group 1 influenza viruses
Energy Technology Data Exchange (ETDEWEB)
Pan, Yang [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Sasaki, Tadahiro [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Kubota-Koketsu, Ritsuko [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Kanonji Institute, The Research Foundation for Microbial Diseases of Osaka University, Kanonji, Kagawa (Japan); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Inoue, Yuji [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Yasugi, Mayo [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Graduate School of Life and Environmental Sciences, Osaka Prefecture University, Izumisano, Osaka (Japan); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Yamashita, Akifumi; Ramadhany, Ririn; Arai, Yasuha [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Du, Anariwa [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Boonsathorn, Naphatsawan [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Department of Medical Sciences, Ministry of Public Health, Muang, Nonthaburi (Thailand); JST/JICA, Science and Technology Research Partnership for Sustainable Development (SATREPS), Tokyo (Japan); Ibrahim, Madiha S. [Research Institute for Microbial Diseases, Osaka University, Suita, Osaka (Japan); Department of Microbiology and Immunology, Faculty of Veterinary Medicine, Damanhour University, Damanhour (Egypt); and others
2014-07-18
Highlights: • Influenza infection can elicit heterosubtypic antibodies to group 1 influenza virus. • Three human monoclonal antibodies were generated from an H1N1-infected patient. • The antibodies predominantly recognized α-helical stem of viral hemagglutinin (HA). • The antibodies inhibited HA structural activation during the fusion process. • The antibodies are potential candidates for future antibody therapy to influenza. - Abstract: Influenza viruses are a continuous threat to human public health because of their ability to evolve rapidly through genetic drift and reassortment. Three human monoclonal antibodies (HuMAbs) were generated in this study, 1H11, 2H5 and 5G2, and they cross-neutralize a diverse range of group 1 influenza A viruses, including seasonal H1N1, 2009 pandemic H1N1 (H1N1pdm) and avian H5N1 and H9N2. The three HuMAbs were prepared by fusing peripheral blood lymphocytes from an H1N1pdm-infected patient with a newly developed fusion partner cell line, SPYMEG. All the HuMAbs had little hemagglutination inhibition activity but had strong membrane-fusion inhibition activity against influenza viruses. A protease digestion assay showed the HuMAbs targeted commonly a short α-helix region in the stalk of the hemagglutinin. Furthermore, Ile45Phe and Glu47Gly double substitutions in the α-helix region made the HA unrecognizable by the HuMAbs. These two amino acid residues are highly conserved in the HAs of H1N1, H5N1 and H9N2 viruses. The HuMAbs reported here may be potential candidates for the development of therapeutic antibodies against group 1 influenza viruses.
Katritzky, Alan R; Jain, Ritu; Xu, Yong-Jiang; Steel, Peter J
2002-11-15
Condensation reactions of benzotriazole and 2-(pyrrol-1-yl)-1-ethylamine (1) with formaldehyde and glutaric dialdehyde, respectively, afforded intermediates 2 and 6. Subsequent nucleophilic substitutions of the benzotriazole group in 2 and 6 with Grignard reagents, sodium cyanide, and sodium borohydride gave 1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazines 3a-e, 4, 5 and 5,6,9,10,11,11a-hexahydro-8H-pyrido[1,2-a]pyrrolo[2,1-c]pyrazines 7a-c, 8, 9, respectively, in good yields.
A General Construction of IND-CCA2 Secure Public Key Encryption
DEFF Research Database (Denmark)
Kiltz, Eike; Malone-Lee, John
2003-01-01
We propose a general construction for public key encryption schemes that are IND-CCA2 secure in the random oracle model. We show that the scheme proposed in [1, 2] fits our general framework and moreover that our method of analysis leads to a more efficient security reduction....
Fixation effects on the release of copper, chromium and arsenic from CCA-C treated marine piles
Stan Lebow
1999-01-01
This study sought to determine the effect of fixation time and temperature on the release of copper, chromium and arsenic from treated marine piles immersed in seawater under "worst case" conditions. Sections of piles were CCA-C treated to a target retention of 2.5 lbs/ft3) (40 kg/m3) and then allowed to Condition at 36°F (2°C) for either 3, 7 or 20 days. As...
Development of [11C]/[3H]THK-5351 – A potential novel carbon-11 tau imaging PET radioligand
International Nuclear Information System (INIS)
Stepanov, Vladimir; Svedberg, Marie; Jia, Zhisheng; Krasikova, Raisa; Lemoine, Laetitia; Okamura, Nobujuki; Furumoto, Shozo; Mitsios, Nicholas; Mulder, Jan; Långström, Bengt; Nordberg, Agneta; Halldin, Christer
2017-01-01
Introduction: Due to the rise in the number of patients with dementia the imperative for finding new diagnostic and treatment options becomes ever more pressing. While significant progress has been made in PET imaging of Aβ aggregates both in vitro and in vivo, options for imaging tau protein aggregates selectively are still limited. Based on the work previously published by researchers from the Tohoku University, Japan, that resulted in the development of [ 18 F]THK-5351, we have undertaken an effort to develop a carbon-11 version of the identical structure - [ 11 C]THK-5351. In parallel, THK-5351 was also labeled with tritium ([ 3 H]THK-5351) for use in in vitro autoradiography (ARG). Methods: The carbon-11 labeling was performed starting with di-protected enantiomeric pure precursor - tert-butyl 5-(6-((2S)-3-fluoro-2-(tetrahydro-2H-pyran-2-yloxy)propoxy)quinolin-2-yl) pyridin-2-yl carbamate, which was reacted with [ 11 C]MeI, using DMF as the solvent and NaH as base, followed by deprotection with trifluoroacetic acid/water mixture, resulting in enantiomerically pure carbon-11 radioligand, [ 11 C]THK-5351 - (S)-1-fluoro-3-(2-(6-([ 11 C]methylamino)pyridin-3-yl)quinolin-6-yloxy) propan-2-ol. Tritium labeling and purification of [ 3 H]THK-5351 were undertaken using similar approach, resulting in [ 3 H]THK-5351 with RCP >99.8% and specific radioactivity of 1.3 GBq/μmol. Results: [ 11 C]THK-5351 was produced in good yield (1900 ± 355 MBq), specific radioactivity (SRA) (361 ± 119 GBq/μmol at EOS + 20 min) and radiochemical purity (RCP) (>99.8%), with enantiomeric purity of 98.7%. [ 3 H]THK-5351 was evaluated for ARG of tau binding in post-mortem human brain tissue using cortical sections from one AD patient and one control subject. [ 3 H]THK-5351 binding density was higher in the AD patient compared to the control subject, the binding was displaced by unlabeled THK-5351 confirming specific [ 3 H]THK-5351 binding.
Analysis of a ceramic filled bio-plastic composite sandwich structure
International Nuclear Information System (INIS)
Habib Ullah, M.; Islam, M. T.
2013-01-01
Design and analysis of a ceramic-filled bio-plastic composite sandwich structure is presented. This proposed high-dielectric structure is used as a substrate for patch antennas. A meandered-strip line-fed fractal-shape patch antenna is designed and fabricated on a copper-laminated sandwich-structured substrate. Measurement results of this antenna show 44% and 20% of bandwidths with maximum gains of 3.45 dBi and 5.87 dBi for the lower and upper bands, respectively. The half-power beam widths of 104° and 78° have been observed from the measured radiation pattern at the two resonance frequencies 0.9 GHz and 2.5 GHz
Analysis of a ceramic filled bio-plastic composite sandwich structure
Energy Technology Data Exchange (ETDEWEB)
Habib Ullah, M. [Institute of Space Science (ANGKASA), Universiti Kebangsaan Malaysia, Bangi Selangor 43600 (Malaysia); Department of Electrical, Electronic and System Engineering, Universiti Kebangsaan Malaysia, Bangi 43600 (Malaysia); Islam, M. T. [Institute of Space Science (ANGKASA), Universiti Kebangsaan Malaysia, Bangi Selangor 43600 (Malaysia)
2013-11-25
Design and analysis of a ceramic-filled bio-plastic composite sandwich structure is presented. This proposed high-dielectric structure is used as a substrate for patch antennas. A meandered-strip line-fed fractal-shape patch antenna is designed and fabricated on a copper-laminated sandwich-structured substrate. Measurement results of this antenna show 44% and 20% of bandwidths with maximum gains of 3.45 dBi and 5.87 dBi for the lower and upper bands, respectively. The half-power beam widths of 104° and 78° have been observed from the measured radiation pattern at the two resonance frequencies 0.9 GHz and 2.5 GHz.
Wang, Xiaohong; Dong, Fugui; Miao, Caihong; Li, Wei; Wang, Min; Gao, Mingzhang; Zheng, Qi-Huang; Xu, Zhidong
2018-06-01
Carbon-11-labeled serotonin (5-hydroxytryptamine) 6 receptor (5-HT 6 R) antagonists, 1-[(2-bromophenyl)sulfonyl]-5-[ 11 C]methoxy-3-[(4-methyl-1-piperazinyl)methyl]-1H-indole (O-[ 11 C]2a) and 1-[(2-bromophenyl)sulfonyl]-5-methoxy-3-[(4-[ 11 C]methyl-1-piperazinyl)methyl]-1H-indole (N-[ 11 C]2a), 5-[ 11 C]methoxy-3-((4-methylpiperazin-1-yl)methyl)-1-(phenylsulfonyl)-1H-indole (O-[ 11 C]2b) and 5-methoxy-3-((4-[ 11 C]methylpiperazin-1-yl)methyl)-1-(phenylsulfonyl)-1H-indole (N-[ 11 C]2b), 1-((4-isopropylphenyl)sulfonyl)-5-[ 11 C]methoxy-3-((4-methylpiperazin-1-yl)methyl)-1H-indole (O-[ 11 C]2c) and 1-((4-isopropylphenyl)sulfonyl)-5-methoxy-3-((4-[ 11 C]methylpiperazin-1-yl)methyl)-1H-indole (N-[ 11 C]2c), 1-((4-fluorophenyl)sulfonyl)-5-[ 11 C]methoxy-3-((4-methylpiperazin-1-yl)methyl)-1H-indole (O-[ 11 C]2d) and 1-((4-fluorophenyl)sulfonyl)-5-methoxy-3-((4-[ 11 C]methylpiperazin-1-yl)methyl)-1H-indole (N-[ 11 C]2d), were prepared from their O- or N-desmethylated precursors with [ 11 C]CH 3 OTf through O- or N-[ 11 C]methylation and isolated by HPLC combined with SPE in 40-50% radiochemical yield, based on [ 11 C]CO 2 and decay corrected to end of bombardment (EOB). The radiochemical purity was >99%, and the molar activity (MA) at EOB was 370-740 GBq/μmol with a total synthesis time of ∼40-min from EOB. Copyright © 2018 Elsevier Ltd. All rights reserved.
Juranić, Martina; Srilunchang, Kanok-orn; Krohn, Nádia Graciele; Leljak-Levanić, Dunja; Sprunck, Stefanie; Dresselhaus, Thomas
2012-01-01
Germline and early embryo development constitute ideal model systems to study the establishment of polarity, cell identity, and asymmetric cell divisions (ACDs) in plants. We describe here the function of the MATH-BTB domain protein MAB1 that is exclusively expressed in the germ lineages and the zygote of maize (Zea mays). mab1 (RNA interference [RNAi]) mutant plants display chromosome segregation defects and short spindles during meiosis that cause insufficient separation and migration of nuclei. After the meiosis-to-mitosis transition, two attached nuclei of similar identity are formed in mab1 (RNAi) mutants leading to an arrest of further germline development. Transient expression studies of MAB1 in tobacco (Nicotiana tabacum) Bright Yellow-2 cells revealed a cell cycle–dependent nuclear localization pattern but no direct colocalization with the spindle apparatus. MAB1 is able to form homodimers and interacts with the E3 ubiquitin ligase component Cullin 3a (CUL3a) in the cytoplasm, likely as a substrate-specific adapter protein. The microtubule-severing subunit p60 of katanin was identified as a candidate substrate for MAB1, suggesting that MAB1 resembles the animal key ACD regulator Maternal Effect Lethal 26 (MEL-26). In summary, our findings provide further evidence for the importance of posttranslational regulation for asymmetric divisions and germline progression in plants and identified an unstable key protein that seems to be involved in regulating the stability of a spindle apparatus regulator(s). PMID:23250449
Hardness in high temperature of steels ABNT H11 and ABNT H11 modified with niobium
International Nuclear Information System (INIS)
Goncalves, R.A.
1984-01-01
A method to measure the hardness of metallic materials was developed. The heating was done by the Joule effect heat dissipation in the sample, that is like an electrical resistor. A diamond penetrator with a revolution paraboloid format was used, that assure a linear relation between the load applyed and the penetration deep. Hardness tests were make in the range of 25 - 600 0 C, in the steels ABNT H11 and ABNT H11 modified with niobium, with the simultaneous register of the applied force, penetration deep and temperature. (E.G.) [pt
Effect of moisture content on strength of CCA-treated lumber
Jerrold E. Winandy
1995-01-01
Recent studies on the effects of chromated copper arsenate (CCA) treatment on lumber design properties have primarily evaluated the effects of such treatment at or near 12% moisture content and at failure times of 1 to 10 min. The influence of various moisture contents and faster loading rates is unknown. This report discusses the influence of moisture content and its...
Directory of Open Access Journals (Sweden)
Parlindungan Manik
2012-04-01
Full Text Available Planning of ship construction is make its having good effectivity value and efficiency. Composite as material alternative to changes of steel feedstock and wood has many applied named FRP (fiberglass reinforced plastics single skin. The weakness of this FRP was heavy construction and requires many production time. Therefore, will be checked comparison between single skin with sandwich constructions for shell. In this research, the way for making composite is hand lay up method with three various thickness of skin there are : t, t/2, and t/4. To know strength comparison from the various skin of sandwich with single skin, must be test, consist of tensile test.. The result is analyzed then compared by BKI (Biro Klasifikasi Indonesia rules for the fiberglass ship. Based on the result, indicates that optimization skin thickness of sandwich construction applies Coremat which tensile strength it is equivalent with Single Skin at 2/3t and usage of Sandwich construction causes 23,12 % lighter. In economic analyze, advantage from low weight is compensation of addition 23,12 % DWT. Material cost for Sandwich about 11,35% bigger than Single Skin construction.
45 CFR 1626.11 - H-2 agricultural workers.
2010-10-01
...) Other employment rights as provided in the worker's specific contract under which the nonimmigrant... 45 Public Welfare 4 2010-10-01 2010-10-01 false H-2 agricultural workers. 1626.11 Section 1626.11... ON LEGAL ASSISTANCE TO ALIENS § 1626.11 H-2 agricultural workers. (a) Nonimmigrant agricultural...
Conservation Compromises: The MAB and the Legacy of the International Biological Program, 1964-1974.
Schleper, Simone
2017-02-01
This article looks at the International Biological Program (IBP) as the predecessor of UNESCO's well-known and highly successful Man and the Biosphere Programme (MAB). It argues that international conservation efforts of the 1970s, such as the MAB, must in fact be understood as a compound of two opposing attempts to reform international conservation in the 1960s. The scientific framework of the MAB has its origins in disputes between high-level conservationists affiliated with the International Union for the Conservation of Nature and Natural Resources (IUCN) about what the IBP meant for the future of conservation. Their respective visions entailed different ecological philosophies as much as diverging sets of political ideologies regarding the global implementation of conservation. Within the IBP's Conservation Section, one group propagated a universal systems approach to conservation with a centralized, technocratic management of nature and society by an elite group of independent scientific experts. Within IUCN, a second group based their notion of environmental expert roles on a more descriptive and local ecology of resource mapping as practiced by UNESCO. When the IBP came to an end in 1974, both groups' ecological philosophies played into the scientific framework underlying the MAB's World Network or Biosphere Reserves. The article argues that it is impossible to understand the course of conservation within the MAB without studying the dynamics and discourses between the two underlying expert groups and their respective visions for reforming conservation.
Sensory Evaluation and Feasibility Report of Plantain Sandwich for Nigerian Market
Olu Malomo; E.O. Uche; E.A. Alamu
2015-01-01
Protein-energy malnutrition is a common nutritional disorder in developing countries and constitutes a major public health problem in young children and elderly people. This project is aimed at evaluating the acceptability of plantain-peanut sandwich and roasted at different temperatures. A plantain-peanut sandwich consists of minced protein stuffed into a carbohydrate source made into a roll as a food product. The plantain was roasted at two different temperatures than later enriched with 5%...
Creep of sandwich beams with metallic foam cores
International Nuclear Information System (INIS)
Kesler, O.; Crews, L.K.; Gibson, L.J.
2003-01-01
The steady state creep deflection rates of sandwich beams with metallic foam cores were measured and compared with analytical and numerical predictions of the creep behavior. The deflection rate depends on the geometry of the sandwich beam, the creep behavior of the foam core and the loading conditions (stress state, temperature). Although there was a considerable scatter in the creep data (both of the foams and of the sandwich beams made using them), the data for the sandwich beams were fairly well described by the analysis
Creep of sandwich beams with metallic foam cores
Energy Technology Data Exchange (ETDEWEB)
Kesler, O.; Crews, L.K.; Gibson, L.J
2003-01-20
The steady state creep deflection rates of sandwich beams with metallic foam cores were measured and compared with analytical and numerical predictions of the creep behavior. The deflection rate depends on the geometry of the sandwich beam, the creep behavior of the foam core and the loading conditions (stress state, temperature). Although there was a considerable scatter in the creep data (both of the foams and of the sandwich beams made using them), the data for the sandwich beams were fairly well described by the analysis.
Lousada, Claudio M; Pinto, Susana S; Lopes, José N Canongia; da Piedade, M Fatima Minas; Diogo, Hermínio P; da Piedade, Manuel E Minas
2008-04-03
The standard molar enthalpies of sublimation of ferrocene, 1,1'-dimethylferrocene, decamethylferrocene, ferrocenecarboxaldehyde and alpha-methylferrocenemethanol, and the enthalpy of vaporization of N,N-dimethyl(aminomethyl)ferrocene, at 298.15 K, were determined by Calvet-drop microcalorimetry and/or the Knudsen effusion method. The obtained values were used to assess and refine our previously developed force field for metallocenes. The modified force field was able to reproduce the deltasubHdegreesm and deltavapHdegreesm values of the test-set with an accuracy better than 5 kJ.mol-1, except for decamethylferrocene, in which case the deviation between the calculated and experimental deltasubHdegreesm values was 16.1 kJ.mol-1. The origin of the larger error found in the prediction of the sublimation energetics of decamethylferrocene, and which was also observed in the estimation of structural properties (e.g., density and unit cell dimensions), is discussed. Finally, the crystal structures of Fe(eta5-C5H4CH3)2 and Fe[(eta5-(C5H5)(eta5-C5H4CHO)] at 293 and 150 K, respectively, are reported.
Fatigue Debond Growth in Sandwich Structures Loaded in Mixed Mode Bending (MMB)
DEFF Research Database (Denmark)
Quispitupa, Amilcar; Berggreen, Christian; Carlsson, Leif A.
2008-01-01
Static and cyclic debond growth in sandwich specimens loaded in mixed mode bending (MMB) is examined. The MMB sandwich specimens were manufactured using H100 PVC foam core and E-glass/polyester non-crimp quadro-axial [0/45/90/-45]s DBLT-850 face sheets. Static test were performed to determine...... the fracture toughness of the debonded sandwich specimens at different mixed mode loadings. The mixed mode ratio (mode I to mode II) was controlled by changing the lever arm distance of the MMB test rig. Compliance technique and visual inspection was employed to measure the crack length during fatigue. Fatigue...... tests were performed at 90% of the static fracture toughness at a loading ratio of R=0.1. Fatigue results revealed higher debond crack growth rates when the lever arm distance was increased. For some specimens, the crack propagated just below the face/core interface in the foam core and for others...
International Nuclear Information System (INIS)
Ley, V.; Corbi, A.L.; Sanchez-Madrid, F.; Carreira, J.C.
1985-01-01
A 4-step radioimmunoassay has been devised for direct identification of monoclonal antibodies (MAb) directed to IgE-binding molecules. Polyvinyl chloride wells coated with purified anti-mouse kappa chain MAb (187-1) were successively incubated with: (1) MAb-containing hybridoma supernatants, (2) allergen extract, (3) allergic patients' serum pool, and (4) 125 I-labeled anti-human IgE antiserum, to detect MAb-allergen-IgE complexes. MAb to allergens from Parietaria judaica pollen and Dermatophagoides mites have been selected with this screening procedure. The affinity-purified allergen molecules competed the binding of IgE to allergen extracts coated to paper discs in a RAST inhibition assay, confirming the anti-allergen specificity of the selected MAb. This screening method is sensitive enough to allow detection of MAb directed to poorly represented allergens. (Auth.)
Graphic-Card Cluster for Astrophysics (GraCCA) -- Performance Tests
Schive, Hsi-Yu; Chien, Chia-Hung; Wong, Shing-Kwong; Tsai, Yu-Chih; Chiueh, Tzihong
2007-01-01
In this paper, we describe the architecture and performance of the GraCCA system, a Graphic-Card Cluster for Astrophysics simulations. It consists of 16 nodes, with each node equipped with 2 modern graphic cards, the NVIDIA GeForce 8800 GTX. This computing cluster provides a theoretical performance of 16.2 TFLOPS. To demonstrate its performance in astrophysics computation, we have implemented a parallel direct N-body simulation program with shared time-step algorithm in this system. Our syste...
Energy Technology Data Exchange (ETDEWEB)
Barraj, Leila M. [Chemical Regulation and Food Safety, Exponent, Inc., Suite 1100, 1150 Connecticut Ave., NW, Washington, DC 20036 (United States)], E-mail: lbarraj@exponent.com; Scrafford, Carolyn G. [Chemical Regulation and Food Safety, Exponent, Inc., Suite 1100, 1150 Connecticut Ave., NW, Washington, DC 20036 (United States); Eaton, W. Cary [RTI International, 3040 Cornwallis Road, Research Triangle Park, NC 27709 (United States); Rogers, Robert E.; Jeng, Chwen-Jyh [Toxcon Health Sciences Research Centre Inc., 9607 - 41 Avenue, Edmonton, Alberta, T6E 5X7 (Canada)
2009-04-01
Lumber treated with chromated copper arsenate (CCA) has been used in residential outdoor wood structures and playgrounds. The U.S. EPA has conducted a probabilistic assessment of children's exposure to arsenic from CCA-treated structures using the Stochastic Human Exposure and Dose Simulation model for the wood preservative scenario (SHEDS-Wood). The EPA assessment relied on data from an experimental study using adult volunteers and designed to measure arsenic in maximum hand and wipe loadings. Analyses using arsenic handloading data from a study of children playing on CCA-treated play structures in Edmonton, Canada, indicate that the maximum handloading values significantly overestimate the exposure that occurs during actual play. The objective of our paper is to assess whether the dislodgeable arsenic residues from structures in the Edmonton study are comparable to those observed in other studies and whether they support the conclusion that the values derived by EPA using modeled maximum loading values overestimate hand exposures. We compared dislodgeable arsenic residue data from structures in the playgrounds in the Edmonton study to levels observed in studies used in EPA's assessment. Our analysis showed that the dislodgeable arsenic levels in the Edmonton playground structures are similar to those in the studies used by EPA. Hence, the exposure estimates derived using the handloading data from children playing on CCA-treated structures are more representative of children's actual exposures than the overestimates derived by EPA using modeled maximum values. Handloading data from children playing on CCA-treated structures should be used to reduce the uncertainty of modeled estimates derived using the SHEDS-Wood model.
Advanced Mechanical Testing of Sandwich Materials
DEFF Research Database (Denmark)
Hayman, Brian; Berggreen, Christian; Jenstrup, Claus
2008-01-01
An advanced digital optical system has been used to measure surface strains on sandwich face and core specimens tested in a project concerned with improved criteria for designing sandwich X-joints. The face sheet specimens were of glass reinforced polyester and were tested in tension. The core sp...
Experimental and theoretical studies of the C{sub 6}H{sub 5} + C{sub 6}H{sub 6} reaction
Energy Technology Data Exchange (ETDEWEB)
Park, J.; Burova, S.; Rodgers, A.S.; Lin, M.C.
1999-11-11
The absolute rate constants for the C{sub 6}H{sub 5} + C{sub 6}H{sub 6} and C{sub 6}D{sub 6} reactions have been measured by cavity ringdown spectrometry at temperatures between 298 and 495 K at a constant 40 Torr Ar pressure. The new results, which reveal no detectable kinetic isotopic effect, can be represented by the Arrhenius equation, {kappa}{sub 1} = 10{sup (11.91{+-}0.13)} exp[{minus}(2,102 {+-} 106)/T] cm{sup 3}/(mol s). Low-temperature data for the addition/stabilization process, C{sub 6}H{sub 5} + C{sub 6}H{sub 6} {r{underscore}arrow} C{sub 12}H{sub 11}, can be correlated with those obtained in a low-pressure, high-temperature Knudsen cell study for the addition/displacement reaction, C{sub 6}H{sub 5} + C{sub 6}H{sub 6} {r{underscore}arrow} C{sub 12}H{sub 10} + H, by the RRKM theory using the molecular and transition-state parameters computed at the B3LYP/6-311G(d,p) level of theory. Combination of these two sets of data gives {kappa}{sub 1} = 10{sup (11.98{+-}0.03)} exp[{minus}(2168 {+-} 34)/T] cm{sup 3}/(mol s) covering the temperature range 298--1,330 K. The RRKM theory also correlates satisfactorily the forward reaction data with the high-temperature shock-tube result for the reverse H-for-C{sub 6}H{sub 5} substitution process with 2.7 and 4.7 kcal/mol barriers for the entrance (C{sub 6}H{sub 5} + C{sub 6}H{sub 6}) and reverse (H + C{sub 12}H{sub 10}) reactions, respectively. For modeling applications, the authors have calculated the forward reaction rate constants for the formation of the two competing products, H + C{sub 12}H{sub 10} and C{sub 12}H{sub 11}, at several pressures covering 300 K {lt} T {lt} 2,500 K.
Itai, Shunsuke; Yamada, Shinji; Kaneko, Mika K; Harada, Hiroyuki; Kato, Yukinari
2017-10-01
Podocalyxin is a CD34-related type I transmembrane protein that is highly glycosylated with N-glycan, O-glycan, and keratan sulfate. Podocalyxin was originally found in the podocytes of rat kidney and is reportedly expressed in many types of tumors, including brain tumors, colorectal cancers, and breast cancers. Overexpression of podocalyxin is an independent predictor of progression, metastasis, and poor outcome. We recently immunized mice with recombinant human podocalyxin, which was produced using LN229 glioblastoma cells, and produced a novel antipodocalyxin monoclonal antibody (mAb), PcMab-47, which reacts with endogenous podocalyxin-expressing cancer cell lines and normal cell lines independent of glycosylation in Western blot, flow cytometry, and immunohistochemical analyses. In this study, we performed immunohistochemical analysis against oral cancers using PcMab-47. PcMab-47-stained oral squamous cell carcinoma cells in a cytoplasmic pattern and detected 26/38 (68.4%) of oral squamous cell carcinoma cells on tissue microarrays. These results indicate that PcMab-47 is useful in detecting podocalyxin of oral cancers for immunohistochemical analysis.
Ayele B.; Erko B.; Legesse M.; Hailu A.; Medhin G.
2008-01-01
A total of 206 urine samples collected from Hassoba Elementary schoolchildren, Afar, Ethiopia, a low Schistosoma haematobium endemic setting, was diagnosed to evaluate the performance of CCA strip using double references, urine filtration technique and urinalysis dipstick (Combur 10 Test®) that detect schistosome eggs and blood in urine, respectively. The former was used as a gold standard reference method. Sensitivity, specificity, positive and negative predictive values for the CCA were 52%...
A J Integral Approach for Measuring Cohesive Laws Using a Modified DCB Sandwich Specimen
DEFF Research Database (Denmark)
Lundsgaard-Larsen, Christian; Berggreen, Christian; Sørensen, Bent F.
2007-01-01
mode mixities. The sandwich specimen consists of glass fiber faces and Divinycell H200 foam core. Arbitrary stiffening of the sandwich specimen with steel bars adhered to the faces reduces rotations and ensures that the method is useable for a wide range of materials. The J integral is employed...... and the opening of the pre-crack tip is recorded by a commercial digital photogrammetry measurement system. Cohesive laws are extracted by differentiating J with respect to the normal and tangential opening of the pre-crack tip. Some results are presented and discussed....
Directory of Open Access Journals (Sweden)
Libertad Alzamora-Gonzales
2016-05-01
Full Text Available Fasciolosis is a cosmopolitan parasitosis medical-veterinary importance caused by Fasciola hepatica, which affects sheep, goats and cattle; and it affects man accidentally causing an epidemic-endemic infection difficult to diagnose. The aim was to develop an indirect sandwich ELISA with 3 antibodies for detecting excretory-secretory antigens of Fasciola hepatica (ESFh. For the development of indirect sandwich ELISA were used, as capture antibody, mouse polyclonal antibodies anti ESFh and polyclonal antibodies rabbit anti-ESFh as detection antibody, at the concentrations of 10 and 5 µg/mL respectively. The conjugate used was mouse monoclonal anti- total immunoglobulins rabbit linked to peroxidase (1/1000. Were analized 31 sheep fecal samples, and the results were compared with those obtained by direct coproparasitological examination (DC and counterimmunoelectrophoresis (CIEP. The detection limit obtained for indirect sandwich ELISA was 100 ng/mL. The test had a 100% sensitivity, 96.6% specificity, positive and negative predictive values of 50% and 96.6% respectively, in relation to DC test. Comparing with CIEP the specificity obtained for indirect sandwich ELISA was 93.5% and a negative predictive value of 100%. We concluded that indirect sandwich ELISA designed is able to detect metabolic antigens in ovine feces samples and can be used for Fasciola hepatica diagnosis.
International Nuclear Information System (INIS)
Getman, T.D.; Krause, J.A.; Shore, S.G.
1988-01-01
The preparation of nido-undecaborane, B 11 H 15 , from the protonation of K[B 11 H 14 ] and the subsequent deprotonation of B 11 H 15 by P(CH 3 ) 3 to give [P(CH 3 ) 3 H][B 11 H 14 ] is described. The structure of [P(CH 3 ) 3 H][B 11 H 14 ] has been determined from single-crystal x-ray data. The spectral data indicate that the boron framework of B 11 H 15 is similar to that of [B 11 H 14 ] - . 11 references, 1 figure
Low Velocity Impact Properties of Aluminum Foam Sandwich Structural Composite
Directory of Open Access Journals (Sweden)
ZHAO Jin-hua
2018-01-01
Full Text Available Sandwich structural composites were prepared by aluminum foam as core materials with basalt fiber(BF and ultra-high molecular weight polyethylene(UHMWPE fiber composite as faceplate. The effect of factors of different fiber type faceplates, fabric layer design and the thickness of the corematerials on the impact properties and damage mode of aluminum foam sandwich structure was studied. The impact properties were also analyzed to compare with aluminum honeycomb sandwich structure. The results show that BF/aluminum foam sandwich structural composites has bigger impact damage load than UHMWPE/aluminum foam sandwich structure, but less impact displacement and energy absorption. The inter-layer hybrid fabric design of BF and UHMWPE has higher impact load and energy absorption than the overlay hybrid fabric design faceplate sandwich structure. With the increase of the thickness of aluminum foam,the impact load of the sandwich structure decreases, but the energy absorption increases. Aluminum foam sandwich structure has higher impact load than the aluminum honeycomb sandwich structure, but smaller damage energy absorption; the damage mode of aluminum foam core material is mainly the fracture at the impact area, while aluminum honeycomb core has obvious overall compression failure.
Directory of Open Access Journals (Sweden)
Hoong-Kun Fun
2009-01-01
Full Text Available The asymmetric unit of the title compound, C27H24N4O2·0.5C2H6O, comprises two crystallographically independent molecules (A and B with slightly different conformations, and one ethanol molecule of crystallization. Intramolecular C—H...O and O—H...O hydrogen bonds generate six- and eight-membered rings, producing S(6 and S(8 ring motifs, respectively. In molecule A, one of the benzene rings is disordered over two positions, with site-occupancy factors of 0.542 (11 and 0.458 (11. The dihedral angles between the central benzene ring and the two outer benzene rings are 73.88 (9 and 82.6 (2/88.9 (2° in molecule A, and 80.81 (8 and 79.38 (8° in molecule B. In the crystal structure, molecules form infinite one-dimensional chains in the (101 plane. The crystal structure is stabilized by intermolecular O—H...N, N—H...N, N—H...O and C—H...O hydrogen bonds, weak C—H...π and π–π [centroid–centroid = 3.5496 (1 Å] interactions.
International Nuclear Information System (INIS)
Bretagnon, T.; Bastide, G.; Rouzeyre, M.
1990-01-01
Capacitance spectroscopy has been used to study the two dominant deep levels, H 4 and E 11 , produced in InP by low-energy electron irradiation. The annealing rates of H 4 and E 11 in the p-type material are found to be identical, as is also the dependence on free-carrier recombination and on the chemical nature of the acceptor (Cd or Zn). Recombination-enhanced annealing converts these traps to a hole trap H 4 ' , which is not detectable by conventional deep-level transient spectroscopy. Its emission and capture properties are measured and analyzed. The similarity of the creation and annealing behavior of H 4 and E 11 shows that they share a common point defect. Our results lead to the tentative identification of the defect as a phosphorous vacancy-acceptor complex and we show how this may anneal to the H 4 ' center
Subcellullar localization of tumor-associated antigen 3H11Ag
International Nuclear Information System (INIS)
Guo Jianhui; Jin Genglin; Meng Lin; Ma Hong; Nie Dezhi; Wu Jian; Yuan Lan; Shou Chengchao
2004-01-01
3H11Ag, a tumor-associated antigen defined by the monoclonal antibody 3H11 that specifically recognizes cancer cells in various tumor tissues, was successfully cloned recently, but its function is unknown. To explore the potential roles it plays in tumors, we analyzed its subcellular localization in the present study. By expressing 3H11Ag fused with fluorescent protein in COS-7 cells, we found that 3H11Ag localizes to both cytoplasm and nucleus, which was confirmed by subcellular fractionation. And sequentially extracting the nuclei of COS-7 cells transfected with 3H11Ag showed that it is a DNA- and nuclear matrix-associated protein. Moreover, by expressing a series of red fluorescent protein-tagged truncated forms of 3H11Ag, it was demonstrated that the 150 amino acid residues at its C-terminal are fully responsible for the subcellular localization. In addition, the results of the computational analysis of 3H11Ag were in accordance with those of the experimental analysis. All these data would be helpful to elucidate the functions of 3H11Ag
Structural and failure mechanics of sandwich composites
Carlsson, LA; Carlsson, Leif A
2011-01-01
Focusing on important deformation and failure modes of sandwich structures, this volume describes the mechanics behind fracture processes. The text also reviews test methods developed for the cr, structural integrity, and failure mechanisms of sandwich structures.
Thermal conductivity of newspaper sandwiched aerated lightweight concrete panel
Energy Technology Data Exchange (ETDEWEB)
Ng, Soon-Ching; Low, Kaw-Sai [Faculty of Engineering and Science, Universiti Tunku Abdul Rahman, Jalan Genting Kelang, Setapak, 53300 Kuala Lumpur, Wilayah Persekutuan (Malaysia)
2010-12-15
Investigation on the thermal conductivity of newspaper sandwiched aerated lightweight concrete (ALC) panels is the main purpose of this study. Various densities of ALC panels ranging from 1700, 1400 and 1100 kg/m{sup 3} with three different aerial intensities of newspaper sandwiched were produced. Investigation was limited to the effect of aerial intensity of newspaper sandwiched and the effect of density of ALC on thermal conductivity. It is found that the thermal conductivity of newspaper sandwiched ALC panels reduced remarkably compared to control ALC panels. The reduction was recorded at 18.0%, 21.8% and 20.7% correspond to densities of 1700, 1400 and 1100 kg/m{sup 3} with just a mere 0.05 g/cm{sup 2} aerial intensity of newspaper sandwiched. Newspaper sandwiched has a significant impact on the performance of thermal conductivity of ALC panels based on regression analysis. (author)
Predicting safe sandwich production
DEFF Research Database (Denmark)
Birk, Tina; Duan, Zhi; Møller, Cleide Oliveira de Almeida
2014-01-01
Time and temperature control is crucial to avoid growth of pathogens during production and serving of cold ready-to-eat meals. The Danish guidelines state that chilled foods, such as sandwiches, should not be outside the cold chain for more than 3 hours including the time for preparation...... and serving. However, Danish sandwich producing companies find it challenging to comply with this and have expressed a need for more flexibility. The Danish guidelines do allow for a prolongation of the acceptable time outside the cold chain, if the safety of the specific production can be documented...
Sumoylation of the Plant Clock Transcription Factor CCA1 Suppresses DNA Binding
Hansen, L.L.; Imrie, L.; Le Bihan, T.; van den Burg, H.A.; van Ooijen, G.
2017-01-01
In plants, the circadian clock regulates the expression of one-third of all transcripts and is crucial to virtually every aspect of metabolism and growth. We now establish sumoylation, a posttranslational protein modification, as a novel regulator of the key clock protein CCA1 in the model plant
Müller, Christa E; Diekmann, Martina; Thorand, Mark; Ozola, Vita
2002-02-11
This study describes the preparation and binding properties of [(3)H]PSB-11, a novel, potent, and selective antagonist radioligand for human A(3) adenosine receptors (ARs). [(3)H]PSB-11 binding to membranes of Chinese hamster ovary (CHO) cells expressing the human A(3) AR was saturable and reversible. Saturation experiments showed that [(3)H]PSB-11 labeled a single class of binding sites with high affinity (K(D)=4.9 nM) and limited capacity (B(max)=3500 fmol/mg of protein). PSB-11 is highly selective versus the other adenosine receptor subtypes. The new radioligand shows an extraordinarily low degree of non-specific binding rendering it a very useful tool for studying the (patho)physiological roles of A(3 )ARs.
Density functional study of isoguanine tetrad and pentad sandwich complexes with alkali metal ions.
Meyer, Michael; Steinke, Thomas; Sühnel, Jürgen
2007-02-01
Isoguanine tetraplexes and pentaplexes contain two or more stacked polyads with intercalating metal ions. We report here the results of a density functional study of sandwiched isoguanine tetrad and pentad complexes consisting of two polyads with Na(+), K(+) and Rb(+) ions at the B3LYP level. In comparison to single polyad metal ion complexes, there is a trend towards increased non-planarity of the polyads in the sandwich complexes. In general, the pentad sandwiches have relatively planar polyad structures, whereas the tetrad complexes contain highly non-planar polyad building blocks. As in other sandwich complexes and in metal ion complexes with single polyads, the metal ion-base interaction energy plays an essential role. In iG sandwich structures, this interaction energy is slightly larger than in the corresponding guanine sandwich complexes. Because the base-base interaction energy is even more increased in passing from guanine to isoguanine, the isoguanine sandwiches are thus far the only examples where the base-base interaction energy is larger than the base-metal ion interaction energy. Stacking interactions have been studied in smaller models consisting of two bases, retaining the geometry from the complete complex structures. From the data obtained at the B3LYP and BH&H levels and with Møller-Plesset perturbation theory, one can conclude that the B3LYP method overestimates the repulsion in stacked base dimers. For the complexes studied in this work, this is only of minor importance because the direct inter-tetrad or inter-pentad interaction is supplemented by a strong metal ion-base interaction. Using a microsolvation model, the metal ion preference K(+) approximately Rb(+) > Na(+) is found for tetrad complexes. On the other hand, for pentads the ordering is Rb(+) > K(+) > Na(+). In the latter case experimental data are available that agree with this prediction.
Large magnetic entropy change in melt-spun LaFe11.5Si1.5 ribbons
International Nuclear Information System (INIS)
Xie Kun; Song Xiaoping; Zhu Yaoming; Lv Weipeng; Sun Zhanbo
2004-01-01
The microstructure transformation and the magnetic entropy change of LaFe 11.5 Si 1.5 melt-spun ribbons were investigated. The melt-spun ribbons show a homogeneous distribution of elements, and the homogeneity develops further after 5 h annealing. XRD results show that the ribbons are composed of NaZn 13 -type LaFe 11.5 Si 1.5 compounds and an α-Fe phase. After annealing, the ribbons crystallize well in the NaZn 13 -type structure and exhibit a very large magnetic entropy change. A first-order magnetic transition is observed in the annealed ribbons, and this is believed to be the origin of the large magnetic entropy. These results suggest that NaZn 13 -type LaFe 11.5 Si 1.5 compounds with a large magnetic entropy change can be produced by melt-spinning, the annealing time can be shortened significantly and the production cost of the magnetic refrigerant will be cut down accordingly
The UNC-4 homeobox protein represses mab-9 expression in DA motor neurons in Caenorhabditis elegans
DEFF Research Database (Denmark)
Jafari, Gholamali; Appleford, Peter J; Seago, Julian
2011-01-01
, an RNAi screen designed to identify upstream transcriptional regulators of mab-9 showed that silencing of unc-4 (encoding a paired-class homeodomain protein) increases mab-9::gfp expression in the nervous system, specifically in posterior DA motor neurons. Over-expression of unc-4 from a heat...
Development of Aircraft Sandwich Parts
Directory of Open Access Journals (Sweden)
J. Křena
2000-01-01
Full Text Available The presented paper shows the design and development process of sandwich parts. A spoiler plate and a main landing gear door are developed. Sandwich parts are made of C/E composite facings and a foam core. FE models have been used for optimization of structures. Emphasis has been placed on deformations of parts under a few load cases. Experimental tests have been used for a verification of structure parts loaded by concentrated forces.
IL-2/anti-IL-2 mAb immunocomplexes: A renascence of IL-2 in cancer immunotherapy?
Czech Academy of Sciences Publication Activity Database
Tomala, Jakub; Kovář, Marek
2016-01-01
Roč. 5, č. 3 (2016), e1102829 ISSN 2162-402X R&D Projects: GA ČR GA13-12885S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Anti-IL-2 mAb * cancer immunotherapy * IL-2 Subject RIV: EE - Microbiology, Virology Impact factor: 7.719, year: 2016
ITO-TiN-ITO Sandwiches for Near-Infrared Plasmonic Materials.
Chen, Chaonan; Wang, Zhewei; Wu, Ke; Chong, Haining; Xu, Zemin; Ye, Hui
2018-05-02
Indium tin oxide (ITO)-based sandwich structures with the insertion of ultrathin (ITO layers show TiN-thickness-dependent properties, which lead to moderate and tunable effective permittivities for the sandwiches. The surface plasmon polaritons (SPP) of the ITO-TiN-ITO sandwich at the telecommunication window (1480-1570 nm) are activated by prism coupling using Kretschmann configuration. Compared with pure ITO films or sandwiches with metal insertion, the reflectivity dip for sandwiches with TiN is relatively deeper and wider, indicating the enhanced coupling ability in plasmonic materials for telecommunications. The SPP spatial profile, penetration depth, and degree of confinement, as well as the quality factors, demonstrate the applicability of such sandwiches for NIR plasmonic materials in various devices.
Syntheses of [5-2H]-uracil, [5-2H]-cytosine, [6-2H]-uracil and [6-2H]-cytosine
International Nuclear Information System (INIS)
Kiritani, Reiko; Asano, Takeyoshi; Fujita, Shin-ichi; Dohmaru, Takaaki; Kawanishi, Tetsuro
1986-01-01
Syntheses of [5- 2 H]-, [6- 2 H]-uracil and [5- 2 H]-, [6- 2 H]-cytosine were investigated. The catalytic reaction of uracil or cytosine with 2 H 2 gas in alkaline media gave rise to [6- 2 H]-compounds almost exclusively. On the other hand, the reaction of 5-bromouracil or 5-bromocytosine with 2 H 2 gas gave rise to a mixture of [5- 2 H]-, [6- 2 H]- and [5- 2 H, 6- 2 H]-compounds depending on the experimental conditions. By controlling the temperature, the pressure of 2 H 2 gas and the amount of catalyst, [5- 2 H]-uracil and [5- 2 H]-cytosine were obtained. The isotopic distribution in each product was measured by 1 H NMR spectroscopy combined with an HPLC method. (author)
Hogiri, Tomoharu; Tamashima, Hiroshi; Nishizawa, Akitoshi; Okamoto, Masahiro
2018-02-01
To optimize monoclonal antibody (mAb) production in Chinese hamster ovary cell cultures, culture pH should be temporally controlled with high resolution. In this study, we propose a new pH-dependent dynamic model represented by simultaneous differential equations including a minimum of six system component, depending on pH value. All kinetic parameters in the dynamic model were estimated using an evolutionary numerical optimization (real-coded genetic algorithm) method based on experimental time-course data obtained at different pH values ranging from 6.6 to 7.2. We determined an optimal pH-shift schedule theoretically. We validated this optimal pH-shift schedule experimentally and mAb production increased by approximately 40% with this schedule. Throughout this study, it was suggested that the culture pH-shift optimization strategy using a pH-dependent dynamic model is suitable to optimize any pH-shift schedule for CHO cell lines used in mAb production projects. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Policy. 11.5 Section 11.5 Energy NUCLEAR REGULATORY COMMISSION CRITERIA AND PROCEDURES FOR DETERMINING ELIGIBILITY FOR ACCESS TO OR CONTROL OVER SPECIAL NUCLEAR MATERIAL General Provisions § 11.5 Policy. It is the policy of the Nuclear Regulatory Commission to carry...
Experimental formability analysis of bondal sandwich sheet
Kami, Abdolvahed; Banabic, Dorel
2018-05-01
Metal/polymer/metal sandwich sheets have recently attracted the interests of industries like automotive industry. These sandwich sheets have superior properties over single-layer metallic sheets including good sound and vibration damping and light weight. However, the formability of these sandwich sheets should be enhanced which requires more research. In this paper, the formability of Bondal sheet (DC06/viscoelastic polymer/DC06 sandwich sheet) was studied through different types of experiments. The mechanical properties of Bondal were determined by uniaxial tensile tests. Hemispherical punch stretching and hydraulic bulge tests were carried out to determine the forming limit diagram (FLD) of Bondal. Furthermore, cylindrical and square cup drawing tests were performed in dry and oil lubricated conditions. These tests were conducted at different blank holding forces (BHFs). An interesting observation about Bondal sheet deep drawing was obtaining of higher drawing depths at dry condition in comparison with oil-lubricated condition.
Vibro-acoustics of lightweight sandwich structures
Lu, Tianjian
2014-01-01
Vibro-Acoustics of Lightweight Sandwich Structures introduces the study of the coupled vibration and acoustic behavior of lightweight sandwich structures in response to harmonic force and sound pressure. This book focuses on the theoretical modeling and experimental investigation of lightweight sandwich structures in order to provide a predictive framework for vibro-acoustic characteristics of typical engineering structures. Furthermore, by developing solution tools, it concentrates on the influence of key systematic parameters leading to effective guidance for optimal structure design toward lightweight, high-stiffness and superior sound insulation capability. This book is intended for researchers, scientists, engineers and graduate students in mechanical engineering especially in structural mechanics, mechanics and acoustics. Fengxian Xin and Tianjian Lu both work at the School of Aerospace, Xi’an Jiaotong University.
International Nuclear Information System (INIS)
Xiao, D B; Li, Q S; Hou, Z Q; Wang, X H; Chen, Z H; Xia, D W; Wu, X Z
2016-01-01
This paper presents a novel differential capacitive silicon micro-accelerometer with symmetrical double-sided serpentine beam-mass sensing structure and glass–silicon–glass sandwich structure. The symmetrical double-sided serpentine beam-mass sensing structure is fabricated with a novel pre-buried mask fabrication technology, which is convenient for manufacturing multi-layer sensors. The glass–silicon–glass sandwich structure is realized by a double anodic bonding process. To solve the problem of the difficulty of leading out signals from the top and bottom layer simultaneously in the sandwich sensors, a silicon pillar structure is designed that is inherently simple and low-cost. The prototype is fabricated and tested. It has low noise performance (the peak to peak value is 40 μg) and μg-level Allan deviation of bias (2.2 μg in 1 h), experimentally demonstrating the effectiveness of the design and the novel fabrication technology. (paper)
Puttharugsa, Chokchai; Wangkam, Thidarat; Huangkamhang, Nongluck; Gajanandana, Oraprapai; Himananto, Orawan; Sutapun, Boonsong; Amarit, Ratthasart; Somboonkaew, Armote; Srikhirin, Toemsak
2011-01-15
An immunosensor based on surface plasmon resonance imaging (SPR imaging) using a specific monoclonal antibody 11E5 (MAb 11E5) was developed for the detection of the seed-borne bacterium Acidovorax avenae subsp. citrulli (Aac), which causes fruit blotch in watermelons and cantaloupes, and compared to the conventional ELISA technique. The 1:40 mixed self-assembled monolayer (mixed SAM) surface was used for the immobilized MAb 11E5 on sensor surface for the detection of Aac. Both whole cells and broken cells of Aac were tested by using direct and sandwich detection assay. The limit of detection (LOD) of Aac using the SPR imaging technique and a direct detection assay was 10(6)cfu/ml and a subsequent amplification of the SPR signal using a polyclonal antibody (PAb) lowered the LOD to 5×10(5) cfu/ml. The LOD for the ELISA technique was 5×10(4) cfu/ml for the detection of Aac, which was slightly better than that for the SPR technique. However, the sensor surface based on SPR imaging offered a major advantage in terms of surface regeneration, allowing at least five cycles with a shorter time assay, multi-channel analysis with an application on multiplex detection, and an ease of the surface usage for the detection of Aac in the naturally infected plant. The surface was tested against the naturally infected sample and showed good selectivity toward the Aac bacteria. Copyright © 2010 Elsevier B.V. All rights reserved.
Non-linear Behavior of Curved Sandwich Panels
DEFF Research Database (Denmark)
Berggreen, Carl Christian; Jolma, P.; Karjalainen, J. P.
2003-01-01
In this paper the non-linear behavior of curved sandwich panels is investigated both numerically and experimentally. Focus is on various aspects of finite element modeling and calculation procedures. A simply supported, singly curved, CFRP/PVC sandwich panel is analyzed under uniform pressure loa...
Liu, Hanwen; Zou, Yuqin; Tao, Li; Ma, Zhaoling; Liu, Dongdong; Zhou, Peng; Liu, Hongbo; Wang, Shuangyin
2017-09-01
A facile vacuum filtration method is applied for the first time to construct sandwich-structure anode. Two layers of graphene stacks sandwich a composite of black phosphorus (BP), which not only protect BP from quickly degenerating but also serve as current collector instead of copper foil. The BP composite, reduced graphene oxide coated on BP via chemical bonding, is simply synthesized by solvothermal reaction at 140 °C. The sandwiched film anode used for lithium-ion battery exhibits reversible capacities of 1401 mAh g -1 during the 200th cycle at current density of 100 mA g -1 indicating superior cycle performance. Besides, this facile vacuum filtration method may also be available for other anode material with well dispersion in N-methyl pyrrolidone (NMP). © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
New Approach to Remove Metals from Chromated Copper Arsenate (CCA)-Treated Wood
Todd F. Shupe; Chung Y. Hse; Hui Pan
2012-01-01
Recovery of metals from chromated copper arsenate (CCA)-treated southern pine wood particles was investigated using binary acid solutions consisting of acetic, oxalic, and phosphoric acids in a microwave reactor. Formation of an insoluble copper oxalate complex in the binary solution containing oxalic acid was the major factor for low copper removal. Furthermore, the...
(S-1-[3,5-Bis(trifluoromethylphenyl]-N-methylethylamine–(R-2-hydroxybutanedioic acid (1/1
Directory of Open Access Journals (Sweden)
Hai-Bin Zhu
2009-01-01
Full Text Available In the title compound, C11H11F6N·C4H6O5, a key intermediate in the synthesis of the NK1 receptor antagonist of casopitant, the F atoms of the trifluoromethyl groups are disordered over two sites with equal occupancies. In the crystal, the components are linked by bifurcated N—H...(O,O hydrogen bonds.
Nonglobal proof of the thin--sandwich conjecture
International Nuclear Information System (INIS)
Pereira, C.M.
1981-01-01
A gravitational thin--sandwich conjecture was first proposed by Wheeler and coworkers during the period 1962--4. The present paper contains a proof of the nonglobal form of this gravitational thin--sandwich conjecture. The proof (a) applies for arbitrary choices of the spatial metric and its time derivative; and (b) demonstrates the existence on a spacelike three-surface of solutions which satisfy conditions of continuity known to be sufficient to obtain existence and uniqueness of solutions to Einstein's equations off the three-surface and existence and uniqueness of geodesics. Riquier's existence theorem plays an important role in the proof. The relationship of the present results to previous work is discussed. Some global questions associated with the thin--sandwich conjecture are clarified. Some aspects of the relationship of the thin--sandwich conjecture to the problem of the quantization of the gravitational field are noted. Both the vacuum case and the case of a nonviscous fluid are included. The discussion allows for an arbitrary equation of state p = p
Rainfall prediction of Cimanuk watershed regions with canonical correlation analysis (CCA)
Rustiana, Shailla; Nurani Ruchjana, Budi; Setiawan Abdullah, Atje; Hermawan, Eddy; Berliana Sipayung, Sinta; Gede Nyoman Mindra Jaya, I.; Krismianto
2017-10-01
Rainfall prediction in Indonesia is very influential on various development sectors, such as agriculture, fisheries, water resources, industry, and other sectors. The inaccurate predictions can lead to negative effects. Cimanuk watershed is one of the main pillar of water resources in West Java. This watersheds divided into three parts, which is a headwater of Cimanuk sub-watershed, Middle of Cimanuk sub-watershed and downstream of Cimanuk sub- watershed. The flow of this watershed will flow through the Jatigede reservoir and will supply water to the north-coast area in the next few years. So, the reliable model of rainfall prediction is very needed in this watershed. Rainfall prediction conducted with Canonical Correlation Analysis (CCA) method using Climate Predictability Tool (CPT) software. The prediction is every 3months on 2016 (after January) based on Climate Hazards group Infrared Precipitation with Stations (CHIRPS) data over West Java. Predictors used in CPT were the monthly data index of Nino3.4, Dipole Mode (DMI), and Monsoon Index (AUSMI-ISMI-WNPMI-WYMI) with initial condition January. The initial condition is chosen by the last data update. While, the predictant were monthly rainfall data CHIRPS region of West Java. The results of prediction rainfall showed by skill map from Pearson Correlation. High correlation of skill map are on MAM (Mar-Apr-May), AMJ (Apr-May-Jun), and JJA (Jun-Jul-Aug) which means the model is reliable to forecast rainfall distribution over Cimanuk watersheds region (over West Java) on those seasons. CCA score over those season prediction mostly over 0.7. The accuracy of the model CPT also indicated by the Relative Operating Characteristic (ROC) curve of the results of Pearson correlation 3 representative point of sub-watershed (Sumedang, Majalengka, and Cirebon), were mostly located in the top line of non-skill, and evidenced by the same of rainfall patterns between observation and forecast. So, the model of CPT with CCA method
Characterization of sandwich panels for indentation and impact
International Nuclear Information System (INIS)
Shazly, M; Salem, S; Bahei-El-Din, Y
2013-01-01
The integrity of sandwich structures which are susceptible to impact may deteriorate significantly due to collapse of the core material and delamination of the face sheets. The integration of a thin polyurethane interlayer between the composite face sheet and foam core is known to protect the core material and substantially improve the resistance to impact. The objective of the present work is to characterize the response of sandwich panels, as well as that of the constituents to impact. In particular, the response of polyurethane and foam samples under a range of quasi-static and dynamic loading rates is determined experimentally. Furthermore, the response of sandwich panels to quasi-static indentation and low velocity impact is examined to quantify the extent of damage and how it is affected by the integration of polyurethane interlayers in their construction. This information is useful in the modelling of high velocity impact of sandwich panels; an effort which is currently underway. The results illustrate the benefit of using polyurethane interlayers within the construction of sandwich panels in enhancing their performance under quasi-static indentation and impact loads
A novel electrochemical aptamer-antibody sandwich assay for lysozyme detection.
Ocaña, Cristina; Hayat, Akhtar; Mishra, Rupesh; Vasilescu, Alina; del Valle, Manel; Marty, Jean-Louis
2015-06-21
In this paper, we have reported a novel electrochemical aptamer-antibody based sandwich biosensor for the detection of lysozyme. In the sensing strategy, an anti-lysozyme aptamer was immobilized onto the carbon electrode surface by covalent binding via diazonium salt chemistry. After incubating with a target protein (lysozyme), a biotinylated antibody was used to complete the sandwich format. The subsequent additions of avidin-alkaline phosphatase as an enzyme label, and a 1-naphthyl phosphate substrate (1-NPP) allowed us to determine the concentration of lysozyme (Lys) via Differential Pulse Voltammetry (DPV) of the generated enzyme reaction product, 1-naphthol. Using this strategy, a wide detection range from 5 fM to 5 nM was obtained for a target lysozyme, with a detection limit of 4.3 fM. The control experiments were carried out by using bovine serum albumin (BSA), cytochrome c and casein. The results showed that the proposed biosensor had good specificity, stability and reproducibility for lysozyme analysis. In addition, the biosensor was applied for detecting lysozyme in spiked wine samples, and very good recovery rates were obtained in the range from 95.2 to 102.0% for lysozyme detection. This implies that the proposed sandwich biosensor is a promising analytical tool for the analysis of lysozyme in real samples.
Flexural Behavior of Aluminum Honeycomb Core Sandwich Structure
Matta, Vidyasagar; Kumar, J. Suresh; Venkataraviteja, Duddu; Reddy, Guggulla Bharath Kumar
2017-05-01
This project is concerned with the fabrication and flexural testing of aluminium honey comb sandwich structure which is a special case of composite materials that is fabricated by attaching two thin but stiff skins to a light weight but thick core. The core material is normally low density material but its high thickness provide the sandwich composite with high bonding stiffness. Honeycomb core are classified into two types based on the materials and structures. Hexagonal shape has a unique properties i.e has more bonding strength and less formation time based on the cell size and sheet thickness. Sandwich structure exhibit different properties such as high load bearing capacity at low weight and has excellent thermal insulation. By considering the above properties it has tendency to minimize the structural problem. So honey comb sandwich structure is choosed. The core structure has a different applications such as aircraft, ship interiors, construction industries. As there is no proper research on strength characteristics of sandwich structure. So, we use light weight material to desire the strength. There are different parameters involved in this structure i.e cell size, sheet thickness and core height. In this project we considered 3 level of comparison among the 3 different parameters cell size of 4, 6 and 8 mm, sheet thickness of 0.3, 0.5 and 0.7 mm, and core height of 20,25 and 30 mm. In order to reduce the number of experiment we use taguchi design of experiment, and we select the L8 orthogonal array is the best array for this type of situation, which clearly identifies the parameters by independent of material weight to support this we add the minitab software, to identify the main effective plots and regression equation which involves the individual response and corresponding parameters. Aluminium material is used for the fabrication of Honeycomb sandwich structure among the various grades of aluminium we consider the AL6061 which is light weight material
Kamarajah, Sivesh K
2018-03-07
Recently, the AJCC has released its 8th edition changes to the staging system for intrahepatic cholangiocarcinoma (iCCA). This study sought to validate the proposed changes to the 8th edition of AJCC system for T and N classification of iCCA using a population-based data set. Using the Surveillance, Epidemiology, and End Results (SEER) database (1998-2013), patients undergoing resection or non-surgical management for non-metastatic iCCA were identified. Overall survival was estimated using the Kaplan-Meier method and compared using log-rank tests. Concordance indices (c-indices) calculated from Cox proportional hazards models were calculated to evaluate discriminatory power. The study included 2630 patients resected (37%) or non-surgically managed (63%) for iCCA. Nodal staging was performed in 56%, of whom 31% had positive nodes. For all patients with iCCA, the median 5-year survival by AJCC T classification for T1a, T1b, T2, T3, and T4 was 32, 21, 14, 10, and 10 months, respectively (p < 0.001). The concordance index for the staging system was 0.57 for all patients, 0.62 for those who underwent resection, and 0.54 for patients who did not undergo resection. In summary, the new AJCC 8th edition staging system is comparable to the 7th edition and valid in stratifying patients with iCCA. However, the performance of the staging system is better in patients undergoing surgical resection than those undergoing non-surgical management. These findings further highlight the need for improved accuracy of radiological imaging in clinically staging patients to guide prognosis.
Ingravallo, P; Lahser, F; Xia, E; Sodowich, B; Lai, V C; Hong, Z; Zhong, W
2001-06-01
The nonstructural protein 5B (NS5B) of hepatitis C virus (HCV) is an RNA-dependent RNA polymerase (RdRp) which plays an essential role in viral RNA replication. Antibodies that specifically recognize NS5B will have utilities in monitoring NS5B production and subcellular localization, as well as in structure-function studies. In this report, three mouse monoclonal antibodies (mAbs), 16A9C9, 16D9A4 and 20A12C7, against a recombinant NS5B protein (genotype 1a, H-77 strain) were produced. These mAbs specifically recognize HCV NS5B, but not RdRps of polivirus (PV), bovine viral diarrhea virus (BVDV) or GB virus B (GBV-B). The mAbs can readily detect NS5B in cellular lysates of human osteosarcoma Saos2 cells constitutively expressing the nonstructural region of HCV (NS3-NS4A-NS4B-NS5A-NS5B). NS5B proteins of different HCV genotypes/subtypes (1a, 1b, 2a, 2c, 5a) showed varied affinity for these mAbs. Interestingly, the epitopes for the mAbs were mapped to the palm subdomain (amino acid 188-370) of the HCV RdRp as determined by immunoblotting analysis of a panel of HCV/GBV-B chimeric NS5B proteins. The binding site was mapped between amino acid 231 and 267 of NS5B for 16A9C9, and between 282 and 372 for 16D9A4 and 20A12C7. Furthermore, these mAbs showed no inhibitory effect on the NS5B polymerase activity in vitro.
Coudert, Lucie; Blais, Jean-François; Mercier, Guy; Cooper, Paul; Janin, Amélie; Gastonguay, Louis
2014-01-01
In recent years, an efficient and economically attractive leaching process has been developed to remove metals from copper-based treated wood wastes. This study explored the applicability of this leaching process using chromated copper arsenate (CCA) treated wood samples with different initial metal loading and elapsed time between wood preservation treatment and remediation. The sulfuric acid leaching process resulted in the solubilization of more than 87% of the As, 70% of the Cr, and 76% of the Cu from CCA-chips and in the solubilization of more than 96% of the As, 78% of the Cr and 91% of the Cu from CCA-sawdust. The results showed that the performance of this leaching process might be influenced by the initial metal loading of the treated wood wastes and the elapsed time between preservation treatment and remediation. The effluents generated during the leaching steps were treated by precipitation-coagulation to satisfy the regulations for effluent discharge in municipal sewers. Precipitation using ferric chloride and sodium hydroxide was highly efficient, removing more than 99% of the As, Cr, and Cu. It appears that this leaching process can be successfully applied to remove metals from different CCA-treated wood samples and then from the effluents. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Aneta Krzyżak
2016-01-01
Full Text Available Sandwich panels are composites which consist of two thin laminate outer skins and lightweight (e.g., honeycomb thick core structure. Owing to the core structure, such composites are distinguished by stiffness. Despite the thickness of the core, sandwich composites are light and have a relatively high flexural strength. These composites have a spatial structure, which affects good thermal insulator properties. Sandwich panels are used in aeronautics, road vehicles, ships, and civil engineering. The mechanical properties of these composites are directly dependent on the properties of sandwich components and method of manufacturing. The paper presents some aspects of technology and its influence on mechanical properties of sandwich structure polymer composites. The sandwiches described in the paper were made by three different methods: hand lay-up, press method, and autoclave use. The samples of sandwiches were tested for failure caused by impact load. Sandwiches prepared in the same way were used for structural analysis of adhesive layer between panels and core. The results of research showed that the method of manufacturing, more precisely the pressure while forming sandwich panels, influences some mechanical properties of sandwich structured polymer composites such as flexural strength, impact strength, and compressive strength.
Mueller, Claudia; Dietel, Elke; Heynen, Severin R; Nalenz, Heiko; Goldbach, Pierre; Mahler, Hanns-Christian; Schmidt, Johannes; Grauschopf, Ulla; Schoenhamnmer, Karin
2015-01-01
MabThera is an essential component of the standard-of-care regimens in the treatment of non-Hodgkin lymphoma and Chronic Lymphatic Leukemia. MabThera for subcutaneous injection is a novel line extension that has been approved by the European Medicines Agency for the treatment of patients with follicular lymphoma and diffuse large B-cell lymphoma. This study aimed to evaluate in-use stability data of MabThera subcutaneous drug-product solution in single-use syringes for subcutaneous administration according to the European Medicines Agency guideline. The drug-product solution was exposed to material contact surfaces of five different administration setups commonly used in subcutaneous drug delivery. MabThera subcutaneous was transferred under aseptic conditions into polypropylene and polycarbonate syringes and stored for 1, 2, and 4 weeks at 2°C to 8°C followed by 24 hours at 30°C. After storage, subcutaneous administration was simulated and MabThera subcutaneous drug-product solution quality attributes were evaluated by using compendial physico-chemical tests, as well as suitable and validated molecule- and formulation-specific analytical methods. MabThera subcutaneous vials were treated and analyzed in parallel. The physico-chemical results of MabThera subcutaneous in the different setups were comparable to the control for all timepoints. No change in drug-product quality after storage and simulated administration was found compared to the control. However, since single-dose products do not contain preservatives, microbial contamination and growth needs to be avoided and product sterility needs to be ensured. The results showed that MabThera subcutaneous remains compatible and stable, from a physico-chemical perspective, for up to 4 weeks at 2°C to 8°C followed by 24 hours at 30°C with the contact materials tested in this study. In order to avoid and minimize microbial growth, MabThera subcutaneous should be used immediately after removal from the original
Microdroplet sandwich real-time rt-PCR for detection of pandemic and seasonal influenza subtypes.
Directory of Open Access Journals (Sweden)
Stephanie L Angione
Full Text Available As demonstrated by the recent 2012/2013 flu epidemic, the continual emergence of new viral strains highlights the need for accurate medical diagnostics in multiple community settings. If rapid, robust, and sensitive diagnostics for influenza subtyping were available, it would help identify epidemics, facilitate appropriate antiviral usage, decrease inappropriate antibiotic usage, and eliminate the extra cost of unnecessary laboratory testing and treatment. Here, we describe a droplet sandwich platform that can detect influenza subtypes using real-time reverse-transcription polymerase chain reaction (rtRT-PCR. Using clinical samples collected during the 2010/11 season, we effectively differentiate between H1N1p (swine pandemic, H1N1s (seasonal, and H3N2 with an overall assay sensitivity was 96%, with 100% specificity for each subtype. Additionally, we demonstrate the ability to detect viral loads as low as 10(4 copies/mL, which is two orders of magnitude lower than viral loads in typical infected patients. This platform performs diagnostics in a miniaturized format without sacrificing any sensitivity, and can thus be easily developed into devices which are ideal for small clinics and pharmacies.
International Nuclear Information System (INIS)
Ramos Suzarte, Mayra; Iznaga Escobar, Normando; Torres Gemil, Olga; Rodriguez Obaya, Teresita; Perez Rodriguez, Rolando; Rodriguez Mesa, Nelson; Oliva Gonzalez, Juan P.; Perera Pintado, Alejandro; Torres Aroche, Leonel; Batista Cuellar, Juan; Gonzalez Lazo, Nery; Cruz, Teresa; Leonard, Ibrahim; Neninger, Elia
2003-01-01
The present work is aimed at demonstrating that humanized hR3 and ior egf/r3, ior c5, ior cea-1 murine monoclonal antibodies (mAbs) can identify primary neoplasia lesions, Their post-surgical received and metastasis by using immunography, Results showed that above mentioned mAbs are useful for the diagnosis of epithelial tumors, their metastasis and post-surgical received. this technique becomes a concept prove for further use of mAbs in cancer therapy
International Nuclear Information System (INIS)
Moon, M.W.; Hsi, R.S.P.
1992-01-01
(R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)
ELISA with double antigen sandwich for screening specific serum anti-TP antibody in blood donors
International Nuclear Information System (INIS)
Wang Yiqing; Shi Zhixu
2002-01-01
Objective: To select a sensitive and specific laboratory examination suitable for screening serum anti-TP antibody in blood donors. Methods: The serum anti-TP antibody in 11271 blood donors were detected using ELISA with double antigen sandwich and the outcomes were compared with those using RPR assay. The conflicting specimen were confirmed by repeating the test with TPHA assay. Results: The positive rates of serum anti-TP antibody by ELISA with double antigen sandwich and RPR was 0.36% (41/11271) and 0.26% (29/11271), respectively. The coincidence of the detecting outcomes by ELISA with double antigen sandwich and RPR with TPHA was 97.5% (40/41) and 63.41%(26/41) respectively. Conclusion: Compared with RPR assay, ELISA with double antigen sandwich has higher sensibility and specificity for screening serum anti-TP antibody in blood donors
Catalytic conversion of 11C-labeled methanol over Cs-ZSM-5 zeolite
International Nuclear Information System (INIS)
Sarkadi-Priboczki, E.; Kovacs, Z.; Kumar, N.; Salmi, T.; Murzin, D.Yu.
2004-01-01
Reaction mechanism of the conversion of 11 C labeled methanol over basic Cs-ZSM-5 zeolite catalyst was investigated and the reaction products obtained were compared with that of H-ZSM-5 acidic catalyst. The catalytic experiments were carried out by passing 11 C-labeled methanol with He as a carrier gas over Cs-ZSM-5 packed in a micro reactor. After adsorption of the radio methanol, the catalyst was heated up to 330 deg C. The products of the catalytic conversion of the 11 C-labeled methanol were analyzed by radio-gas chromatography (gas chromatograph with thermal conductivity detector on-line coupled with a radioactivity detector). (N.T.)
International Nuclear Information System (INIS)
Wardlaw, Joanna M.; Lewis, Steff
2005-01-01
Purpose: Carotid stenosis is usually determined on Doppler ultrasound from velocity readings. We wondered if angiography-style stenosis measurements applied to ultrasound images improved accuracy over velocity readings alone, and if so, which measure correlated best with angiography. Materials and methods: We studied prospectively patients undergoing colour Doppler ultrasound (CDU) for TIA or minor stroke. Those with 50%+ symptomatic internal carotid artery (ICA) stenosis had intra-arterial angiography (IAA). We measured peak systolic ICA velocity, and from the ultrasound image, the minimal residual lumen, the original lumen (ECST), ICA diameter distal (NASCET) and CCA diameter proximal (CCA method) to the stenosis. The IAAs were measured by ECST, NASCET and CCA methods also, blind to CDU. Results: Amongst 164 patients (328 arteries), on CDU the ECST, NASCET and CCA stenosis measures were similarly related to each other (ECST = 0.54 NASCET + 46) as on IAA (ECST = 0.6 NASCET + 40). Agreement between CDU- and IAA-measured stenosis was similar for ECST (r = 0.51), and CCA (r = 0.48) methods, and slightly worse for NASCET (r = 0.41). Adding IAA-style stenosis to the peak systolic ICA velocity did not improve agreement with IAA over peak systolic velocity alone. Conclusion: Angiography-style stenosis measures have similar inter-relationships when applied to CDU, but do not improve accuracy of ultrasound over peak systolic ICA velocity alone
Design and manufacturing of bio-based sandwich structures
CSIR Research Space (South Africa)
John, Maya J
2017-03-01
Full Text Available The aim of this chapter is to discuss the design and manufacturing of bio-based sandwich structures. As the economic advantages of weight reduction have become mandatory for many advanced industries, bio-based sandwich panels have emerged...
Küssau, Tanja; Flipo, Marion; Van Wyk, Niel; Viljoen, Albertus; Olieric, Vincent; Kremer, Laurent; Blaise, Mickaël
2018-05-01
In mycobacteria, the ketoacyl-acyl carrier protein (ACP) reductase MabA (designated FabG in other bacteria) catalyzes the NADPH-dependent reduction of β-ketoacyl-ACP substrates to β-hydroxyacyl-ACP products. This first reductive step in the fatty-acid biosynthesis elongation cycle is essential for bacteria, which makes MabA/FabG an interesting drug target. To date, however, very few molecules targeting FabG have been discovered and MabA remains the only enzyme of the mycobacterial type II fatty-acid synthase that lacks specific inhibitors. Despite the existence of several MabA/FabG crystal structures, the structural rearrangement that occurs upon cofactor binding is still not fully understood. Therefore, unlocking this knowledge gap could help in the design of new inhibitors. Here, high-resolution crystal structures of MabA from Mycobacterium smegmatis in its apo, NADP + -bound and NADPH-bound forms are reported. Comparison of these crystal structures reveals the structural reorganization of the lid region covering the active site of the enzyme. The crystal structure of the apo form revealed numerous residues that trigger steric hindrance to the binding of NADPH and substrate. Upon NADPH binding, these residues are pushed away from the active site, allowing the enzyme to adopt an open conformation. The transition from an NADPH-bound to an NADP + -bound form is likely to facilitate release of the product. These results may be useful for subsequent rational drug design and/or for in silico drug-screening approaches targeting MabA/FabG.
Bi, Lei
2013-11-01
A chemically stable electrolyte structure was developed for proton-conducting SOFCs by using two layers of stable BaZr0.7Pr 0.1Y0.2O3 -δ to sandwich a highly-conductive but unstable BaCe0.8Y0.2O 3 -δ electrolyte layer. The sandwiched electrolyte structure showed good chemical stability in both CO2 and H2O atmosphere, indicating that the BZPY layers effectively protect the inner BCY electrolyte, while the BCY electrolyte alone decomposed completely under the same conditions. Fuel cell prototypes fabricated with the sandwiched electrolyte achieved a relatively high performance of 185 mW cm- 2 at 700 C, with a high electrolyte film conductivity of 4 × 10- 3 S cm- 1 at 600 C. © 2013 Elsevier B.V.
Hajdú, István; Flachner, Beáta; Bognár, Melinda; Végh, Barbara M; Dobi, Krisztina; Lőrincz, Zsolt; Lázár, József; Cseh, Sándor; Takács, László; Kurucz, István
2014-08-01
Monoclonal antibody proteomics uses nascent libraries or cloned (Plasmascan™, QuantiPlasma™) libraries of mAbs that react with individual epitopes of proteins in the human plasma. At the initial phase of library creation, cognate protein antigen and the epitope interacting with the antibodies are not known. Scouting for monoclonal antibodies (mAbs) with the best binding characteristics is of high importance for mAb based biomarker assay development. However, in the absence of the identity of the cognate antigen the task represents a challenge. We combined phage display, and surface plasmon resonance (Biacore) experiments to test whether specific phages and the respective mimotope peptides obtained from large scale studies are applicable to determine key features of antibodies for scouting. We show here that mAb captured phage-mimotope heterogeneity that is the diversity of the selected peptide sequences, is inversely correlated with an important binding descriptor; the off-rate of the antibodies and that represents clues for driving the selection of useful mAbs for biomarker assay development. Carefully chosen synthetic mimotope peptides are suitable for specificity testing in competitive assays using the target proteome, in our case the human plasma. Copyright © 2014 Elsevier B.V. All rights reserved.
The sandwich sign | Mahomed | SA Journal of Radiology
African Journals Online (AJOL)
The sandwich sign refers to the sandwiching of mesenteric vessels and fat by enlarged mesenteric nodes on cross-sectional imaging, commonly occurring in lymphoma, but not specific to lymphoma. The sign is radiologically indistinguishable from post-transplant lymphoproliferative disorders. The radiological significance ...
Zhou, Shiyue; Tello, Nadia; Harvey, Alex; Boyes, Barry; Orlando, Ron; Mechref, Yehia
2016-06-01
Glycans have numerous functions in various biological processes and participate in the progress of diseases. Reliable quantitative glycomic profiling techniques could contribute to the understanding of the biological functions of glycans, and lead to the discovery of potential glycan biomarkers for diseases. Although LC-MS is a powerful analytical tool for quantitative glycomics, the variation of ionization efficiency and MS intensity bias are influencing quantitation reliability. Internal standards can be utilized for glycomic quantitation by MS-based methods to reduce variability. In this study, we used stable isotope labeled IgG2b monoclonal antibody, iGlycoMab, as an internal standard to reduce potential for errors and to reduce variabililty due to sample digestion, derivatization, and fluctuation of nanoESI efficiency in the LC-MS analysis of permethylated N-glycans released from model glycoproteins, human blood serum, and breast cancer cell line. We observed an unanticipated degradation of isotope labeled glycans, tracked a source of such degradation, and optimized a sample preparation protocol to minimize degradation of the internal standard glycans. All results indicated the effectiveness of using iGlycoMab to minimize errors originating from sample handling and instruments. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Labeling of 3H11 With 123I and Its Biodistribution
International Nuclear Information System (INIS)
Qin Hongbin; Yin Wei; Gao Huibo; Chen Daming; Qi Benzhong; Jin Xiaohai; Bai Hongsheng; Zhang Wenhui; Yang Zhi
2010-01-01
3H11 was labeled with 123 I by Iodogen method,and the labeling product were purified with PD-10 column. The labeling yield and the radiochemical purity of the product was determined by paper chromatography. The biodistribution of 123 I-3H11 in normal mice was car ride out as well. The optimal experimental conditions of 123 I-3H11 was as follow: Iodogen 10 μg, 3H11 30 μg, Na 123 I solution 20 μL (13.3 MBq), PBS 100 μL (pH 7.4, 0.2 mol/L), the normal temperature for 8 min. The labeling yield of 123 I-3H11 was 70%-80%. After stored at 4 degree C for 48 h in human serum,the radiochemical purity was more than 92%. The results of biodistribution showed that the clearance of radiolabeled antibody in blood (half time, T 1/2 ) was 12.25±0.25 h, and the radioactivity in the stomach was up taken obviously. The above results indicated that 123 I-3H11 appears to show some potential as gastric cancer imaging diagnostic agent. (authors)
Zhang, Wenshuai; Zeng, Xiaoyan; Zhang, Li; Peng, Haiyan; Jiao, Yongjun; Zeng, Jun; Treutlein, Herbert R.
2013-06-01
In this work, we have developed a new approach to predict the epitopes of antigens that are recognized by a specific antibody. Our method is based on the "multiple copy simultaneous search" (MCSS) approach which identifies optimal locations of small chemical functional groups on the surfaces of the antibody, and identifying sequence patterns of peptides that can bind to the surface of the antibody. The identified sequence patterns are then used to search the amino-acid sequence of the antigen protein. The approach was validated by reproducing the binding epitope of HIV gp120 envelop glycoprotein for the human neutralizing antibody as revealed in the available crystal structure. Our method was then applied to predict the epitopes of two glycoproteins of a newly discovered bunyavirus recognized by an antibody named MAb 4-5. These predicted epitopes can be verified by experimental methods. We also discuss the involvement of different amino acids in the antigen-antibody recognition based on the distributions of MCSS minima of different functional groups.
Directory of Open Access Journals (Sweden)
Andrew C Harris
Full Text Available Passive immunization with monoclonal antibodies (mAbs against (+-methamphetamine (METH is being evaluated for the treatment of METH addiction. A human/mouse chimeric form of the murine anti-METH mAb7F9 has entered clinical trials. This study examined the effects of murine mAb7F9 on certain addiction-related behavioral effects of METH in rats as measured using intracranial self-stimulation (ICSS. Initial studies indicated that acute METH (0.1-0.56 mg/kg, s.c. lowered the minimal (threshold stimulation intensity that maintained ICSS. METH (0.3 mg/kg, s.c. also blocked elevations in ICSS thresholds (anhedonia-like behavior during spontaneous withdrawal from a chronic METH infusion (10 mg/kg/day x 7 days. In studies examining effects of i.v. pretreatment with mAb7F9 (at 30, 100, or 200 mg/kg, 200 mg/kg blocked the ability of an initial injection of METH (0.3 mg/kg, s.c. to reduce baseline ICSS thresholds, but was less capable of attenuating the effect of subsequent daily injections of METH. MAb7F9 (200 mg/kg also produced a small but significant reduction in the ability of METH (0.3 mg/kg, s.c. to reverse METH withdrawal-induced elevations in ICSS thresholds. These studies demonstrate that mAb7F9 can partially attenuate some addiction-related effects of acute METH in an ICSS model, and provide some support for the therapeutic potential of mAb7F9 for the treatment of METH addiction.
Podocyte changes upon induction of albuminuria in Thy-1.1 transgenic mice.
Smeets, B.; Dijkman, H.B.P.M.; Loeke, N. te; Son, J.P.H.F. van; Steenbergen, E.; Assmann, K.J.M.; Wetzels, J.F.M.; Groenen, P.J.T.A.
2003-01-01
BACKGROUND: Thy-1.1 transgenic mice, characterized by ectopic expression of the Thy-1.1 protein on podocytes, spontaneously develop proteinuria and focal glomerulosclerosis (FGS). Injection of a monoclonal antibody (mAb) directed against the Thy-1.1 protein in young transgenic mice induces a massive
Laws, Derek R.
2014-09-22
The one-electron oxidations of two dimers of half-sandwich osmium carbonyl complexes have been examined by electrochemistry, spectro-electrochemistry, and computational methods. The all-terminal carbonyl complex Os2Cp2(CO)4 (1, Cp = η5-C5H5) undergoes a reversible one-electron anodic reaction at E1/2 = 0.41 V vs ferrocene in CH2Cl2/0.05 M [NBu4][B(C6F5)4], giving a rare example of a metal-metal bonded radical cation unsupported by bridging ligands. The IR spectrum of 1+ is consistent with an approximately 1:1 mixture of anti and gauche structures for the 33 e- radical cation in which it has retained all-terminal bonding of the CO ligands. Density functional theory (DFT) calculations, including orbital-occupancy-perturbed Mayer bond-order analyses, show that the highest-occupied molecular orbitals (HOMOs) of anti-1 and gauche-1 are metal-ligand delocalized. Removal of an electron from 1 has very little effect on the Os-Os bond order, accounting for the resistance of 1+ to heterolytic cleavage. The Os-Os bond distance is calculated to decrease by 0.10 å and 0.06 å as a consequence of one-electron oxidation of anti-1 and gauche-1, respectively. The CO-bridged complex Os2Cp∗2(μ-CO)2(CO)2 (Cp∗ = η5-C5Me5), trans-2, undergoes a more facile oxidation, E1/2 = -0.11 V, giving a persistent radical cation shown by solution IR analysis to preserve its bridged-carbonyl structure. However, ESR analysis of frozen solutions of 2+ is interpreted in terms of the presence of two isomers, most likely anti-2+ and trans-2+, at low temperature. Calculations show that the HOMO of trans-2 is highly delocalized over the metal-ligand framework, with the bridging carbonyls accounting for about half of the orbital makeup. The Os-Os bond order again changes very little with removal of an electron, and the Os-Os bond length actually undergoes minor shortening. Calculations suggest that the second isomer of 2+ has the anti all-terminal CO structure. (Figure Presented) © 2014 American
Optimization of composite sandwich cover panels subjected to compressive loadings
Cruz, Juan R.
1991-01-01
An analysis and design method is presented for the design of composite sandwich cover panels that include the transverse shear effects and damage tolerance considerations. This method is incorporated into a sandwich optimization computer program entitled SANDOP. As a demonstration of its capabilities, SANDOP is used in the present study to design optimized composite sandwich cover panels for for transport aircraft wing applications. The results of this design study indicate that optimized composite sandwich cover panels have approximately the same structural efficiency as stiffened composite cover panels designed to satisfy individual constraints. The results also indicate that inplane stiffness requirements have a large effect on the weight of these composite sandwich cover panels at higher load levels. Increasing the maximum allowable strain and the upper percentage limit of the 0 degree and +/- 45 degree plies can yield significant weight savings. The results show that the structural efficiency of these optimized composite sandwich cover panels is relatively insensitive to changes in core density. Thus, core density should be chosen by criteria other than minimum weight (e.g., damage tolerance, ease of manufacture, etc.).
Cation-mediated conversion of the state of charge in uranium arene inverted-sandwich complexes
Energy Technology Data Exchange (ETDEWEB)
Camp, Clement; Mougel, Victor; Pecaut, Jacques; Mazzanti, Marinella [Laboratoire de Reconnaissance Ionique et Chimie de Coordination, SCIB, UMR-E3 CEA-UJF, INAC, CEA-Grenoble (France); Maron, Laurent [LCPNO, CNRS and INSA, UPS, Universite de Toulouse (France)
2013-12-16
Two new arene inverted-sandwich complexes of uranium supported by siloxide ancillary ligands [K{U(OSi(OtBu)_3)_3}{sub 2}(μ-η{sup 6}:η{sup 6}-C{sub 7}H{sub 8})] (3) and [K{sub 2}{U(OSi(OtBu)_3)_3}{sub 2}(μ-η{sup 6}:η{sup 6}-C{sub 7}H{sub 8})] (4) were synthesized by the reduction of the parent arene-bridged complex [{U(OSi(OtBu)_3)_3}{sub 2}(μ-η{sup 6}:η{sup 6}-C{sub 7}H{sub 8})] (2) with stoichiometric amounts of KC{sub 8} yielding a rare family of inverted-sandwich complexes in three states of charge. The structural data and computational studies of the electronic structure are in agreement with the presence of high-valent uranium centers bridged by a reduced tetra-anionic toluene with the best formulation being U{sup V}-(arene{sup 4-})-U{sup V}, KU{sup IV}-(arene{sup 4-})-U{sup V}, and K{sub 2}U{sup IV}-(arene{sup 4-})-U{sup IV} for complexes 2, 3, and 4 respectively. The potassium cations in complexes 3 and 4 are coordinated to the siloxide ligands both in the solid state and in solution. The addition of KOTf (OTf=triflate) to the neutral compound 2 promotes its disproportionation to yield complexes 3 and 4 (depending on the stoichiometry) and the U{sup IV} mononuclear complex [U(OSi(OtBu){sub 3}){sub 3}(OTf)(thf){sub 2}] (5). This unprecedented reactivity demonstrates the key role of potassium for the stability of these complexes. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
11 CFR 102.11 - Petty cash fund (2 U.S.C. 432(h)(2)).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Petty cash fund (2 U.S.C. 432(h)(2)). 102.11 Section 102.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND... and Congressional district) sought by such candidate. ...
TGF-beta Sma/Mab signaling mutations uncouple reproductive aging from somatic aging.
Directory of Open Access Journals (Sweden)
Shijing Luo
2009-12-01
Full Text Available Female reproductive cessation is one of the earliest age-related declines humans experience, occurring in mid-adulthood. Similarly, Caenorhabditis elegans' reproductive span is short relative to its total life span, with reproduction ceasing about a third into its 15-20 day adulthood. All of the known mutations and treatments that extend C. elegans' reproductive period also regulate longevity, suggesting that reproductive span is normally linked to life span. C. elegans has two canonical TGF-beta signaling pathways. We recently found that the TGF-beta Dauer pathway regulates longevity through the Insulin/IGF-1 Signaling (IIS pathway; here we show that this pathway has a moderate effect on reproductive span. By contrast, TGF-beta Sma/Mab signaling mutants exhibit a substantially extended reproductive period, more than doubling reproductive span in some cases. Sma/Mab mutations extend reproductive span disproportionately to life span and act independently of known regulators of somatic aging, such as Insulin/IGF-1 Signaling and Dietary Restriction. This is the first discovery of a pathway that regulates reproductive span independently of longevity and the first identification of the TGF-beta Sma/Mab pathway as a regulator of reproductive aging. Our results suggest that longevity and reproductive span regulation can be uncoupled, although they appear to normally be linked through regulatory pathways.
Wang, Hailong; Liu, Chenxi; Liu, Tao; Zeng, Suyuan; Cao, Wei; Ma, Qi; Duan, Chunying; Dou, Jianmin; Jiang, Jianzhuang
2013-11-21
Reaction between Schiff-base ligand and half-sandwich complex M(Pc)(acac) led to the isolation of new sandwich-type mixed (phthalocyaninato)(Schiff-base) di-lanthanide compounds M2(Pc)2(L)H2O (M = Dy, Gd) (1, 2) [H2Pc = metal free phthalocyanine, Hacac = acetylacetone, H2L = N,N'-bis(3-methyloxysalicylidene)benzene-1,2-diamine] with the triple-decker molecular structure clearly revealed by single crystal X-ray diffraction analysis. For the comparative studies, sandwich triple-decker analogues with pure Schiff-base ligand M2(L)3H2O (M = Dy, Gd) (3, 4) were also prepared. Dynamic magnetic measurement result reveals the single-molecule magnet (SMM) nature of the di-dysprosium derivative 1, while the static magnetic investigation over both pure and the diamagnetic diluted samples of this compound discloses the interionic ferromagnetic coupling between the two dysprosium ions, which in turn effectively suppresses the QTM and enhances the energy barrier of this SMM. Nevertheless, comparative studies over the static magnetic properties of the di-dysprosium triple-decker complexes 1 and 3 indicate the stronger magnetic coupling between the two lanthanide ions in mixed (phthalocyaninato)(Schiff-base) species than in the pure Schiff-base triple-decker analogue, suggesting the special coordination sphere around the dysprosium ions in the former compound over the latter one on the more intense inter-ionic ferromagnetic coupling. As a very small step towards understanding the structure-property relationship, the present result will be surely helpful for the design and synthesis of the multinuclear lanthanide-based SMMs with good properties.
5-Bromo-2-[5-(4-nitrophenyl-3-phenyl-4,5-dihydro-1H-pyrazol-1-yl]pyrimidine
Directory of Open Access Journals (Sweden)
B. Kalluraya
2009-12-01
Full Text Available In the title pyrazoline compound, C19H14BrN5O2, the essentially planar pyrazoline and pyrimidine rings [maximum deviations = 0.013 (1 and 0.009 (1 Å, respectively] are inclined slightly to one another, making a dihedral angle of 10.81 (10°. The nitrobenzene unit is almost perpendicular to the attached pyrazoline ring, as indicated by the dihedral angle of 84.61 (8°. In the crystal structure, intermolecular C—H...N contacts link the molecules into dimers in an antiparallel manner. These dimers are further linked into one-dimensional chains along the b axis via C—H...O contacts. The crystal structure is consolidated by three different intermolecular π–π interactions [range of centroid–centroid distances = 3.5160 (11–3.6912 (11 Å].
Heterojunction photodetector based on graphene oxide sandwiched between ITO and p-Si
Ahmad, H.; Tajdidzadeh, M.; Thandavan, T. M. K.
2018-02-01
The drop casting method is utilized on indium tin oxide (ITO)-coated glass in order to prepare a sandwiched ITO/graphene oxide (ITO/GO) with silicon dioxide/p-type silicon (SiO2/p-Si) heterojunction photodetector. The partially sandwiched GO layer with SiO2/p-Si substrate exhibits dual characteristics as it showed good sensitivity towards the illumination of infrared (IR) laser at wavelength of 974 nm. Excellent photoconduction is also observed for current-voltage (I-V) characteristics at various laser powers. An external quantum efficiency greater than 1 for a direct current bias voltage of 0 and 3 V reveals significant photoresponsivity of the photodetector at various laser frequency modulation at 1, 5 and 9 Hz. The rise times are found to be 75, 72 and 70 μs for 1, 5 and 9 Hz while high fall times 455, 448 and 426 are measured for the respective frequency modulation. The fabricated ITO/GO-SiO2/p-Si sandwiched heterojunction photodetector can be considered as a good candidate for applications in the IR regions that do not require a high-speed response.
He, Shengfa; Li, Xin; Wu, Yong; Wu, Shandong; Wu, Zhihua; Yang, Anshu; Tong, Ping; Yuan, Juanli; Gao, Jinyan; Chen, Hongbing
2018-06-01
Bovine milk is a recognized allergenic food source with β-lactoglobulin (BLG) as its major allergen. Reliable detection of BLG epitopes can, therefore, be a useful marker for the presence of milk in processed food products, and for potential allergenicity. At the present, enzyme-linked immunosorbent assays (ELISA) for the detection of BLG are time-consuming and generally not specific to BLG IgE epitopes. In this study, the 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide-activated anti-BLG IgE epitope monoclonal antibody (mAb 1G9) was covalently bound onto the KOH-treated microtiter plate surface. Using this mAb-bound plate in sandwich combination with biotinylated anti-BLG polyclonal antibody-labeled gold nanoparticles, a linear dynamic range between 31.25 and 64 × 10 3 ng mL -1 with a limit of detection for BLG of 0.49 ng mL -1 was obtained, which is 32 times wider and 16 times more sensitive than conventional sandwich ELISA (sELISA). Total recovery of BLG in spiked food samples was found, without matrix effects. Also in partially hydrolyzed infant formulas, the allergenic BLG residues were detected quantitatively. Compared with conventional and commercial BLG detection sELISAs, our sELISA is reliable, highly BLG epitope-specific, user-friendly, and time-saving and allows accurate detection of potentially allergenic residues in different types of processed foods. This improved sELISA protocol can be easily extended to detect other well-identified and characterized food allergens. Graphical abstract IgE epitope mAb-bound plate in sandwich combination with gold probe for sensitive and rapid detection of bovine β-lactoglobulin and its potentially allergenic residues.
H-mode-like discharge under the presence of 1/1 rational surface at ergodic layer in LHD
International Nuclear Information System (INIS)
Morita, Shigeru; Morisaki, Tomohiro; Tanaka, Kenji
2004-01-01
H-mode-like discharge was found in LHD with a full B t field of 2.5T at an outwardly shifted configuration of R ax = 4.00 m where the m/n = 1/1 rational surface is located at the ergodic layer. The H-mode-like discharge was triggered by changing the P NBI from 9MW to 5 MW in a density range of 4-8 x 10 13 cm -3 , followed by a clear density rise, ELM-like H α bursts, and a reduction of magnetic fluctuation. These H-mode-like features vanished with a small radial movement of the 1/1 surface. (author)
Structural basis for the binding of the neutralizing antibody, 7D11, to the poxvirus L1 protein
International Nuclear Information System (INIS)
Su, Hua-Poo; Golden, Joseph W.; Gittis, Apostolos G.; Hooper, Jay W.; Garboczi, David N.
2007-01-01
Medical countermeasures to prevent or treat smallpox are needed due to the potential use of poxviruses as biological weapons. Safety concerns with the currently available smallpox vaccine indicate a need for research on alternative poxvirus vaccine strategies. Molecular vaccines involving the use of proteins and/or genes and recombinant antibodies are among the strategies under current investigation. The poxvirus L1 protein, encoded by the L1R open reading frame, is the target of neutralizing antibodies and has been successfully used as a component of both protein subunit and DNA vaccines. L1-specific monoclonal antibodies (e.g., mouse monoclonal antibody mAb-7D11, mAb-10F5) with potent neutralizing activity bind L1 in a conformation-specific manner. This suggests that proper folding of the L1 protein used in molecular vaccines will affect the production of neutralizing antibodies and protection. Here, we co-crystallized the Fab fragment of mAb-7D11 with the L1 protein. The crystal structure of the complex between Fab-7D11 and L1 reveals the basis for the conformation-specific binding as recognition of a discontinuous epitope containing two loops that are held together by a disulfide bond. The structure of this important conformational epitope of L1 will contribute to the development of molecular poxvirus vaccines and also provides a novel target for anti-poxvirus drugs. In addition, the sequence and structure of Fab-7D11 will contribute to the development of L1-targeted immunotherapeutics
DETECTION OF H i IN EMISSION IN THE LY α EMITTING GALAXY HARO 11
International Nuclear Information System (INIS)
Pardy, Stephen A.; Cannon, John M.; Östlin, Göran; Hayes, Matthew; Bergvall, Nils
2016-01-01
We present the first robust detection of H i 21 cm emission in the blue compact galaxy Haro 11 using the 100 m Robert C. Byrd Green Bank Telescope (GBT). Haro 11 is a luminous blue compact galaxy with emission in both Ly α and the Lyman continuum. We detect (5.1 ± 0.7 × 10 8 ) M ⊙ of H i gas at an assumed distance of 88 Mpc, making this galaxy H i deficient compared to other local galaxies with similar optical properties. Given this small H i mass, Haro 11 has an elevated M H2 / M Hi ratio and a very low gas fraction compared to most local galaxies, and contains twice as much mass in ionized hydrogen as in neutral hydrogen. The H i emission has a linewidth of 71 km s − 1 and is offset 60 km s −1 redward of the optical line center. It is undergoing a starburst after a recent merger that has elevated the star formation rate, and will deplete the gas supply in <0.2 Gyr. Although this starburst has elevated the star formation rate (SFR) compared to galaxies with similar H i masses and line widths, Haro 11 matches a trend of lower gas fractions toward higher SFRs and is below the general trend of increasing H i mass with increasing luminosity. Taken together, our results paint Haro 11 as a standard low-mass galaxy that is undergoing an unusually efficient star formation episode.
Dynamic Response of Functionally Graded Carbon Nanotube Reinforced Sandwich Plate
Mehar, Kulmani; Panda, Subrata Kumar
2018-03-01
In this article, the dynamic response of the carbon nanotube-reinforced functionally graded sandwich composite plate has been studied numerically with the help of finite element method. The face sheets of the sandwich composite plate are made of carbon nanotube- reinforced composite for two different grading patterns whereas the core phase is taken as isotropic material. The final properties of the structure are calculated using the rule of mixture. The geometrical model of the sandwich plate is developed and discretized suitably with the help of available shell element in ANSYS library. Subsequently, the corresponding numerical dynamic responses computed via batch input technique (parametric design language code in ANSYS) of ANSYS including Newmark’s integration scheme. The stability of the sandwich structural numerical model is established through the proper convergence study. Further, the reliability of the sandwich model is checked by comparison study between present and available results from references. As a final point, some numerical problems have been solved to examine the effect of different design constraints (carbon nanotube distribution pattern, core to face thickness ratio, volume fractions of the nanotube, length to thickness ratio, aspect ratio and constraints at edges) on the time-responses of sandwich plate.
Klitgaard, Josephine L; Koefoed, Klaus; Geisler, Christian; Gadeberg, Ole V; Frank, David A; Petersen, Jørgen; Jurlander, Jesper; Pedersen, Mikkel W
2013-10-01
The treatment of chronic lymphocytic leukaemia (CLL) has been improved by introduction of monoclonal antibodies (mAbs) that exert their effect through secondary effector mechanisms. CLL cells are characterized by expression of CD5 and CD23 along with CD19 and CD20, hence anti-CD5 Abs that engage secondary effector functions represent an attractive opportunity for CLL treatment. Here, a repertoire of mAbs against human CD5 was generated and tested for ability to induce complement-dependent cytotoxicity (CDC) and antibody-dependent cell-mediated cytotoxicity (ADCC) both as single mAbs and combinations of two mAbs against non-overlapping epitopes on human CD5. The results demonstrated that combinations of two mAbs significantly increased the level of CDC compared to the single mAbs, while no enhancement of ADCC was seen with anti-CD5 mAb combinations. High levels of CDC and ADCC correlated with low levels of Ab-induced CD5 internalization and degradation. Importantly, an anti-CD5 mAb combination enhanced CDC of CLL cells when combined with the anti-CD20 mAbs rituximab and ofatumumab as well as with the anti-CD52 mAb alemtuzumab. These results suggest that an anti-CD5 mAb combination inducing CDC and ADCC may be effective alone, in combination with mAbs against other targets or combined with chemotherapy for CLL and other CD5-expressing haematological or lymphoid malignancies. © 2013 John Wiley & Sons Ltd.
The deprotonation energies of BH5 and AlH5: Comparisons to GaH5
International Nuclear Information System (INIS)
Speakman, Lucas D.; Turney, Justin M.; Schaefer, Henry F.
2007-01-01
Hypercoordinate boron is most unusual, leading to considerable theoretical and experimental research on the parent BH 5 molecule. The deprotonation energies of BH 5 and the related molecules AlH 5 and GaH 5 have been of particular interest. Here the energy differences for XH 5 ->XH 4 - +H(X=BandAl) are computed to be 332.4 and 326.3kcalmol -1 , respectively, with an aug-cc-pVQZ basis set at the CCSD(T) level of theory. Vibrational frequencies for BH 4 - and AlH 4 - are also reported as 1098, 1210, 2263, and 2284cm -1 and 760, 779, 1658, and 1745cm -1 , respectively, again at the CCSD(T) aug-cc-pVQZ level of theory. Comparisons with the valence isoelectronic GaH 5 molecule are made
Directory of Open Access Journals (Sweden)
Urszula Jarocka
2014-08-01
Full Text Available This paper concerns the development of an immunosensor for detection of peptides derived from avian influenza hemagglutinin H5. Its preparation consists of successive gold electrode modification steps: (i modification with 1,6-hexanedithiol and gold colloidal nanoparticles; (ii immobilization of antibody-binding fragments (Fab’ of anti-hemagglutinin H5 monoclonal antibodies Mab 6-9-1 via S-Au covalent bonds; and (iii covering the remaining free space on the electrode surfaces with bovine serum albumin. The interactions between Fab’ fragments and hemagglutinin (HA variants have been explored with electrochemical impedance spectroscopy (EIS in the presence of [Fe(CN6]3−/4− as an electroactive marker. The immunosensor was able to recognize three different His-tagged variants of recombinant hemagglutinin from H5N1 viruses: H1 subunit (17–340 residues of A/swan/Poland/305-135V08/2006, the long HA (17–530 residues A/Bar-headed Goose/Qinghai/12/2005 and H1 subunit (1–345 residues of A/Vietnam/1194/2004. The strongest response has been observed for the long variant with detection limit of 2.2 pg/mL and dynamic range from 4.0 to 20.0 pg/mL.
Directory of Open Access Journals (Sweden)
Ana Betina Lacunza
2016-01-01
Full Text Available El comportamiento antisocial se refiere a una diversidad de actos que infringen las normas sociales y de convivencia. Su delimitación está dada tanto por la valoración social de la gravedad de los comportamientos como por su alejamiento a las pautas normativas de una sociedad. El objetivo de este trabajo fue analizar las propiedades psicométricas del cuestionario de Conducta Antisocial (CC-A en adolescentes de Tucumán, Argentina. Se aplicó el CC-A y la Batería de Socialización BAS-3 a quinientos once adolescentes escolarizados de once y doce años. Se encontró una solución de tres factores que explicaban el 35 % de la varianza, congruente con la propuesta original. Los coeficientes Alpha de Cronbach fueron adecuados en Agresividad (.735, Aislamiento (.769 y Ansiedad/Retraimiento (.681, y se establecieron relaciones entre CC-A y BAS-3. Así mismo, se observaron correlaciones negativas entre Agresividad, Consideración con los demás y Autocontrol mientras que fueron positivas entre Aislamiento y Retraimiento. Posteriormente, se determinaron las categorías percentilares de esta versión (CC-A de ventiocho ítems; 18% de los adolescentes presentaban percentiles de riesgo en Agresividad mientras que un 20.9% lo hacía en Aislamiento. El estudio aporta datos con respecto a las propiedades psicométricas del instrumento en población local, indicando su sensibilidad para la evaluación del comportamiento antisocial.
Energy Technology Data Exchange (ETDEWEB)
Dimitrievska, Mirjana [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Shea, Patrick [Lawrence Livermore National Laboratory; Kweon, Kyoung E. [Lawrence Livermore National Laboratory; Bercx, Marnik [University of Antwerp; Varley, Joel B. [Lawrence Livermore National Laboratory; Tang, Wan Si [National Institute of Standards and Technology; University of Maryland; Skripov, Alexander V. [Ural Division of the Russian Academy of Sciences; Stavila, Vitalie [Sandia National Laboratories; Udovic, Terrence J. [National Institute of Standards and Technology; Wood, Brandon C. [Lawrence Livermore National Laboratory
2018-02-02
The disordered phases of LiCB11H12 and NaCB11H12 possess superb superionic conductivities that make them suitable as solid electrolytes. In these materials, cation diffusion correlates with high orientational mobilities of the CB11H12- anions; however, the precise relationship has yet to be demonstrated. In this work, ab initio molecular dynamics and quasielastic neutron scattering are combined to probe anion reorientations and their mechanistic connection to cation mobility over a range of timescales and temperatures. It is found that anions do not rotate freely, but rather transition rapidly between orientations defined by the cation sublattice symmetry. The symmetry-breaking carbon atom in CB11H12- also plays a critical role by perturbing the energy landscape along the instantaneous orientation of the anion dipole, which couples fluctuations in the cation probability density directly to the anion motion. Anion reorientation rates exceed 3 x 1010 s-1, suggesting the underlying energy landscape fluctuates dynamically on diffusion-relevant timescales. Furthermore, carbon is found to modify the orientational preferences of the anions and aid rotational mobility, creating additional symmetry incompatibilities that inhibit ordering. The results suggest that synergy between the anion reorientational dynamics and the carbon-modified cation-anion interaction accounts for the higher ionic conductivity in CB11H12- salts compared with B12H122-.
Fracture Analysis of Debonded Sandwich Columns Under Axial Compression
DEFF Research Database (Denmark)
May, A.; Avilés, F.; Berggreen, Christian
A sandwich structure consists of two strong and stiff face sheets bonded to a weak low density core. The large separation between the face sheets provides increased bending rigidity and strength at low weight cost. Thus, sandwich structures frequently present better mechanical properties than...... monolithic structures of the same weight. The vast range of applications of such materials includes wind turbines, marine, and aerospace industries. In this work, geometrically nonlinear finite element analysis is conducted to investigate the fracture parameters and debond propagation of sandwich columns...
Porous Sandwiched Graphene/Silicon Anodes for Lithium Storage
International Nuclear Information System (INIS)
Wei, Liangming; Hou, Zhongyu; Wei, Hao
2017-01-01
Highlights: • In situ hydrolysis of tetraethoxysilane within the confined galleries region of graphite oxide. • New porous sandwiched graphene/Si nanocomposites were prepared by magnesium thermal reduction. • The Si nanostructure was compactly sandwiched between two neighboring graphenes. • The Si/graphene anodes deliver large reversible capacity with excellent cycling stability. - Abstract: Porous sandwiched graphene/Si nanocomposites (PG-Si) are prepared by in situ hydrolysis of tetraethoxysilane within the confined gallery region of graphite oxide, and then magnesium thermal reduction of the intra-gallery SiO 2 to Si nanocrystals. The Si nanostructures are in situ formed within the confined gallery region of graphite, and they are compactly sandwiched between two neighboring graphene sheets. This compactly sandwiched structure affords enhanced electron conductivity, and prevents Si nanoparticles from aggregation. Meanwhile, the free voids between neighboring Si nanocrystals alleviate the volume change of Si during cycling. As a consequence, the resulting PG-Si nanocomposites are high-performance anode materials for lithium-ion batteries which show long cycle life (>500 cycles) and high specific charge capacity (1464 mAh g −1 at a current density of 200 mA/g, 920 mAh g −1 at a current density of 1.68A/g after 500 cycles). The Li + diffusion kinetics in PG-Si is also discussed.
DEFF Research Database (Denmark)
Partal, Miriam Casacuberta; Kinunghi, Safari; Vennervald, Birgitte J
2016-01-01
of Lake Victoria in Mwanza Region, Tanzania, and to optimize the reading of the POC-CCA test lines by using a computer software image analysis. Initially, a pilot study in 106 school children indicated that time of urine collection did not have an impact on CCA results as 84.9% (90) had identical scores...... POC-CCAs were compared to six Kato-Katz smears (75.0% vs. 42.6%; p reading of the POC-CCA, a Software...... tool (Image Studio Lite®) was used to read and quantify the colour (expressed as pixels) of the test line on all positive tests, showing a positive correlation between number of pixels and the visually scored intensities and between number of pixels and egg counts. In conclusion, the POC-CCA assay...
Electrodialytic remediation of CCA-treated waste wood in a 2 m3 pilot plant
DEFF Research Database (Denmark)
Christensen, Iben Vernegren; Pedersen, Anne Juul; Ottosen, Lisbeth M.
2006-01-01
Waste wood that has been treated with chromated-copper-arsenate (CCA) poses a potential environmental problem due to the content of copper, chromium and arsenic. A pilot plant for electrodialytic remediation of up to 2 m3 wood has been designed and tested and the results are presented here. Sever...
AA, sandwich line with magnetic horn
CERN PhotoLab
1980-01-01
The magnetic horn, focusing the antiprotons emanating from the target, was affixed to a sandwich line through which the 150 kA pulses were supplied. Expecting to have to change from time to time the fragile horn (inner conductor only 0.7 mm thick), the assembly was designed for quick exchange. At the lower end of the sandwich line we see the connectors for the high-current cables, at the upper end the magnet horn. It has just been lifted from the V-supports which held it aligned downstream of the target. Continue with 8010293.
Buckling driven debonding in sandwich columns
DEFF Research Database (Denmark)
Østergaard, Rasmus Christian
2008-01-01
results from two mechanisms: (a) interaction of local debond buckling and global buckling and (b) the development of a damaged zone at the debond crack tip. Based on the pronounced imperfection sensitivity, the author predicts that an experimental measurement of the strength of sandwich structures may......A compression loaded sandwich column that contains a debond is analyzed using a geometrically non-linear finite element model. The model includes a cohesive zone along one face sheet/core interface whereby the debond can extend by interface crack growth. Two geometrical imperfections are introduced...
Effect of nanomodified polyester resin on hybrid sandwich laminates
International Nuclear Information System (INIS)
Anbusagar, NRR.; Giridharan, P.K.; Palanikumar, K.
2014-01-01
Highlights: • Effect of nanomodified polyester resin on hybrid sandwich laminates is evaluated. • The hybrid sandwich laminates are fabricated with varying wt% of nanoclay. • Flexural, impact and moisture absorbtion properties are evaluated for hybrid composites. • Scanning electron microscopy is utilized to analyze the dispersion of clay and fractured surfaces of the nanocomposites. - Abstract: Effect of nanoclay modified polyester resin on flexural, impact, hardness and water absorption properties of untreated woven jute and glass fabric hybrid sandwich laminates have been investigated experimentally. The hybrid sandwich laminates are prepared by hand lay-up manufacturing technique (HL) for investigation. All hybrid sandwich laminates are fabricated with a total of 10 layers, by varying the extreme layers and wt% of nanoclay in polyester resin so as to obtain four different combinations of hybrid sandwich laminates. For comparison of the composite with hybrid composite, jute fiber reinforced composite laminate also fabricated. X-ray diffraction (XRD) results obtained from samples with nanoclay indicated that intergallery spacing of the layered clay increases with matrix. Scanning electron microscopy (SEM) gave a morphological picture of the cross-sections and energy dispersive X-ray spectroscopy (EDS) allowed investigating the elemental composition of matrix in composites. The testing results indicated that the flexural properties are greatly increased at 4% of nanoclay loading while impact, hardness and water absorption properties are increased at 6% of nanoclay loading. A plausible explanation for high increase of properties has also been discussed
Energy Technology Data Exchange (ETDEWEB)
Mutschler, J.; Reske, S.N. [Universitaetsklinik Ulm (Germany). Klinik fuer Nuklearmedizin; Steinbach, G. [Universitaetsklinik Ulm (Germany). Abt. Klinische Chemie; Bunjes, D. [Universitaetsklinik Ulm (Germany). Medizinische Klinik III; Buchmann, I. [Universitaetsklinik Heidelberg (Germany). Abt. fuer Nuklearmedizin
2009-07-01
Tumour necrosis factor-{alpha} (TNF-{alpha}) serum levels may increase due to intensive conditioning regimes with high-dose chemotherapy and total body irradiation (TBI) before stem cell transplantation. This increases the risk for developing acute graft versus host disease (aGvHD) after stem cell transplantation. In this prospective study we investigated the influence of radioimmunotherapy with {sup 188}Re-CD-66-mAb on changes on TNF-{alpha} serum levels. Patients, methods: In 18 patients we measured TNF-{alpha} before and up to 96 hours after radioimmunotherapy, in 2 patients in addition following TBI, in 9 patients also following chemotherapy. For measuring TNF-{alpha} we used an automated immunochemiluminescence assay (Immulite 1000 DPC Biermann, Bad Nauheim). The mean follow up period to record incidence of aGVHD was 100 days after stem cell transplantation. Compared to the basal levels before, the levels of TNF-{alpha} after conditioning with {sup 188}Re-CD-66-mAb did not increase significantly and remained in the physiological range. In contrast, these initial physiological cytokine levels increased and became pathological following 48 h after total body irradiation (13.2 {+-} 6.6 pg/ml) and chemotherapy (10.8 {+-} 15.7 pg/ml). In our study we found a low incidence of aGvHD (22.2%, n = 4/18). Conclusion: These results demonstrate that additional conditioning therapy with {sup 188}Re-CD-66-mAb does not increase proinflammatory cytokine levels of TNF-{alpha}. This finding may indicate that additive radioimmunotherapy may not be a significant factor for increasing the rate of conditioning- associated aGvHD. (orig.)
Janda, Katarzyna; Aksamit, Dariusz; Drozdz, Maciej; Krzanowski, Marcin; Ignacak, Ewa; Kowalczyk-Michałek, Martyna; Tabor-Ciepiela, Barbara; Sułowicz, Władysław
2012-01-01
The aim of the study was to evaluate the influence of elevated homocystein (Hcy) level and selected lipid parameters on the progression of atherosclerotic changes in patients after kidney transplantation (KTx). The study included 51 pts (17 F, 34 M) aged 15-62 years (median 38.1) after cadaver KTx. The mean observation period equaled 21.2 months (6-24 months); while total observation period was 90 patients/ years. Hcy levels was measured using HPLC, Lp(a) and Apo-B levels using the nephelometric method and total cholesterol with its' HDL and LDL fractions, triglycerides and creatinine based on the Hitachi 917 analyzer. Patients' blood was drawn before renal transplantation and 3, 6, 9, 12, 15, 18, 21 and 24 months after KTx. Common carotid artery intima media thickness (CCA-IMT) was evaluated by ultrasound on 14 days, 12 and 24 months after KTx. CCA-IMT correlated significantly with Hcy levels after 12 months (R=0.53; p=0.0009) and 24 months (R=0.38; p=0.0356) after KTx. Significant differences were found 12 and 24 months after KTx in CCA-IMT between patients with normal (15 micromol/ l) mean Hcy concentrations: p=0.0035 and p= 0.015, respectively. Analyzing changes in CCA-IMT, significant differences were noted when comparing the CCA-IMT increment after 12 and 24 months post KTx in patients with normal (15 micromol/l) homocystein concentrations: p=0.049 and p=0.0039, respectively. Increment of CCA-IMT 12 months after KTx, significantly correlated with mean total cholesterol level (R=0.35; p=0.0333), whereas 24 months after procedure correlated significantly with 0.0315). Hcy level is an independent risk factor for atherosclerosis development in patients after KTx. Elevated Hcy level as well as increased cholesterol and Lp(a) levels enhance the progression of atherosclerotic changes evaluated by CCA-IMT in KTx patients.
Flexural fatigue failures and lives of Eco-Core sandwich beams
International Nuclear Information System (INIS)
Hossain, Mohammad Mynul; Shivakumar, Kunigal
2014-01-01
Highlights: • Eco-Core sandwich beam is flexural fatigue tested to study its fatigue response. • The core showed three failure types: damage onset, progression and final failure. • These failures were found to be represented by 1%, 5% and 7% change in compliance. • The fatigue stress-life (S–N) relationship follows a power low, σ max /σ ct = A o N α . • The fatigue failure was by multiple vertical cracks followed by 45° shear failure. - Abstract: Eco-Core is a class of syntactic foam made from small volume of high char yield binder and large volume of a class of flyash for fire resistance application. Very little or no flexural fatigue data of this class of core material is reported in the open literature. This paper presents a flexural fatigue response of Eco-Core in a glass/vinyl ester composite face sheet sandwich beam. A four-point loaded flexural test specimen was designed and tested in static and fatigue loadings to cause tension failure in the core. The fatigue test was conducted at maximum cyclic stress (σ max ) ranged from 0.7σ ct to 0.9σ ct , where σ ct is the static flexural strength of the core. The sinusoidal loading frequency of 2 Hz with the stress ratio of 0.1 was used. Flexural fatigue failure modes of Eco-Core sandwich beam were classified: damage onset (single tension crack), damage progression (multiple tension cracks) and ultimate failure (a combination of tension and shear). These failures were characterized by 1%, 5% and 7% changes in compliance that corresponds to N 1% , N 5% and N 7% lives. The fatigue stress-life (S–N) relationship was found to follow the well-known power law equation, σ max /σ ct = A o N α . The constants A o and α were established for all three types of failures. The endurance limit was established based on 1 million cycles limit and it was found to be 0.65σ ct , 0.70σ ct and 0.71σ ct , respectively for the three modes of failure. Flexural fatigue and static failure modes of Eco-Core sandwich
International Nuclear Information System (INIS)
Morales-Morales, Alejo; Duconge, Jorge; Caballero-Torres, Idania; Nunez-Gandolff, Gilda; Fernandez, Eduardo; Iznaga-Escobar, Normando
1999-01-01
The anti-human epidermal growth factor receptor (EGF-R) humanized monoclonal antibody (MAb) h-R3 is an (IgG 1 ), which binds to an extracellular domain of EGF-R. It was used to evaluate the biodistribution on nude mice xenografted with H-125 human lung adenocarcinoma cell line. Results were compared with its murine version of the MAb ior-egf/r3. Twenty-one athymic female 4NMRI nu/nu mice were injected intraperitoneally with 10 μg/100 μCi of 99m Tc-labeled MAbs. Immunoreactivity of 99m Tc-labeled MAbs were measured by enzyme-linked immunosorbent assay (ELISA) on H-125 cell line and the immunoreactive fractions was determined by the Lindmo method. Among all organs, significant accumulation was found in serum (27.05 ± 2.08 %ID/g) and tumor (3.903 ± 0.89 %ID/g) at 4 h after injection. These values decreased to 5.03 ± 0.50 %ID/g and 2.19 ± 0.56 %ID/g for serum and tumor, respectively. The immunoreactive fraction was found to be 0.70, with a correlation coefficient r=0.9984. With the good biodistribution and tumor uptake of the 99m Tc-labeled humanized antibody h-R3, a phase I diagnostic clinical trial of tumor with epithelial origin should be pursued
A new version of code Java for 3D simulation of the CCA model
Zhang, Kebo; Xiong, Hailing; Li, Chao
2016-07-01
In this paper we present a new version of the program of CCA model. In order to benefit from the advantages involved in the latest technologies, we migrated the running environment from JDK1.6 to JDK1.7. And the old program was optimized into a new framework, so promoted extendibility.
Glöckner, Andreas; Bannenberg, Thomas; Büschel, Susanne; Daniliuc, Constantin G; Jones, Peter G; Tamm, Matthias
2011-05-23
The transmetalation reaction between [(η(7) -C(7) H(7) )ZrCl(tmeda)] (1; tmeda=N,N,N',N'-tetramethylethylenediamine) and various phospholide anions leads to a new class of mixed sandwich complexes: [(η(7)-C(7)H(7))Zr(η(5)-C(4)PMe(4))] (2), [(η(7)-C(7)H(7))Zr(η(5)-C(4)PH(2)Me(2))] (3) and [(η(7)-C(7)H(7))Zr(η(5)-C(4)PPhHMe(2))] (4). The presence of Lewis basic phosphorus atoms and Lewis acidic zirconium atoms allows ambiphilic behaviour to be observed, and X-ray diffraction analysis reveals dimeric arrangements for 2 and 3 with long intermolecular Zr-P bonds, whereas 4 remains monomeric in the solid state. DFT calculations indicate that the metal-phosphorus interaction is weak, and accordingly, complexes 2-4 act as monodentate ligands upon reaction with [W(CO)(5)(thf)]. The resulting complexes [W(CO)(5)(L)] 5-7 (L=2-4) were studied by IR spectroscopy and compared with the [W(CO)(5) ] complex 9, containing the phosphane-functionalised trozircene [(η(7)-C(7)H(7))Zr(η(5)-C(5)H(4)PPh(2))] (8). They all show a close resemblance to simple phosphanes, such as PMe(3) , although molecular orbital analysis of 2 reveals that the free electron pair in the phosphatrozircenes is not the HOMO. Four equivalents of 2 can replace 1,4-cyclooctadiene (COD) in [Ni(cod)(2)] to form the homoleptic, distorted tetrahedral complex [Ni{2}(4)] (10). Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Capacci, Chiara; Ciabatti, Iacopo; Femoni, Cristina; Iapalucci, Maria Carmela; Funaioli, Tiziana; Zacchini, Stefano; Zanotti, Valerio
2018-02-05
The reaction of [NEt 4 ] 2 [Ni 6 (CO) 12 ] in thf with 0.5 equiv of PCl 3 affords the monophosphide [Ni 11 P(CO) 18 ] 3- that in turn further reacts with PCl 3 resulting in the tetra-phosphide carbonyl cluster [HNi 31 P 4 (CO) 39 ] 5- . Alternatively, the latter can be obtained from the reaction of [NEt 4 ] 2 [Ni 6 (CO) 12 ] in thf with 0.8-0.9 equiv of PCl 3 . The [HNi 31 P 4 (CO) 39 ] 5- penta-anion is reversibly protonated by strong acids leading to the [H 2 Ni 31 P 4 (CO) 39 ] 4- tetra-anion, whereas deprotonation affords the [Ni 31 P 4 (CO) 39 ] 6- hexa-anion. The latter is reduced with Na/naphthalene yielding the [Ni 31 P 4 (CO) 39 ] 7- hepta-anion. In order to shed light on the polyhydride nature and redox behavior of these clusters, electrochemical and spectroelectrochemical studies were carried out on [Ni 11 P(CO) 18 ] 3- , [HNi 31 P 4 (CO) 39 ] 5- , and [H 2 Ni 31 P 4 (CO) 39 ] 4- . The reversible formation of the stable [Ni 11 P(CO) 18 ] 4- tetra-anion is demonstrated through the spectroelectrochemical investigation of [Ni 11 P(CO) 18 ] 3- . The redox changes of [HNi 31 P 4 (CO) 39 ] 5- show features of chemical reversibility and the vibrational spectra in the ν CO region of the nine redox states of the cluster [HNi 31 P 4 (CO) 39 ] n- (n = 3-11) are reported. The spectroelectrochemical investigation of [H 2 Ni 31 P 4 (CO) 39 ] 4- revealed the presence of three chemically reversible reduction processes, and the IR spectra of [H 2 Ni 31 P 4 (CO) 39 ] n- (n = 4-7) have been recorded. The different spectroelectrochemical behavior of [HNi 31 P 4 (CO) 39 ] 5- and [H 2 Ni 31 P 4 (CO) 39 ] 4- support their formulations as polyhydrides. Unfortunately, all the attempts to directly confirm their poly hydrido nature by 1 H NMR spectroscopy failed, as previously found for related large metal carbonyl clusters. Thus, the presence and number of hydride ligands have been based on the observed protonation/deprotonation reactions and the spectroelectrochemical
Preparation for gluing of Carbon prototype MAB at INEGI, Porto
Miguel Moreira, Porto, INEGI
2001-01-01
MAB's will assure the alignment of the CMS detector. It is equipped with muon cameras, measuring the position of the barrel muon stations and at the same time linking via the link elements, connecting the barrel muon detectors with the Tracker. In addition there is a connection with the endcap. More details can be found on the muon/alignment homepage on the web
Zhou, Hua; Xie, Jing; Mai, Manfang; Wang, Jing; Shen, Xiangqian; Wang, Shuying; Zhang, Lihua; Kisslinger, Kim; Wang, Hui-Qiong; Zhang, Jinxing; Li, Yu; Deng, Junhong; Ke, Shanming; Zeng, Xierong
2018-05-09
Transparent flexible electrodes are in ever-growing demand for modern stretchable optoelectronic devices, such as display technologies, solar cells, and smart windows. Such sandwich-film-electrodes deposited on polymer substrates are unattainable because of the low quality of the films, inducing a relatively large optical loss and resistivity as well as a difficulty in elucidating the interference behavior of light. In this article, we report a high-quality AZO/Au/AZO sandwich film with excellent optoelectronic performance, e.g., an average transmittance of about 81.7% (including the substrate contribution) over the visible range, a sheet resistance of 5 Ω/sq, and a figure-of-merit (FoM) factor of ∼55.1. These values are well ahead of those previously reported for sandwich-film-electrodes. Additionally, the interference behaviors of light modulated by the coat and metal layers have been explored with the employment of transmittance spectra and numerical simulations. In particular, a heater device based on an AZO/Au/AZO sandwich film exhibits high performance such as short response time (∼5 s) and uniform temperature field. This work provides a deep insight into the improvement of the film quality of the sandwich electrodes and the design of high-performance transparent flexible devices by the application of a flexible substrate with an atomically smooth surface.
Directory of Open Access Journals (Sweden)
Concepción López
2014-11-01
Full Text Available The study of the reactivity of the enantiopure ferrocenyl Schiff base (SC-[FcCH=N–CH(Me(C6H5] (1 (Fc = (η5-C5H5Fe(η5-C5H4 with cis-[PtCl2(dmso2] under different experimental conditions is reported. Four different types of chiral Pt(II have been isolated and characterized. One of them is the enantiomerically pure trans-(SC-[Pt{κ1-N[FcCH=N–CH(Me(C6H5]}Cl2(dmso] (2a in which the imine acts as a neutral N-donor ligand; while the other three are the cycloplatinated complexes: [Pt{κ2-C,N [(C6H4–N=CHFc]}Cl(dmso] (7a and the two diastereomers {(Sp,SC and (Rp,SC} of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}]Fe(η5-C5H5}Cl(dmso] (8a and 9a, respectively. Isomers 7a-9a, differ in the nature of the metallated carbon atom [CPh (in 7a or CFc (in 8a and 9a] or the planar chirality of the 1,2-disubstituted ferrocenyl unit (8a and 9a. Reactions of 7a–9a with PPh3 gave [Pt{κ2-C,N[(C6H4–N=CHFc]}Cl(PPh3] (in 7b and the diastereomers (Sp,SC and (Rp,SC of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}] Fe(η5-C5H5}Cl(PPh3] (8b and 9b, respectively. Comparative studies of the electrochemical properties and cytotoxic activities on MCF7 and MDA-MB231 breast cancer cell lines of 2a and cycloplatinated complexes 7b-9b are also reported. Theoretical studies based on DFT calculations have also been carried out in order to rationalize the results obtained from the cycloplatination of 1, the stability of the Pt(II complexes and their electrochemical properties.
Yu, Chuanfei; Gao, Kai; Zhu, Lei; Wang, Wenbo; Wang, Lan; Zhang, Feng; Liu, Chunyu; Li, Meng; Wormald, Mark R.; Rudd, Pauline M.; Wang, Junzhi
2016-01-01
Two non-human glycan epitopes, galactose-Į-1,3-galactose (Į-gal) and Neu5Gc-Į-2-6-galactose (Neu5Gc) have been shown to be antigenic when attached to Fab oligosaccharides of monoclonal antibodies (mAbs) , while Į-gal attached to Fc glycans were not. However, the antigenicity of Neu5Gc on the Fc glycans remains unclear in the context that most mAbs carry only Fc glycans. After studying two clinical mAbs carrying significant amounts of Fc Neu5Gc, we show that their binding activity with anti-Ne...
Pengaruh perlakuan serat tapis kelapa terhadap kekuatan lentur skin komposit sandwich
Directory of Open Access Journals (Sweden)
I Made Astika
2018-01-01
Full Text Available Abstrak Penggunaan serat alam sebagai penguat komposit semakin berkembang. Indonesia sebagai negara beriklim tropis menghasilkan berbagai jenis serat alami seperti rami, abaca, agave, serat sabut kelapa dan serat tapis kelapa. Penelitian ini bertujuan untuk menyelidiki pengaruh perlakuan alkali serat (NaOH 5% terhadap kekuatan lentur komposit sandwich serat tapis kelapa bermatrik polyester dengan core kayu albasia Bahan penelitian adalah serat tapis kelapa dengan panjang 15 mm, resin unsaturated polyester 157 BQTN, kayu albasia dan NaOH. Hardener yang digunakan adalah MEKPO dengan konsentrasi 1%. Serat tapis kelapa yang digunakan terdiri dari serat tanpa perlakuan dan dengan perlakuan alkali 2 jam. Komposit sandwich tersusun atas dua skin dengan core ditengahnya dan dibuat dengan metode cetak tekan hidrolis. Lamina komposit sebagai skin terbuat dari serat tapis kelapa-polyester dengan fraksi volume serat 30%. Spesimen dan prosedur pengujian lentur mengacu pada standar ASTM C 393. Penampang patahan dilakukan foto makro untuk mengidentifikasi pola kegagalannya.Hasil penelitian menunjukkan serat yang mendapatkan perlakuan alkali 2 jam NaOH menghasilkan kekuatan lentur yang lebih tinggi. Hal ini disebabkan karena perlakuan alkali pada serat tapis kelapa dapat membersihkan lapisan lilin (lignin dan kotoran pada permukaan serat sehingga menghasilkan mechanical interlocking yang lebih baik antara serat dengan matrik poliester. Dengan ikatan yang lebih baik maka komposit tersebut akan mampu menahan beban lentur yang lebih tinggi. Kata kunci: komposit sandwich, serat tapis kelapa, perlakuan NaOH, kekuatan lentur Abstract The use of natural fibers as reinforcement composites is growing. Indonesia as a tropical country produces various types of natural fibers like coconut filter fiber. The purpose of this study is to investigate the effect of alkali treatment of the fiber (5% NaOH. The research material is coconut filter fiber, 157 BQTN unsaturated
Mechanical evaluation with fe analysis of sandwich panels for wind turbine blade
Energy Technology Data Exchange (ETDEWEB)
Yasaswi, M.; Naveen, P.N.E.; Prasad, R.V. [GIET. Dept. of Mechanical Engineering, Rajahmundry (India)
2012-07-01
Sandwich panels are notable for their structural efficiency and are used as load bearing components in various branches of engineering, especially in aerospace and marine industries. The objective of the present work is to perform computer-aided analysis on sandwich panels. The analysis of sandwich panel with truss core are compared with other four types of sandwich panel with continuous corrugated core, top hat core, zed core and channel core. The basic reason to use sandwich structure is to save weight, however smooth skins and excellent fatigue resistance are also attributes of a sandwich structure. A sandwich is comprised of two layered composite materials formed by bonding two or more thin facings or face sheets to relatively thick core materials. In this type of construction the facings resist nearly all of the in-plane loads and out-of-plane bending moments. The thin facings provide nearly all of the bending stiffness because they are generally of a much higher modulus material is located at a greatest distance from the neutral axis of the component. The basic concept of sandwich panel is that the facings carry the bending loads and the core carries the shear loads. The main function of the core material is to distribute local loads and stresses over large areas. From all this analysis it is concluded that the truss core Sandwich panels can be used in wind turbine blade design. (Author)
Toward Development of an Oral, Plant-Based Vaccine Against Escherichia coli O157:H7
2004-01-01
described above), and the toxoid protein was visualized by Western blot analysis with rabbit anti- Stx2 antibodies (prepared by Ms. Edda Twiddy). Stx2...Ms. Edda Twiddy. (Perera et al., 1988). The 11E10 MAb was linked to AminoLink plus resin (Pierce, Rockford, IL) by the pH 10 coupling method...and approximate concentration of the toxoid (Stx2 polyclonal antibody prepared in rabbits by Ms Edda Twiddy). The isolated toxoid was then tested in
Energy Technology Data Exchange (ETDEWEB)
Morales-Morales, Alejo; Duconge, Jorge; Caballero-Torres, Idania; Nunez-Gandolff, Gilda; Fernandez, Eduardo; Iznaga-Escobar, Normando E-mail: normando@ict.cim.sld.cu
1999-04-01
The anti-human epidermal growth factor receptor (EGF-R) humanized monoclonal antibody (MAb) h-R3 is an (IgG{sub 1}), which binds to an extracellular domain of EGF-R. It was used to evaluate the biodistribution on nude mice xenografted with H-125 human lung adenocarcinoma cell line. Results were compared with its murine version of the MAb ior-egf/r3. Twenty-one athymic female 4NMRI nu/nu mice were injected intraperitoneally with 10 {mu}g/100 {mu}Ci of {sup 99m}Tc-labeled MAbs. Immunoreactivity of {sup 99m}Tc-labeled MAbs were measured by enzyme-linked immunosorbent assay (ELISA) on H-125 cell line and the immunoreactive fractions was determined by the Lindmo method. Among all organs, significant accumulation was found in serum (27.05 {+-} 2.08 %ID/g) and tumor (3.903 {+-} 0.89 %ID/g) at 4 h after injection. These values decreased to 5.03 {+-} 0.50 %ID/g and 2.19 {+-} 0.56 %ID/g for serum and tumor, respectively. The immunoreactive fraction was found to be 0.70, with a correlation coefficient r=0.9984. With the good biodistribution and tumor uptake of the {sup 99m}Tc-labeled humanized antibody h-R3, a phase I diagnostic clinical trial of tumor with epithelial origin should be pursued.
Cichonska, Anna; Rousu, Juho; Marttinen, Pekka; Kangas, Antti J; Soininen, Pasi; Lehtimäki, Terho; Raitakari, Olli T; Järvelin, Marjo-Riitta; Salomaa, Veikko; Ala-Korpela, Mika; Ripatti, Samuli; Pirinen, Matti
2016-07-01
A dominant approach to genetic association studies is to perform univariate tests between genotype-phenotype pairs. However, analyzing related traits together increases statistical power, and certain complex associations become detectable only when several variants are tested jointly. Currently, modest sample sizes of individual cohorts, and restricted availability of individual-level genotype-phenotype data across the cohorts limit conducting multivariate tests. We introduce metaCCA, a computational framework for summary statistics-based analysis of a single or multiple studies that allows multivariate representation of both genotype and phenotype. It extends the statistical technique of canonical correlation analysis to the setting where original individual-level records are not available, and employs a covariance shrinkage algorithm to achieve robustness.Multivariate meta-analysis of two Finnish studies of nuclear magnetic resonance metabolomics by metaCCA, using standard univariate output from the program SNPTEST, shows an excellent agreement with the pooled individual-level analysis of original data. Motivated by strong multivariate signals in the lipid genes tested, we envision that multivariate association testing using metaCCA has a great potential to provide novel insights from already published summary statistics from high-throughput phenotyping technologies. Code is available at https://github.com/aalto-ics-kepaco anna.cichonska@helsinki.fi or matti.pirinen@helsinki.fi Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.
Jambeck, Jenna R; Townsend, Timothy G; Solo-Gabriele, Helena M
2008-08-01
Although phased out of many residential uses in the United States, the disposal of CCA-treated wood remains a concern because significant quantities have yet to be taken out of service, and it is commonly disposed in landfills. Catastrophic events have also led to the concentrated disposal of CCA-treated wood, often in unlined landfills. The goal of this research was to simulate the complex chemical and biological activity of a construction and demolition (C&D) debris landfill containing a realistic quantity of CCA-treated wood (10% by mass), produce leachate, and then evaluate the arsenic, copper, and chromium concentrations in the leachate as an indication of what may occur in a landfill setting. Copper concentrations were not significantly elevated in the control or experimental simulated landfill setting (alpha = 0.05). However, the concentrations of arsenic and chromium were significantly higher in the experimental simulated landfill leachate compared to the control simulated landfill leachate (alpha = 0.05, p debris can impact leachate quality which, in turn could affect leachate management practices or aquifers below unlined landfills.
Adhesion aspects of polyurethane foam sandwich panels.
Ng, Simon L.
2016-01-01
Sandwich panels, polyurethane foam sandwiched between two sheets of steel, form the walls and roofs in the construction of buildings. ArcelorMittal is a manufacturer of the steel as well as these finished panels. For this project they combined with a supplier of the polyurethane foams, Huntsman Polyurethanes, to joint-fund a research project investigating the fundamental mechanisms of adhesion, as well as the causes of failures in the product which manifests primarily in two different ways...
Behavior of sandwich panels in a fire
Chelekova, Eugenia
2018-03-01
For the last decades there emerged a vast number of buildings and structures erected with the use of sandwich panels. The field of application for this construction material is manifold, especially in the construction of fire and explosion hazardous buildings. In advanced evacu-ation time calculation methods the coefficient of heat losses is defined with dire regard to fire load features, but without account to thermal and physical characteristics of building envelopes, or, to be exact, it is defined for brick and concrete walls with gross heat capacity. That is why the application of the heat loss coefficient expression obtained for buildings of sandwich panels is impossible because of different heat capacity of these panels from the heat capacities of brick and concrete building envelopes. The article conducts an analysis and calculation of the heal loss coefficient for buildings and structures of three layer sandwich panels as building envelopes.
Sandwich mapping of schistosomiasis risk in Anhui Province, China.
Hu, Yi; Bergquist, Robert; Lynn, Henry; Gao, Fenghua; Wang, Qizhi; Zhang, Shiqing; Li, Rui; Sun, Liqian; Xia, Congcong; Xiong, Chenglong; Zhang, Zhijie; Jiang, Qingwu
2015-06-03
Schistosomiasis mapping using data obtained from parasitological surveys is frequently used in planning and evaluation of disease control strategies. The available geostatistical approaches are, however, subject to the assumption of stationarity, a stochastic process whose joint probability distribution does not change when shifted in time. As this is impractical for large areas, we introduce here the sandwich method, the basic idea of which is to divide the study area (with its attributes) into homogeneous subareas and estimate the values for the reporting units using spatial stratified sampling. The sandwich method was applied to map the county-level prevalence of schistosomiasis japonica in Anhui Province, China based on parasitological data collected from sample villages and land use data. We first mapped the county-level prevalence using the sandwich method, then compared our findings with block Kriging. The sandwich estimates ranged from 0.17 to 0.21% with a lower level of uncertainty, while the Kriging estimates varied from 0 to 0.97% with a higher level of uncertainty, indicating that the former is more smoothed and stable compared to latter. Aside from various forms of reporting units, the sandwich method has the particular merit of simple model assumption coupled with full utilization of sample data. It performs well when a disease presents stratified heterogeneity over space.
DEFF Research Database (Denmark)
Johnsen, C R; Abrahamsen, L; Stahl Skov, P
1991-01-01
The aim was to compare IgE and IgG4 RAST-inhibition assay (RI), monoclonal antibody ELISA (Mab-ELISA), counter current immuno electrophoresis (CCIE) and histamine release from basophil leukocytes (HR) for allergen quantification with special reference to aeroallergen detection. As components......-U/ml) than IgE-RI (2*10(3) SQ-U/ml). The ranges of allergen detection limits for the Mab-ELISA were equal for cat and Derm. pter. (10-10(2) SQ-U/ml). The range of allergen detection limits for CCIE, assaying dog were 10(4)-10(5) SQ-U/ml. The ranges of allergen detection limits for HR were equal for cat...
Shi, Haitao; Wei, Yunxie; He, Chaozu
2016-03-01
Melatonin (N-acetyl-5-methoxytryptamine) is an important regulator of circadian rhythms and immunity in animals. However, the diurnal changes of endogenous melatonin and melatonin-mediated diurnal change of downstream responses remain unclear in Arabidopsis. Using the publicly available microarray data, we found that the transcript levels of two melatonin synthesis genes (serotonin N-acetyltransferase (SNAT) and caffeate O-methyltransferase (COMT)) and endogenous melatonin level were regulated by diurnal cycles, with different magnitudes of change. Moreover, the transcripts of C-repeat-binding factors (CBFs)/Drought response element Binding 1 factors (DREB1s) were co-regulated by exogenous melatonin and diurnal changes, indicating the possible correlation among clock, endogenous melatonin level and AtCBFs expressions. Interestingly, diurnal change of plant immunity against Pst DC3000 and CIRCADIANCLOCK ASSOCIATED 1 (CCA1) expression were largely lost in AtCBFs knockdown line-amiR-1. Taken together, this study identifies the molecular pathway underlying the diurnal changes of immunity in Arabidopsis. Notably, the diurnal changes of endogenous melatonin may regulate corresponding changes of AtCBF/DREB1s expression and their underlying diurnal cycle of plant immunity and AtCCA1. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
X-ray and Hydrogen-bonding Properties of 1-((1H-benzotriazol-1-ylmethylnaphthalen-2-ol
Directory of Open Access Journals (Sweden)
Jaime Ríos-Motta
2009-03-01
Full Text Available The solid state structure of 1-((1H-benzotriazol-1-ylmethylnaphthalen-2-ol, C17H13N3O, shows that this Mannich base crystallizes forming intermolecular N···HO hydrogen bonds, rather than intramolecular ones. Factors contributing to this choice of hydrogen-bonding mode are discussed. The compound crystallizes in the monoclinic system, P21/c space group, with lattice constants: a = 11.7934(9 Å, b = 14.3002(14 Å, c = 8.4444(8 Å, β = 106.243(5 deg, V = 1367.3(2 Å3, Z = 4, F(000 = 576, R1 = 6.96%, wR2 = 11.4%.
Directory of Open Access Journals (Sweden)
Paulo Marcos Zech Coelho
2016-06-01
Full Text Available Accurate diagnostic techniques for schistosomiasis are essential for prevalence determination and identification of positive patients. A point-of-care test for detecting schistosome circulating cathodic antigen (POC-CCA has been evaluated for its accuracy in different endemic regions. This reagent strip/dipstick based assay has showed high sensitivity for individuals with high or moderate worm burden, but the interpretation of light infections is less clear, especially for trace readings.We introduced a urine lyophilization step to the POC-CCA assay to improve its sensitivity and clarify the interpretation of traces. We evaluated POC-CCA sensitivity and specificity within individuals with low parasite burdens in a Brazilian endemic area where a high number of traces were detected. Patients that were positive for other helminths were also evaluated for cross reactions. In all cases, a combined parasitological diagnosis using Kato-Katz (24 slides and Saline Gradient (1 g of feces were used as reference. At baseline, diagnosis by POC-CCA (1-2 cassettes showed 6% sensitivity, inaccurately predicting a low prevalence of Schistosoma mansoni infections (2 POC-CCA positives/32 egg positives. After urine lyophilization, the sensitivity was increased significantly (p < 0.05. Prevalence rates changed from 2% to 32% (27 POC-CCA positives/32 egg positives, equivalent to parasitological techniques. Most of the trace readings changed to positive after lyophilization while some negatives turned into traces. Cross reaction analysis confirmed the specificity of POC-CCA.Trace readings cannot be primarily defined as positive or negative cases. It is critical to verify case-by-case by concentrating urine 10 fold by lyophilization for the diagnosis. Following lyophilization, persistent trace readings should be read as negatives. No trained technician is needed and cost is restricted to the cost of a lyophilizer and the electricity to run it.
International Nuclear Information System (INIS)
Morales, Alejo A. Morales; Nunez-Gandolff, Gilda; Perez, Niuvis Perez; Veliz, Belkis Chico; Caballero-Torres, Idania; Duconge, Jorge; Fernandez, Eduardo; Crespo, Francisco Zayas; Veloso, Ana; Iznaga-Escobar, Normando
1999-01-01
Monoclonal antibodies (MAbs) have been useful for immunoscintigraphic applications in clinical diagnosis since they were introduced in nuclear medicine practice. The MAb ior egf/r3 developed at the Center of Molecular Immunology (Havana, Cuba) is a murine antibody that recognizes the human epidermal growth factor receptor (EGF-R) and has been used widely in the radioimmunodiagnosis of tumors of epithelial origin. Based on the direct Schwarz method, the present report describes the preparation of a freeze-dried formulation for radiolabeling the MAb ior egf/r3 with 99m Tc for immunoscintigraphic applications. Radiolabeling efficiency, effects on immunoreactivity, biodistribution, pharmacokinetic, and stability of the formulation are reported. The study demonstrated that the freeze-dried formulation can be labeled with 99m Tc at high yield. The resulting 99m Tc-labeled ior egf/r3 MAb can be used to visualize in vivo human tumors of epithelial origin by immunoscintigraphy studies. The kit does not need any other addition or purification at the time of tagging other than the requisite amount of pertechnetate (40-50 mCi). Because the contents of the kit are lyophilized, no special storage or transportation is required
CCA 3101/4101 Environmental Humanities: The History of a Unit through an Ecopedagogical Lens
Ryan, John Charles
2012-01-01
In 2011 the author taught, for the first time, the well-established unit CCA3101/4101 Environmental Humanities in the School of Communications and Arts at ECU (Edith Cowan University) in Western Australia. The unit has a 20-year history through associate professor Rod Giblett and parallels the development of the environmental humanities as a field…
International Nuclear Information System (INIS)
Saeed, Muhammad; Tewson, Timothy J.; Erdahl, Colbin E.; Kohen, Amnon
2012-01-01
Introduction: Thymidylate synthase and folate receptors are well-developed targets of cancer therapy. Discovery of a simple and fast method for the conversion of 11 CH 3 Ito[ 11 C]-formaldehyde ( 11 CH 2 O) encouraged us to label the co-factor of this enzyme. Preliminary studies conducted on cell lines have demonstrated a preferential uptake of [11- 14 C]-(R)-N 5 ,N 10 -methylene-5,6,7,8-tetrahydrofolate ( 14 CH 2 H 4 folate) by cancerous cell vs. normal cells from the same organ (Saeed M., Sheff D. and Kohen A. Novel positron emission tomography tracer distinguishes normal from cancerous cells. J Biol Chem 2011;286:33872–33878), pointing out 11 CH 2 H 4 folate as a positron emission tomography (PET) tracer for cancer imaging. Herein we report the synthesis of 11 CH 2 H 4 folate, which may serve as a potential PET tracer. Methods: In a remotely controlled module, methyl iodide ( 11 CH 3 I) was bubbled into a reaction vial containing trimethylamine N-oxide in N,N-Dimethylformamide (DMF) and heated to 70°C for 2 min. Formaldehyde ( 11 CH 2 O) formed after the completion of reaction was then mixed with a solution of freshly prepared tetrahydrofolate (H 4 folate) by using a fast chemoenzymatic approach to accomplish synthesis of 11 CH 2 H 4 folate. Purification of the product was carried out by loading the crude reaction mixture on a SAX cartridge, washing with water to remove unbound impurities and finally eluting with a saline solution. Results: The synthesis and purification of 11 CH 2 H 4 folate were completed within 5 min. High-performance liquid chromatography analysis of the product after SAX purification indicates that more than 90% of the radioactivity that was retained on the SAX cartridge was in 11 CH 2 H 4 folate, with minor ( 11 CH 2 O. Conclusion: We present a fast (∼5 min) synthesis and purification of 11 CH 2 H 4 folate as a potential PET tracer. The final product is received in physiologically compatible buffer (100 mM sodium phosphate, pH 7
van As, A B; Navsaria, P; Numanoglu, A; McCulloch, M
2007-01-01
South Africa has very high levels of accidental trauma as well as interpersonal violence. There are more admissions for trauma in South Africa than for any other disease; therefore it can be regarded as the Number 1 disease in the country. Complex abdominal injuries are common, requiring specific management techniques. The aim is to document our experience with the Modified Sandwich Vacuum Pack technique for temporary closure of abdominal wounds. After providing a short historical overview, we will demonstrate the technique which we carefully adapted over the last decade to the present Modified Sandwich Vacuum Pack technique. In the Last 5 years we utilized our Modified Sandwich Vacuum Pack technique 153 times in 69 patients. Five (5) patients were under the age of 12 years. In the patient group over 12 years the most common indication for using our technique were penetrating injuries (40), abdominal sepsis (28), visceral edema (10), abdominal compartment syndrome (9), abdominal packs (6),Abdominal wall defects (2). In the group under 12-years the 2 children had liver ruptures (posttraumatic) and 3 liver transplantations. The average cost for the materials used with our technique was ZAR 96. (10 Euro and 41 cents). In our experience the Modified Sandwich Vacuum Pack technique is an effective, cheap methodology to deal with open abdomens in the African setting.A drawback may be the technical expertise required, particular in centers dealing with low numbers of complex abdominal trauma.
Directory of Open Access Journals (Sweden)
Sergi Portolés
2010-11-01
Full Text Available Circadian rhythms are daily biological oscillations driven by an endogenous mechanism known as circadian clock. The protein kinase CK2 is one of the few clock components that is evolutionary conserved among different taxonomic groups. CK2 regulates the stability and nuclear localization of essential clock proteins in mammals, fungi, and insects. Two CK2 regulatory subunits, CKB3 and CKB4, have been also linked with the Arabidopsis thaliana circadian system. However, the biological relevance and the precise mechanisms of CK2 function within the plant clockwork are not known. By using ChIP and Double-ChIP experiments together with in vivo luminescence assays at different temperatures, we were able to identify a temperature-dependent function for CK2 modulating circadian period length. Our study uncovers a previously unpredicted mechanism for CK2 antagonizing the key clock regulator CIRCADIAN CLOCK-ASSOCIATED 1 (CCA1. CK2 activity does not alter protein accumulation or subcellular localization but interferes with CCA1 binding affinity to the promoters of the oscillator genes. High temperatures enhance the CCA1 binding activity, which is precisely counterbalanced by the CK2 opposing function. Altering this balance by over-expression, mutation, or pharmacological inhibition affects the temperature compensation profile, providing a mechanism by which plants regulate circadian period at changing temperatures. Therefore, our study establishes a new model demonstrating that two opposing and temperature-dependent activities (CCA1-CK2 are essential for clock temperature compensation in Arabidopsis.
Analysis of syntactic foam – GFRP sandwich composites for flexural loads
Paul, Daniel; Velmurugan, R.; Jayaganthan, R.; Gupta, N. K.; Manzhirov, A. V.
2018-04-01
The use of glass microballoon (GMB) — epoxy syntactic foams as a sandwich core material is studied. The skins and foam core are fabricated and joined instantaneously unlike the procedures followed in the previous studies. Each successive layer of the sandwich is fabricated when the previous layer is in a semi-gelled state. These sandwich samples are characterized for their properties under flexural loading. The failure modes and mechanical properties are carefully investigated. The change in fabrication technique results in a significant increase in the load bearing pattern of the sandwich. In earlier studies, debonding was found to occur prematurely since the bonding between the skins and core is the weakest plane. Using the current technique, core cracking occurs first, followed by skin fiber breaking and debonding happens at the end. This ensures that the load carrying phase of the structure is extended considerably. The sandwich is also analytically studied using Reddy’s higher order shear deformation theory. A higher order theory is selected as the sandwich can no longer be considered as a thin beam and thus shear effects also need to be considered in addition to bending effects.
Directory of Open Access Journals (Sweden)
Qun Qian
2008-07-01
Full Text Available In the title compound, C29H27Cl2N5O2·C4H8O, the polycyclic system is composed of three parts: one central pyridine ring substituted by two functionalized pyrazoline rings. The dihedral angles between the central pyridine plane and pyrazoline planes are 5.11 (1 and 13.99 (1°, whereas the dihedral angles between each chlorophenyl plane and the attached pyrazoline planes are 88.65 (1 and 83.87 (1°. Molecules are linked by intermolecular C—H...O hydrogen bonds, forming a three-dimensional network.
7-Chloro-11a-phenyl-2,3,5,10,11,11a-hexahydro-1H-pyrrolo[2,1-c][1,4]benzodiazepine-5,11-dione
Directory of Open Access Journals (Sweden)
Vahan Martirosyan
2008-03-01
Full Text Available The title compound, C18H15ClN2O2, is a potential human immunodeficiency virus type-1 (HIV-1 non-nucleoside reverse transcriptase inhibitor. The pyrrolidine ring adopts an envelope and the diazepine ring a boat conformation. In the crystal structure, two isomers (R and S form centrosymmetric dimers via N—H...O hydrogen bonds.
Wu, Ying; Liu, Zheng; Zhong, Xiongwu; Cheng, Xiaolong; Fan, Zhuangjun; Yu, Yan
2018-03-01
The red P anode for sodium ion batteries has attracted great attention recently due to the high theoretical capacity, but the poor intrinsic electronic conductivity and large volume expansion restrain its widespread applications. Herein, the red P is successfully encapsulated into the cube shaped sandwich-like interconnected porous carbon building (denoted as P@C-GO/MOF-5) via the vaporization-condensation method. Superior cycling stability (high capacity retention of about 93% at 2 A g -1 after 100 cycles) and excellent rate performance (502 mAh g -1 at 10 A g -1 ) can be obtained for the P@C-GO/MOF-5 electrode. The superior electrochemical performance can be ascribed to the successful incorporation of red P into the unique carbon matrix with large surface area and pore volume, interconnected porous structure, excellent electronic conductivity and superior structural stability. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Elizabeth N. De Gaspari
Full Text Available Determining the profile of antigen expression among meningococci is important for epidemiologic surveillance and vaccine development. To this end, two new mouse monoclonal antibodies (MAbs have been derived against Neisseria meningitidis proteins (class 5. The MAbs were reactive against outer membrane antigens and were bactericidal. Selected anti-class 5 MAbs [(5.1-3E6-2; (5.3-3BH4-C7; (5.4-1BG11-C7; (5.5-3DH-F5G9 also 5F1F4-T3(5.c], and the two new monoclonal antibodies C14F10Br2 (5.8 and 7F11B5Br3 (5.9, were then tested against different meningococcal strains, (63 strains of serogroup A, 60 strains of serogroup C (from 1972 to 1974; and 136 strains of serogroup B (from 1992 meningococci. Our results demonstrated that the expression of class 5 proteins in the N. meningitidis B Brazilian strains studied is highly heterogeneous. The serotypes and subtypes of B:4:P1.15, B:4:P1.9, B:4:P1.7, B:4:P1.3, B:4:P1.14, B:4:P1.16, B:4:NT, and B:NT:NT were detected in N. meningitidis B serogroups.The strains C:2a:P1.2 and A:4.21:P1.9 were dominant in the C and A serogroups, respectively. Serogroup B organisms expressed the class 5 epitopes 5.4 (18%, 5.5 (22%, 5.8 (3.6%, 5.9 (8.0% and 5c (38%. Serogroup C expressed class 5 epitopes 5.1 (81%, 5.4 (35%, 5.5 (33% and 5.9 (5.0%; and serogroup A showed reactivity directed at the class 5 protein 5c (47%; and reactivity was present with the new monoclonal antibody, 5.9 (5.5%. We conclude that the two new MAbs are useful in detecting important group B, class 5 antigens, and that a broad selection of serogroup B, class 5 proteins would be required for an effective vaccine based on the class 5 proteins.
Energy Technology Data Exchange (ETDEWEB)
Cooper, P.; Albright, M.; Srinivasan, U.; Ung, A. [New Brunswick Univ., Fredericton, NB (Canada). Wood Science and Technology Centre
2002-07-01
The application of chromated copper arsenate (CCA) treatment and fixation and drying under the conditions of the study to large red pine poles left for an air seasoning period of 10 months in Quebec, Canada progressively reduced the number of micro-organisms present. A large number of microfungi isolations were effected before the treatment from the sapwood and heartwood of all poles and wood decay fungi on 8 selected poles from the 20 test poles. They originated from the sapwood zone. A reduction of approximately 50 per cent in the number of microfungi isolated from the sapwood was noted after the CCA treatment. In the case of 9 of 30 poles, basidiomycetes were isolated after treatment primarily from the untreated heartwood. There were a few instances where basidiomycetes were isolated from unpenetrated sapwood (wet pockets). Temperatures of 55 to 60 degrees Celsius were achieved under moderate temperature fixation schedules (20 hours) for approximately 5 hours at full sapwood depth. Only by the end of the schedule was a temperature of 55 degrees celsius achieved at the centre of the poles. Most of the microfungi were eliminated by this temperature regime. Trichoderma was eliminated, and only one isolation of basidiomycetes was left from the heartwood of one pole. Temperatures of 55 to 60 degrees Celsius were achieved in the wood core for 9 to 10 days during kiln drying. No basidiomycete isolations remained after this exposure. In several of the poles, there was evidence of Paecilomyces variotii, a thermo-tolerant species and a number of species of Penicillium moulds. It was concluded that there was a negligible probability of decay fungi surviving the sequence of processes as described, given the effectiveness of the fixation exposure and the higher wood temperatures sustained for longer periods. 16 refs., 5 tabs., 2 figs.
Regressional modeling of electrodialytic removal of Cu, Cr and As from CCA treated timber waste
DEFF Research Database (Denmark)
Moreira, E.E.; Ribeiro, Alexandra B.; Mateus, Eduardo
2005-01-01
) removal of Cu, Cr and As from CCA treated timber waste. The method uses a low-level direct current as the cleaning agent, combining the electrokinetic movement of ions in the matrix with the principle of electrodialysis. The technique was tested in eight experiments using a laboratory cell on sawdust...
{1-[(3,5-Dimethyl-4H-1,2,4-triazol-4-ylimino]ethyl}ferrocene
Directory of Open Access Journals (Sweden)
Mao-Ping Song
2008-10-01
Full Text Available In the title compound, [Fe(C5H5(C11H13N4], the triazolyl and Cp ring form a dihedral angle of 76.6 (3°. In the crystal structure, there are both intra- and intermolecular C—H...π interactions, forming a one-dimensional chain structure along [010].
Directory of Open Access Journals (Sweden)
Wen-Tao Wang
2016-11-01
Full Text Available Abstract Background Long non-coding RNAs (lncRNAs are known to play important roles in different cell contexts, including cancers. However, little is known about lncRNAs in cholangiocarcinoma (CCA, a cholangiocyte malignancy with poor prognosis, associated with chronic inflammation and damage to the biliary epithelium. The aim of the study is to identify if any lncRNA might associate with inflammation or oxidative stress in CCA and regulate the disease progression. Methods In this study, RNA-seqs datasets were used to identify aberrantly expressed lncRNAs. Small interfering RNA and overexpressed plasmids were used to modulate the expression of lncRNAs, and luciferase target assay RNA immunoprecipitation (RIP was performed to explore the mechanism of miRNA-lncRNA sponging. Results We firstly analyzed five available RNA-seqs datasets to investigate aberrantly expressed lncRNAs which might associate with inflammation or oxidative stress. We identified that two lncRNAs, H19 and HULC, were differentially expressed among all the samples under the treatment of hypoxic or inflammatory factors, and they were shown to be stimulated by short-term oxidative stress responses to H2O2 and glucose oxidase in CCA cell lines. Further studies revealed that these two lncRNAs promoted cholangiocyte migration and invasion via the inflammation pathway. H19 and HULC functioned as competing endogenous RNAs (ceRNAs by sponging let-7a/let-7b and miR-372/miR-373, respectively, which activate pivotal inflammation cytokine IL-6 and chemokine receptor CXCR4. Conclusions Our study revealed that H19 and HULC, up-regulated by oxidative stress, regulate CCA cell migration and invasion by targeting IL-6 and CXCR4 via ceRNA patterns of sponging let-7a/let-7b and miR-372/miR-373, respectively. The results suggest that these lncRNAs might be the chief culprits of CCA pathogenesis and progression. The study provides new insight into the mechanism linking lncRNA function with CCA and
Apoptosis inhibitor 5 (API-5; AAC-11; FIF) is upregulated in human carcinomas in vivo
Czech Academy of Sciences Publication Activity Database
Kočí, Lenka; Chlebová, K.; Hýžďalová, Martina; Hofmanová, Jiřina; Jíra, M.; Kysela, P.; Kozubík, Alois; Kala, Z.; Krejčí, Pavel
2012-01-01
Roč. 3, č. 4 (2012), s. 913-916 ISSN 1792-1074 R&D Projects: GA ČR(CZ) GA305/09/1526; GA ČR(CZ) GD303/09/H048; GA ČR(CZ) GAP301/11/1730 Institutional research plan: CEZ:AV0Z50040702 Keywords : apoptosis inhibitor 5 * apoptosis * human carcinoma Subject RIV: BO - Biophysics Impact factor: 0.237, year: 2012
Elvington, Michelle; Huang, Yuxiang; Morgan, B. Paul; Qiao, Fei; van Rooijen, Nico; Atkinson, Carl
2012-01-01
Complement inhibitors expressed on tumor cells provide an evasion mechanism against mAb therapy and may modulate the development of an acquired antitumor immune response. Here we investigate a strategy to amplify mAb-targeted complement activation on a tumor cell, independent of a requirement to target and block complement inhibitor expression or function, which is difficult to achieve in vivo. We constructed a murine fusion protein, CR2Fc, and demonstrated that the protein targets to C3 activation products deposited on a tumor cell by a specific mAb, and amplifies mAb-dependent complement activation and tumor cell lysis in vitro. In syngeneic models of metastatic lymphoma (EL4) and melanoma (B16), CR2Fc significantly enhanced the outcome of mAb therapy. Subsequent studies using the EL4 model with various genetically modified mice and macrophage-depleted mice revealed that CR2Fc enhanced the therapeutic effect of mAb therapy via both macrophage-dependent FcγR-mediated antibody-dependent cellular cytotoxicity, and by direct complement-mediated lysis. Complement activation products can also modulate adaptive immunity, but we found no evidence that either mAb or CR2Fc treatment had any effect on an antitumor humoral or cellular immune response. CR2Fc represents a potential adjuvant treatment to increase the effectiveness of mAb therapy of cancer. PMID:22442351
Lefebvre, Anne-Laure; Le Moigne, Vincent; Bernut, Audrey; Veckerlé, Carole; Compain, Fabrice; Herrmann, Jean-Louis; Kremer, Laurent; Arthur, Michel; Mainardi, Jean-Luc
2017-04-01
Mycobacterium abscessus pulmonary infections are treated with a macrolide (clarithromycin or azithromycin), an aminoglycoside (amikacin), and a β-lactam (cefoxitin or imipenem). The triple combination is used without any β-lactamase inhibitor, even though M abscessus produces the broad-spectrum β-lactamase Bla Mab We determine whether inhibition of Bla Mab by avibactam improves the activity of imipenem against M. abscessus The bactericidal activity of drug combinations was assayed in broth and in human macrophages. The in vivo efficacy of the drugs was tested by monitoring the survival of infected zebrafish embryos. The level of Bla Mab production in broth and in macrophages was compared by quantitative reverse transcription-PCR and Western blotting. The triple combination of imipenem (8 or 32 μg/ml), amikacin (32 μg/ml), and avibactam (4 μg/ml) was bactericidal in broth (imipenem was used at 8 and 32 μg/ml, respectively. The triple combination achieved significant intracellular killing, with the bacterial survival rates being 54% and 7% with the low (8 μg/ml) and high (32 μg/ml) dosages of imipenem, respectively. In vivo inhibition of Bla Mab by avibactam improved the survival of zebrafish embryos treated with imipenem. Expression of the gene encoding Bla Mab was induced (20-fold) in the infected macrophages. Inhibition of Bla Mab by avibactam improved the efficacy of imipenem against M. abscessus in vitro , in macrophages, and in zebrafish embryos, indicating that this β-lactamase inhibitor should be clinically evaluated. The in vitro evaluation of imipenem may underestimate the impact of Bla Mab , since the production of the β-lactamase is inducible in macrophages. Copyright © 2017 American Society for Microbiology.
Sandwich mapping of schistosomiasis risk in Anhui Province, China
Directory of Open Access Journals (Sweden)
Yi Hu
2015-06-01
Full Text Available Schistosomiasis mapping using data obtained from parasitological surveys is frequently used in planning and evaluation of disease control strategies. The available geostatistical approaches are, however, subject to the assumption of stationarity, a stochastic process whose joint probability distribution does not change when shifted in time. As this is impractical for large areas, we introduce here the sandwich method, the basic idea of which is to divide the study area (with its attributes into homogeneous subareas and estimate the values for the reporting units using spatial stratified sampling. The sandwich method was applied to map the county-level prevalence of schistosomiasis japonica in Anhui Province, China based on parasitological data collected from sample villages and land use data. We first mapped the county-level prevalence using the sandwich method, then compared our findings with block Kriging. The sandwich estimates ranged from 0.17 to 0.21% with a lower level of uncertainty, while the Kriging estimates varied from 0 to 0.97% with a higher level of uncertainty, indicating that the former is more smoothed and stable compared to latter. Aside from various forms of reporting units, the sandwich method has the particular merit of simple model assumption coupled with full utilization of sample data. It performs well when a disease presents stratified heterogeneity over space.
Guan, Yongxin; Feng, Yangyang; Mu, Yanping; Fang, Ling; Zhang, Huijuan; Wang, Yu
2016-11-01
Known as an excellent energy storage material, ZnMn2O4 has a wide range of applications in supercapacitors. In this report, a special sandwich-like structure of ZnMn2O4/C has been first designed and synthesized via a simple hydrothermal method and subsequent calcinations. The designed special sandwich-like structure can benefit ion exchange and remit the probable volume changes during a mass of electrochemical reactions. Furthermore, the porous carbon nanosheets, derived from low-cost glucose, can effectively increase ion flux. Therefore, the novel sandwich-like ZnMn2O4 nanoparticles encapsulated in carbon nanosheets can undoubtedly demonstrate an exceptional electrochemical performance for SCs. In this work, the composite material with porous sandwich-like structure exhibits excellent cyclic stability for 5000 cycles (˜5% loss) and high specific capacitance of 1786 F g-1.
Buckling tests of sandwich cylindrical shells with and without cut-outs
Bisagni, C.; Davidson, B.D.; Czabaj, M.W.; Ratcliffe, J.G.
2016-01-01
The results of buckling tests performed during the project DESICOS funded by the European Commission in the FP7 Programme are here presented. The tested structures are sandwich cylindrical shells that consist of reduced models of a component of the Ariane 5 launcher: the Dual Launch System. In
Shi, Jingwen; Lan, Wenlong; Ren, Yanjie; Liu, Qingyun; Liu, Hui; Dong, Yunhui; Zhang, Daopeng
2018-04-01
Four pyridinecarboxamide trans-dicyanideiron(III) building blocks and one macrocyclic copper(II) compound have been employed to assemble cyanide-bridged heterometallic complexes, resulting in a serials of cyanide-bridged FeIII-CuII complexes with different structure types. The series of complexes can be formulated as: {[Cu(Cyclam)][Fe(bpb)(CN)2]2}·4H2O (1), {{[Cu(Cyclam)][Fe(bpb)(CN)2]}ClO4}n·nH2O (2), and {[Cu(Cyclam)][Fe(bpmb)(CN)2]2}·4H2O (3), {[Cu(Cyclam)][Fe(bpClb)(CN)2]2}·4H2O (4) and {{[Cu(Cyclam)][Fe(bpdmb)(CN)2]}ClO4}n·2nCH3OH (5) (bpb2- = 1,2-bis(pyridine-2-carboxamido)benzenate, bpmb2- = 1,2-bis(pyridine-2-carboxamido)-4-methyl-benzenate, bpClb2- = 1,2-bis(pyridine-2-carboxamido)-4-chloro-benzenate, bpdmb2- = 1,2-bis(pyridine-2-carboxamido)-4,5-dimethyl-benzenate, Cyclam = 1,4,8,11-tetraazacyclotetradecane). All the complexes have been characterized by elemental analysis, IR spectra and structural determination. Single X-ray diffraction analysis shows the similar neutral sandwich-like structures for complexes 1, 3 and 4, in which the two cyano precursors acting as monodentate ligand through one of their two cyanide groups were coordinated face to face to central Cu(II) ion. The complexes 2 and 5 can be structurally characterized as one-dimensional cationic single chain consisting of alternating units of [Cu(Cyclam)]2+ and [Fe(bpb/bpdmb)(CN)2]- with free ClO4- as balanced anion. Investigation over magnetic properties of the whole serials of complexes reveals the antiferromagnetic magnetic coupling between the neighboring cyanide-bridged Fe(III) and Cu(II) ions in complexes 3 and 4 and the ferromagnetic interaction in complexes 1, 2 and 5, respectively.
Salads, Sandwiches and Desserts.
Marine Corps Inst., Washington, DC.
Developed as part of the Marine Corps Institute (MCI) correspondence training program, this course on salads, sandwiches, and desserts is designed to provide Marine food service personnel with a general background in the proper techniques for the preparation of these items. Introductory materials include specific information for MCI students and a…
Gutiérrez, Rodrigo A; Stokes, Trevor L; Thum, Karen; Xu, Xiaodong; Obertello, Mariana; Katari, Manpreet S; Tanurdzic, Milos; Dean, Alexis; Nero, Damion C; McClung, C Robertson; Coruzzi, Gloria M
2008-03-25
Understanding how nutrients affect gene expression will help us to understand the mechanisms controlling plant growth and development as a function of nutrient availability. Nitrate has been shown to serve as a signal for the control of gene expression in Arabidopsis. There is also evidence, on a gene-by-gene basis, that downstream products of nitrogen (N) assimilation such as glutamate (Glu) or glutamine (Gln) might serve as signals of organic N status that in turn regulate gene expression. To identify genome-wide responses to such organic N signals, Arabidopsis seedlings were transiently treated with ammonium nitrate in the presence or absence of MSX, an inhibitor of glutamine synthetase, resulting in a block of Glu/Gln synthesis. Genes that responded to organic N were identified as those whose response to ammonium nitrate treatment was blocked in the presence of MSX. We showed that some genes previously identified to be regulated by nitrate are under the control of an organic N-metabolite. Using an integrated network model of molecular interactions, we uncovered a subnetwork regulated by organic N that included CCA1 and target genes involved in N-assimilation. We validated some of the predicted interactions and showed that regulation of the master clock control gene CCA1 by Glu or a Glu-derived metabolite in turn regulates the expression of key N-assimilatory genes. Phase response curve analysis shows that distinct N-metabolites can advance or delay the CCA1 phase. Regulation of CCA1 by organic N signals may represent a novel input mechanism for N-nutrients to affect plant circadian clock function.
3D Energy Absorption Diagram Construction of Paper Honeycomb Sandwich Panel
Directory of Open Access Journals (Sweden)
Dongmei Wang
2018-01-01
Full Text Available Paper honeycomb sandwich panel is an environment-sensitive material. Its cushioning property is closely related to its structural factors, the temperature and humidity, random shocks, and vibration events in the logistics environment. In order to visually characterize the cushioning property of paper honeycomb sandwich panel in different logistics conditions, the energy absorption equation of per unit volume of paper honeycomb sandwich panel was constructed by piecewise function. The three-dimensional (3D energy absorption diagram of paper honeycomb sandwich panel was constructed by connecting the inflexion of energy absorption curve. It takes into account the temperature, humidity, strain rate, and characteristics of the honeycomb structure. On the one hand, this diagram breaks through the limitation of the static compression curve of paper honeycomb sandwich panel, which depends on the test specimen and is applicable only to the standard condition. On the other hand, it breaks through the limitation of the conventional 2D energy absorption diagram which has less information. Elastic modulus was used to normalize the plateau stress and energy absorption per unit volume. This makes the 3D energy absorption diagram universal for different material sandwich panels. It provides a new theoretical basis for packaging optimized design.
Zhang, Yan; Zhang, Huijuan; Li, Xiao; Xu, Haitao; Wang, Yu
2016-04-15
A novel nanostructure where LiFePO4 nanoparticles are enveloped in sandwich-like carbon sheets as an enhanced cathode in lithium-ion batteries has successfully been synthesized for the first time. Compared to previous carbon-based nanocomposites, the achieved sandwich-like LiFePO4 nanocomposites exhibit totally different architecture, in which LiFePO4 nanoparticles are tightly entrapped between two carbon layers, instead of being anchored on the carbon sheet surfaces. In other words, the achieved sandwich-like LiFePO4 nanocomposite carbon layers are actually freestanding and can be operated and separated from each other. This is a great breakthrough in the design and synthesis of carbon-based functional materials. The obtained sandwich-like LiFePO4 nanocomposites present excellent electrochemical performance, which is rationally ascribed to the superb and unique structure and architecture. Of particular note is that the freestanding sandwich-like LiFePO4 nanocomposites exhibit enhanced cyclability and rate capability. At a high current density of 0.1 A g(-1), a stable specific capacity of approximately 168.5 mAh g(-1) can be delivered over 1000 cycles, and when the charge-discharge rates increase to 0.6, 2, 5 and 10 A g(-1), the specific capacities still survive at 149, 129, 114 and 91 mAh g(-1), respectively. Meanwhile, the sandwiched nanocomposite demonstrates a significantly improved low-temperature electrochemical energy storage performance. With respect to the excellent Li storage performance, and facility and reliability of production, the freestanding sandwich-like LiFePO4 nanocomposites are reasonably believed to have a great potential for multiple electrochemical energy storage applications.
Finite element simulation of low velocity impact loading on a sandwich composite
Directory of Open Access Journals (Sweden)
Vishwas M.
2018-01-01
Full Text Available Sandwich structure offer more advantage in bringing flexural stiffness and energy absorption capabilities in the application of automobile and aerospace components. This paper presents comparison study and analysis of two types of composite sandwich structures, one having Jute Epoxy skins with rubber core and the other having Glass Epoxy skins with rubber core subjected to low velocity normal impact loading. The behaviour of sandwich structure with various parameters such as energy absorption, peak load developed, deformation and von Mises stress and strain, are analyzed using commercially available analysis software. The results confirm that sandwich composite with jute epoxy skin absorbs approximately 20% more energy than glass epoxy skin. The contact force developed in jute epoxy skin is approximately 2.3 times less when compared to glass epoxy skin. von Mises stress developed is less in case of jute epoxy. The sandwich with jute epoxy skin deforms approximately 1.6 times more than that of same geometry of sandwich with glass epoxy skin. Thus exhibiting its elastic nature and making it potential candidate for low velocity impact application.
2012-01-01
Background Influenza A viruses are well characterized to antagonize type I IFN induction in infected mammalian cells. However, limited information is available for avian cells. It was hypothesised that avian influenza viruses (AIV) with distinct virulence may interact differently with the avian innate immune system. Therefore, the type I IFN responses induced by highly virulent and low virulent H5N1 AIV and reassortants thereof were analysed in chicken cells. Results The highly pathogenic (HP) AIV A/chicken/Yamaguchi/7/04 (H5N1) (Yama) did not induce type I IFN in infected chicken HD-11 macrophage-like cells. This contrasted with an NS1 mutant Yama virus (Yama-NS1A144V) and with the attenuated H5N1 AIV A/duck/Hokkaido/Vac-1/04 (Vac) carrying the haemagglutinin (HA) of the Yama virus (Vac-Yama/HA), that both induced type I IFN in these cells. The substitution of the NS segment from Yama with that from Vac in the Yama backbone resulted in induction of type I IFN secretion in HD-11 cells. However, vice versa, the Yama NS segment did not prevent type I IFN induction by the Vac-Yama/HA virus. This was different with the PB1/PB2/PA segment reassortant Yama and Vac-Yama/HA viruses. Whereas the Yama virus with the Vac PB1/PB2/PA segments induced type I IFN in HD-11 cells, the Vac-Yama/HA virus with the Yama PB1/PB2/PA segments did not. As reported for mammalian cells, the expression of H5N1 PB2 inhibited the activation of the IFN-β promoter in chicken DF-1 fibroblast cells. Importantly, the Yama PB2 was more potent at inhibiting the IFN-β promoter than the Vac PB2. Conclusions The present study demonstrates that the NS1 protein and the polymerase complex of the HPAIV Yama act in concert to antagonize chicken type I IFN secretion in HD-11 cells. PB2 alone can also exert a partial inhibitory effect on type I IFN induction. In conclusion, the control of type I IFN induction by H5N1 HPAIV represents a complex phenotype that involves a particular viral gene constellation
Directory of Open Access Journals (Sweden)
Cimnaghi Elisabetta
2014-03-01
Full Text Available Il programma MAB fu lanciato dall’UNESCO negli anni ’70 al fine di migliorare il rapporto tra uomo e ambiente. Negli anni il programma ha portato al riconoscimento di Riserve della Biosfera che gli Stati Membri si impegnano a gestire nella prospettiva della conservazione delle risorse. L’Organismo Gestore dell’Area Protetta, partendo, da un lato, dalla consapevolezza della ricchezza ambientale che caratterizza il suo territorio e, dall’altro, del contesto di sviluppo antropico elevato in cui essa è situata, ha riconosciuto nel programma MAB un’opportunità per incrementare le sue attività di protezione e potenziamento delle risorse. Questo articolo descrive i primi risultati ottenuti negli studi preliminari per la Designazione al MAB, con particolare attenzione sia alle opportunità di implementazione di progetti legati al marchio “Collina Po”, creato dall’Organo di Gestione del Parco, si ain termini di scambio di ‘best practices’ con altre Riserve di Biosfera.
Investigation on Wall Panel Sandwiched With Lightweight Concrete
Lakshmikandhan, K. N.; Harshavardhan, B. S.; Prabakar, J.; Saibabu, S.
2017-08-01
The rapid population growth and urbanization have made a massive demand for the shelter and construction materials. Masonry walls are the major component in the housing sector and it has brittle characteristics and exhibit poor performance against the uncertain loads. Further, the structure requires heavier sections for carrying the dead weight of masonry walls. The present investigations are carried out to develop a simple, lightweight and cost effective technology for replacing the existing wall systems. The lightweight concrete is developed for the construction of sandwich wall panel. The EPS (Expanded Polystyrene) beads of 3 mm diameter size are mixed with concrete and developed a lightweight concrete with a density 9 kN/m3. The lightweight sandwich panel is cast with a lightweight concrete inner core and ferrocement outer skins. This lightweight wall panel is tested for in-plane compression loading. A nonlinear finite element analysis with damaged plasticity model is carried out with both material and geometrical nonlinearities. The experimental and analytical results were compared. The finite element study predicted the ultimate load carrying capacity of the sandwich panel with reasonable accuracy. The present study showed that the lightweight concrete is well suitable for the lightweight sandwich wall panels.
Acoustic wave spread in superconducting-normal-superconducting sandwich
International Nuclear Information System (INIS)
Urushadze, G.I.
2004-01-01
The acoustic wave spread, perpendicular to the boundaries between superconducting and normal metals in superconducting-normal-superconducting (SNS) sandwich has been considered. The alternate current flow sound induced by the Green function method has been found and the coefficient of the acoustic wave transmission through the junction γ=(S 1 -S 2 )/S 1 , (where S 1 and S 2 are average energy flows formed on the first and second boundaries) as a function of the phase difference between superconductors has been investigated. It is shown that while the SNS sandwich is almost transparent for acoustic waves (γ 0 /τ), n=0,1,2, ... (where τ 0 /τ is the ratio of the broadening of the quasiparticle energy levels in impurity normal metal as a result of scattering of the carriers by impurities 1/τ to the spacing between energy levels 1/τ 0 ), γ=2, (S 2 =-S 1 ), which corresponds to the full reflection of the acoustic wave from SNS sandwich. This result is valid for the limit of a pure normal metal but in the main impurity case there are two amplification and reflection regions for acoustic waves. The result obtained shows promise for the SNS sandwich as an ideal mirror for acoustic wave reflection
45 CFR 5b.11 - Exempt systems.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...
Energy Technology Data Exchange (ETDEWEB)
Morales, Alejo A. Morales; Nunez-Gandolff, Gilda; Perez, Niuvis Perez; Veliz, Belkis Chico; Caballero-Torres, Idania; Duconge, Jorge; Fernandez, Eduardo; Crespo, Francisco Zayas; Veloso, Ana; Iznaga-Escobar, Normando E-mail: normando@ict.sld.cu
1999-08-01
Monoclonal antibodies (MAbs) have been useful for immunoscintigraphic applications in clinical diagnosis since they were introduced in nuclear medicine practice. The MAb ior egf/r3 developed at the Center of Molecular Immunology (Havana, Cuba) is a murine antibody that recognizes the human epidermal growth factor receptor (EGF-R) and has been used widely in the radioimmunodiagnosis of tumors of epithelial origin. Based on the direct Schwarz method, the present report describes the preparation of a freeze-dried formulation for radiolabeling the MAb ior egf/r3 with {sup 99m}Tc for immunoscintigraphic applications. Radiolabeling efficiency, effects on immunoreactivity, biodistribution, pharmacokinetic, and stability of the formulation are reported. The study demonstrated that the freeze-dried formulation can be labeled with {sup 99m}Tc at high yield. The resulting {sup 99m}Tc-labeled ior egf/r3 MAb can be used to visualize in vivo human tumors of epithelial origin by immunoscintigraphy studies. The kit does not need any other addition or purification at the time of tagging other than the requisite amount of pertechnetate (40-50 mCi). Because the contents of the kit are lyophilized, no special storage or transportation is required.
Design Analysis of the Mixed Mode Bending Sandwich Specimen
DEFF Research Database (Denmark)
Quispitupa, Amilcar; Berggreen, Christian; Carlsson, Leif A.
2010-01-01
A design analysis of the mixed mode bending (MMB) sandwich specimen for face–core interface fracture characterization is presented. An analysis of the competing failure modes in the foam cored sandwich specimens is performed in order to achieve face–core debond fracture prior to other failure modes...... for the chosen geometries and mixed mode loading conditions....
NKG2H-Expressing T Cells Negatively Regulate Immune Responses
Directory of Open Access Journals (Sweden)
Daniela Dukovska
2018-03-01
Full Text Available The biology and function of NKG2H receptor, unlike the better characterized members of the NKG2 family NKG2A, NKG2C, and NKG2D, remains largely unclear. Here, we show that NKG2H is able to associate with the signaling adapter molecules DAP12 and DAP10 suggesting that this receptor can signal for cell activation. Using a recently described NKG2H-specific monoclonal antibody (mAb, we have characterized the expression and function of lymphocytes that express this receptor. NKG2H is expressed at the cell surface of a small percentage of peripheral blood mononuclear cell (PBMC and is found more frequently on T cells, rather than NK cells. Moreover, although NKG2H is likely to trigger activation, co-cross-linking of this receptor with an NKG2H-specific mAb led to decreased T cell activation and proliferation in polyclonal PBMC cultures stimulated by anti-CD3 mAbs. This negative regulatory activity was seen only after cross-linking with NKG2H, but not NKG2A- or NKG2C-specific monoclonal antibodies. The mechanism underlying this negative effect is as yet unclear, but did not depend on the release of soluble factors or recognition of MHC class I molecules. These observations raise the intriguing possibility that NKG2H may be a novel marker for T cells able to negatively regulate T cell responses.
Two dimensional dynamic analysis of sandwich plates with gradient foam cores
Energy Technology Data Exchange (ETDEWEB)
Mu, Lin; Xiao, Deng Bao; Zhao, Guiping [State Key Laboratory for Mechanical structure Strength and Vibration, School of AerospaceXi' an Jiaotong University, Xi' an (China); Cho, Chong Du [Dept. of Mechanical Engineering, Inha University, Inchon (Korea, Republic of)
2016-09-15
Present investigation is concerned about dynamic response of composite sandwich plates with the functionally gradient foam cores under time-dependent impulse. The analysis is based on a model of the gradient sandwich plate, in which the face sheets and the core adopt the Kirchhoff theory and a [2, 1]-order theory, respectively. The material properties of the gradient foam core vary continuously along the thickness direction. The gradient plate model is validated with the finite element code ABAQUS®. And the results show that the proposed model can predict well the free vibration of composite sandwich plates with gradient foam cores. The influences of gradient foam cores on the natural frequency, deflection and energy absorbing of the sandwich plates are also investigated.
Directory of Open Access Journals (Sweden)
Salman A. Khan
2010-03-01
Full Text Available The title compound, 5-[(3,5-dimethyl-1-phenyl-1H-pyrazol-4-ylmethylene]-1,3-diethyl-2-thioxodihydropyrimidine-4,6(1H,5H-dione, has been synthesized by condensation of 1,3-diethyl-2-thiobarbituric acid and 3,5-dimethyl-1-phenylpyrazole-4-carbaldehyde in ethanol in the presence of pyridine. The structure of this new compound was confirmed by elemental analysis, IR, 1H-NMR, 13C-NMR and EI-MS spectral analysis.
Standard Test Method for Sandwich Corrosion Test
American Society for Testing and Materials. Philadelphia
2009-01-01
1.1 This test method defines the procedure for evaluating the corrosivity of aircraft maintenance chemicals, when present between faying surfaces (sandwich) of aluminum alloys commonly used for aircraft structures. This test method is intended to be used in the qualification and approval of compounds employed in aircraft maintenance operations. 1.2 The values stated in SI units are to be regarded as the standard. The values given in parentheses are for information. 1.3 This standard may involve hazardous materials, operations, and equipment. This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. Specific hazard statements appear in Section 9.
Magnetic properties of sandwiches based on Nd-Co and Y-Co amorphous alloys
International Nuclear Information System (INIS)
Ndjaka, J.M.B.; Givord, D.
1996-01-01
Y-Co/Nd-Co/Y-Co and Nd-Co/Y-Co/Nd-Co amorphous sandwiches have been prepared by d.c. triode sputtering. The chemical composition of the constituent layers is R 0.33 Co 0.67 (R=Y, Nd). In such systems, the Co moments are coupled parallel through the whole sandwich thickness by strong positive 3d-3d exchange interactions. But, the coercive fields of the constituent layers taken separately differ. In the sandwiches as well, the reversal of magnetization in the different layers occurs at different values of the applied magnetic field. This phenomenon has been analysed qualitatively in terms of creation and annihilation of walls at the interfaces between layers for sandwiches where the thicknesses of the constituent layers are about 1000 A. In sandwiches where the thickness of the constituent layers is 100 A, the wall width available is very weak and the value of the applied magnetic field necessary for the creation of such a wall is higher than the coercive field of the entire sandwich system. As a result, the magnetization of the sandwich system reverses as a whole like in homogeneous systems. (orig.)
Dai, Mengyao; Wang, Yao; Fang, Lu; Irwin, David M; Zhu, Tengteng; Zhang, Junpeng; Zhang, Shuyi; Wang, Zhe
2014-01-01
Bats are the only mammals capable of self-powered flight using wings. Differing from mouse or human limbs, four elongated digits within a broad wing membrane support the bat wing, and the foot of the bat has evolved a long calcar that spread the interfemoral membrane. Our recent mRNA sequencing (mRNA-Seq) study found unique expression patterns for genes at the 5' end of the Hoxd gene cluster and for Tbx3 that are associated with digit elongation and wing membrane growth in bats. In this study, we focused on two additional genes, Meis2 and Mab21l2, identified from the mRNA-Seq data. Using whole-mount in situ hybridization (WISH) we validated the mRNA-Seq results for differences in the expression patterns of Meis2 and Mab21l2 between bat and mouse limbs, and further characterize the timing and location of the expression of these two genes. These analyses suggest that Meis2 may function in wing membrane growth and Mab21l2 may have a role in AP and DV axial patterning. In addition, we found that Tbx3 is uniquely expressed in the unique calcar structure found in the bat hindlimb, suggesting a role for this gene in calcar growth and elongation. Moreover, analysis of the coding sequences for Meis2, Mab21l2 and Tbx3 showed that Meis2 and Mab21l2 have high sequence identity, consistent with the functions of genes being conserved, but that Tbx3 showed accelerated evolution in bats. However, evidence for positive selection in Tbx3 was not found, which would suggest that the function of this gene has not been changed. Together, our findings support the hypothesis that the modulation of the spatiotemporal expression patterns of multiple functional conserved genes control limb morphology and drive morphological change in the diversification of mammalian limbs.
Sandwich design for ships and railway wagons
Energy Technology Data Exchange (ETDEWEB)
Olsson, K.-A. [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Aeronautics
2000-07-01
In Sweden we have long experience of different types of vehicles and ships in sandwich construction, especially for Navy ships, such as minesweepers, mine-counter-measure-vessels and corvettes. As face materials mostly GRP and FRP have been used, but also metallic materials of Al-alloys, coated carbon steel and stainless steel. Core materials have usually been cellular plastic foams of cross-linked PVC, but also extruded PS, PUR, PEI and PMI. A lot of different continuous and discontinuous manufacturing processes are used. Vacuum assisted infusion is used in the last years, because it is a closed process, gives high fibre content and a good quality of the laminates. Sandwich design has mainly been used in the transportation area, where lightweight design is needed to give higher performance and load bearing capacity. The use of sandwich will give high stiffness- and strength-to weight ratio. These are in most cases not enough from economic point of view, but even other integrated functions must be considered, i.e. insulation, energy consumption, damping, less components, lower manufacturing costs, low maintenance, signature effects (military) etc. (orig.)
Study on the sandwich piezoelectric ceramic ultrasonic transducer in thickness vibration
International Nuclear Information System (INIS)
Lin Shuyu; Tian Hua
2008-01-01
A sandwich piezoelectric ceramic ultrasonic transducer in thickness vibration is studied. The transducer consists of front and back metal masses, and coaxially segmented, thickness polarized piezoelectric ceramic thin rings. For this kind of sandwich piezoelectric transducers in thickness vibration, it is required that the lateral dimension of the transducer is sufficiently large compared with its longitudinal dimension so that no lateral displacements in the transducer can occur (laterally clamped). In this paper, the thickness vibration of the piezoelectric ceramic stack consisting of a number of identical piezoelectric ceramic thin rings is analysed and its electro-mechanical equivalent circuit is obtained. The resonance frequency equation for the sandwich piezoelectric ceramic ultrasonic transducer in thickness vibration is derived. Based on the frequency equation, two sandwich piezoelectric ceramic ultrasonic transducers are designed and manufactured, and their resonance frequencies are measured. It is shown that the measured resonance frequencies are in good agreement with the theoretical results. This kind of sandwich piezoelectric ultrasonic transducer is expected to be used in megasonic ultrasonic cleaning and sonochemistry where high power and high frequency ultrasound is needed
International Nuclear Information System (INIS)
Mutschler, J.; Reske, S.N.; Steinbach, G.; Bunjes, D.; Buchmann, I.
2009-01-01
Tumour necrosis factor-α (TNF-α) serum levels may increase due to intensive conditioning regimes with high-dose chemotherapy and total body irradiation (TBI) before stem cell transplantation. This increases the risk for developing acute graft versus host disease (aGvHD) after stem cell transplantation. In this prospective study we investigated the influence of radioimmunotherapy with 188 Re-CD-66-mAb on changes on TNF-α serum levels. Patients, methods: In 18 patients we measured TNF-α before and up to 96 hours after radioimmunotherapy, in 2 patients in addition following TBI, in 9 patients also following chemotherapy. For measuring TNF-α we used an automated immunochemiluminescence assay (Immulite 1000 DPC Biermann, Bad Nauheim). The mean follow up period to record incidence of aGVHD was 100 days after stem cell transplantation. Compared to the basal levels before, the levels of TNF-α after conditioning with 188 Re-CD-66-mAb did not increase significantly and remained in the physiological range. In contrast, these initial physiological cytokine levels increased and became pathological following 48 h after total body irradiation (13.2 ± 6.6 pg/ml) and chemotherapy (10.8 ± 15.7 pg/ml). In our study we found a low incidence of aGvHD (22.2%, n = 4/18). Conclusion: These results demonstrate that additional conditioning therapy with 188 Re-CD-66-mAb does not increase proinflammatory cytokine levels of TNF-α. This finding may indicate that additive radioimmunotherapy may not be a significant factor for increasing the rate of conditioning- associated aGvHD. (orig.)
Stan Lebow; R. Sam Williams; Patricia Lebow
2003-01-01
The release of arsenic from wood pressure-treated with chromated copper arsenate (CCA) can be decreased by application of wood finishes, but little is known about the types of finishes that are best suited for this purpose. This study evaluated the effects of finish water repellent content and ultraviolet (UV) radiation on the release of arsenic, copper, and chromium...
Insert Design and Manufacturing for Foam-Core Composite Sandwich Structures
Lares, Alan
Sandwich structures have been used in the aerospace industry for many years. The high strength to weight ratios that are possible with sandwich constructions makes them desirable for airframe applications. While sandwich structures are effective at handling distributed loads such as aerodynamic forces, they are prone to damage from concentrated loads at joints or due to impact. This is due to the relatively thin face-sheets and soft core materials typically found in sandwich structures. Carleton University's Uninhabited Aerial Vehicle (UAV) Project Team has designed and manufactured a UAV (GeoSury II Prototype) which features an all composite sandwich structure fuselage structure. The purpose of the aircraft is to conduct geomagnetic surveys. The GeoSury II Prototype serves as the test bed for many areas of research in advancing UAV technologies. Those areas of research include: low cost composite materials manufacturing, geomagnetic data acquisition, obstacle detection, autonomous operations and magnetic signature control. In this thesis work a methodology for designing and manufacturing inserts for foam-core sandwich structures was developed. The results of this research work enables a designer wishing to design a foam-core sandwich airframe structure, a means of quickly manufacturing optimized inserts for the safe introduction of discrete loads into the airframe. The previous GeoSury II Prototype insert designs (v.1 & v.2) were performance tested to establish a benchmark with which to compare future insert designs. Several designs and materials were considered for the new v.3 inserts. A plug and sleeve design was selected, due to its ability to effectively transfer the required loads to the sandwich structure. The insert material was chosen to be epoxy, reinforced with chopped carbon fibre. This material was chosen for its combination of strength, low mass and also compatibility with the face-sheet material. The v.3 insert assembly is 60% lighter than the
Anti-GD2 mAb and Vorinostat synergize in the treatment of neuroblastoma
Kroesen, M.; Bull, C.; Gielen, P.R.; Brok, I.C.; Armandari, I.; Wassink, M.; Looman, M.W.G.; Boon, L.; Brok, M.H.M.G.M. den; Hoogerbrugge, P.M.; Adema, G.J.
2016-01-01
Neuroblastoma (NBL) is a childhood malignancy of the sympathetic nervous system. For high-risk NBL patients, the mortality rate is still over 50%, despite intensive multimodal treatment. Anti-GD2 monoclonal antibody (mAB) in combination with systemic cytokine immunotherapy has shown clinical
Diels-Alder Reactions of 12-Hydroxy-9(10®20-5aH-abeo-abieta-1(10,8(9,12(13-triene-11,14-dione
Directory of Open Access Journals (Sweden)
Shougang Hu
2013-06-01
Full Text Available 12-Hydroxy-9(10®20-5aH-abeo-abieta-1(10,8(9,12(13-triene-11,14-dione (quinone 2 served as the dienophile in numerous intermolecular Diels-Alder reactions. These cycloadditions were conducted either thermally (including microwave heating or with Lewis acid activation. While most dienes reacted with quinone 2 in good chemical yield, others were incompatible under the experimental conditions used.
Nanocrystalline Aluminum Truss Cores for Lightweight Sandwich Structures
Schaedler, Tobias A.; Chan, Lisa J.; Clough, Eric C.; Stilke, Morgan A.; Hundley, Jacob M.; Masur, Lawrence J.
2017-12-01
Substitution of conventional honeycomb composite sandwich structures with lighter alternatives has the potential to reduce the mass of future vehicles. Here we demonstrate nanocrystalline aluminum-manganese truss cores that achieve 2-4 times higher strength than aluminum alloy 5056 honeycombs of the same density. The scalable fabrication approach starts with additive manufacturing of polymer templates, followed by electrodeposition of nanocrystalline Al-Mn alloy, removal of the polymer, and facesheet integration. This facilitates curved and net-shaped sandwich structures, as well as co-curing of the facesheets, which eliminates the need for extra adhesive. The nanocrystalline Al-Mn alloy thin-film material exhibits high strength and ductility and can be converted into a three-dimensional hollow truss structure with this approach. Ultra-lightweight sandwich structures are of interest for a range of applications in aerospace, such as fairings, wings, and flaps, as well as for the automotive and sports industries.
Blast-Resistant Improvement of Sandwich Armor Structure with Aluminum Foam Composite
Yang, Shu; Qi, Chang
2013-01-01
Sandwich armor structures with aluminum foam can be utilized to protect a military vehicle from harmful blast load such as a landmine explosion. In this paper, a system-level dynamic finite element model is developed to simulate the blast event and to evaluate the blast-resistant performance of the sandwich armor structure. It is found that a sandwich armor structure with only aluminum foam is capable of mitigating crew injuries under a moderate blast load. However, a severe blast load causes...
Directory of Open Access Journals (Sweden)
C. Lo Passo
2018-04-01
Full Text Available Factor H binding protein (FHbp is a component of two licensed vaccines for prevention of sepsis and meningitis caused by serogroup B meningococci. FHbp binds human Factor H (FH, which contributes to evasion of host immunity and FHbp sequence variants can be classified into two sub-families. Antibodies against FHbp elicit complement-mediated killing and can inhibit recruitment of FH to the bacterial surface. We report epitope mapping studies of two murine IgG mAbs, designated JAR 31 and JAR 36, isolated from a mouse immunized with FHbp in sub-family A, which is present in ∼30–40% of invasive isolates. In the present study, we tested the reactivity of mAbs JAR 31 and JAR 36 with seven natural FHbp sequence variants from different phylogenic groups. We screened bacteriophage-displayed peptide libraries to identify amino acid residues contributing to the JAR 36 epitope. Based on the reactivities of mAbs JAR 31 and JAR 36 with the seven FHbp variants, and the frequent occurrences of aspartate (D and lysine (K residues in the JAR 36-bound phage peptides, we selected six residues in the carboxyl-terminal region of FHbp for replacement with alanine (A. The D201A and K203A substitutions respectively eliminated and decreased binding of mAbs JAR 31 and JAR 36 to FHbp. These substitutions did not affect binding of the control mAb JAR 33 or of human FH. JAR 31 or JAR 36 mediated cooperative complement-mediated bactericidal activity with other anti-FHbp mAbs. The identification of two amino acid residues involved in the epitopes recognized by these anti-FHbp mAbs may contribute to a more complete understanding of the spatial requirements for cooperative anti-FHbp mAb bactericidal activity. Keywords: Biochemistry, Immunology, Microbiology, Molecular biology
Effect of varying geometrical parameters of trapezoidal corrugated-core sandwich structure
Directory of Open Access Journals (Sweden)
Zaid N.Z.M.
2017-01-01
Full Text Available Sandwich structure is an attractive alternative that increasingly used in the transportation and aerospace industry. Corrugated-core with trapezoidal shape allows enhancing the damage resistance to the sandwich structure, but on the other hand, it changes the structural response of the sandwich structure. The aim of this paper is to study the effect of varying geometrical parameters of trapezoidal corrugated-core sandwich structure under compression loading. The corrugated-core specimen was fabricated using press technique, following the shape of trapezoidal shape. Two different materials were used in the study, glass fibre reinforced plastic (GFRP and carbon fibre reinforced plastic (CFRP. The result shows that the mechanical properties of the core in compression loading are sensitive to the variation of a number of unit cells and the core thickness.
Cheng Piao; Todd F. Shupe; Mark Gibson; Chung Y. Hse
2009-01-01
Chromated copper arsenate (CCA) continues to be widely used as a wood preservative for industrial uses in the U.S. Disposal of treated wood is a potential long-term environmental liability. Current practices for disposing of decommissioned preservative-treated wood include landfilling and incineration, which are increasingly impractical due to environmental...
Long sandwich modules for photon veto detectors
International Nuclear Information System (INIS)
Yershov, N.; Khabibullin, M.; Kudenko, Yu.; Littenberg, L.; Mayatski, V.; Mineev, O.
2005-01-01
Long lead-scintillator sandwich modules developed for the BNL experiment KOPIO are described. The individual 4 m long module consists of 15 layers of 7 mm thick extruded scintillator and 15 layers of 1 mm lead absorber. Readout is implemented via WLS fibers glued into grooves in a scintillator with 7 mm spacing and viewed from both ends by the phototubes. Time resolution of 300 ps for cosmic MIPs was obtained. Light output stability monitored for 2 years shows no degradation beyond the measurement errors. A 4 m long C-bent sandwich module was also manufactured and tested
Wei, Sung-Hsi; Huang, Angela S; Liao, Ying-Shu; Liu, Yu-Lun; Chiou, Chien-Shun
2014-03-01
Food sold over the internet is an emerging business that also presents a concern with regard to food safety. A nationwide foodborne disease outbreak associated with sandwiches purchased from an online shop in July 2010 is reported. Consumers were telephone interviewed with a structured questionnaire and specimens were collected for etiological examination. A total of 886 consumers were successfully contacted and completed the questionnaires; 36.6% had become ill, with a median incubation period of 18 h (range, 6-66 h). The major symptoms included diarrhea (89.2%), abdominal pain (69.8%), fever (47.5%), headache (32.7%), and vomiting (17.3%). Microbiological laboratories isolated Salmonella enterica serovar Enteritidis, Salmonella Virchow, Staphylococcus aureus, Bacillus cereus, and enterotoxigenic Escherichia coli from the contaminated sandwiches, Salmonella Enteritidis and Salmonella Virchow from the patients, and Salmonella Enteritidis and Staphylococcus aureus from food handlers. Pulsed-field gel electrophoresis genotyping suggested a common origin of Salmonella bacteria recovered from the patients, food, and a food handler. Among the pathogens detected, the symptoms and incubation period indicated that Salmonella, likely of egg origin, was the probable causative agent of the outbreak. This outbreak illustrates the importance of meticulous hygiene practices during food preparation and temperature control during food shipment and the food safety challenges posed by online food-shopping services.
Wei, Sung-Hsi; Huang, Angela S.; Liao, Ying-Shu; Liu, Yu-Lun
2014-01-01
Abstract Food sold over the internet is an emerging business that also presents a concern with regard to food safety. A nationwide foodborne disease outbreak associated with sandwiches purchased from an online shop in July 2010 is reported. Consumers were telephone interviewed with a structured questionnaire and specimens were collected for etiological examination. A total of 886 consumers were successfully contacted and completed the questionnaires; 36.6% had become ill, with a median incubation period of 18 h (range, 6–66 h). The major symptoms included diarrhea (89.2%), abdominal pain (69.8%), fever (47.5%), headache (32.7%), and vomiting (17.3%). Microbiological laboratories isolated Salmonella enterica serovar Enteritidis, Salmonella Virchow, Staphylococcus aureus, Bacillus cereus, and enterotoxigenic Escherichia coli from the contaminated sandwiches, Salmonella Enteritidis and Salmonella Virchow from the patients, and Salmonella Enteritidis and Staphylococcus aureus from food handlers. Pulsed-field gel electrophoresis genotyping suggested a common origin of Salmonella bacteria recovered from the patients, food, and a food handler. Among the pathogens detected, the symptoms and incubation period indicated that Salmonella, likely of egg origin, was the probable causative agent of the outbreak. This outbreak illustrates the importance of meticulous hygiene practices during food preparation and temperature control during food shipment and the food safety challenges posed by online food–shopping services. PMID:24313786
A CCA+ICA based model for multi-task brain imaging data fusion and its application to schizophrenia.
Sui, Jing; Adali, Tülay; Pearlson, Godfrey; Yang, Honghui; Sponheim, Scott R; White, Tonya; Calhoun, Vince D
2010-05-15
Collection of multiple-task brain imaging data from the same subject has now become common practice in medical imaging studies. In this paper, we propose a simple yet effective model, "CCA+ICA", as a powerful tool for multi-task data fusion. This joint blind source separation (BSS) model takes advantage of two multivariate methods: canonical correlation analysis and independent component analysis, to achieve both high estimation accuracy and to provide the correct connection between two datasets in which sources can have either common or distinct between-dataset correlation. In both simulated and real fMRI applications, we compare the proposed scheme with other joint BSS models and examine the different modeling assumptions. The contrast images of two tasks: sensorimotor (SM) and Sternberg working memory (SB), derived from a general linear model (GLM), were chosen to contribute real multi-task fMRI data, both of which were collected from 50 schizophrenia patients and 50 healthy controls. When examining the relationship with duration of illness, CCA+ICA revealed a significant negative correlation with temporal lobe activation. Furthermore, CCA+ICA located sensorimotor cortex as the group-discriminative regions for both tasks and identified the superior temporal gyrus in SM and prefrontal cortex in SB as task-specific group-discriminative brain networks. In summary, we compared the new approach to some competitive methods with different assumptions, and found consistent results regarding each of their hypotheses on connecting the two tasks. Such an approach fills a gap in existing multivariate methods for identifying biomarkers from brain imaging data.
Lukaszewicz, D.; Blok, L.G.; Kratz, J.; Ward, C.; Kassapoglou, C.; Elmarakbi, A.; Araújo, A.L.
2016-01-01
In this work the application of fibre reinforced plastic (FRP) sandwich
structures, with particular focus on aramid fibre tufted sandwiches is being studied for
automotive crashworthiness applications using impact testing and numerical simulation.
Application of Load Carrying Sandwich Elements in Wind Turbine Blades
DEFF Research Database (Denmark)
Jensen, Jacob Fisker; Schultz, Jacob Pagh; Berggreen, Carl Christian
2005-01-01
The present work investigates the possibilities and drawbacks when applying sandwich as opposed to single skin composites in the flanges of the load carrying spar in a future 180 m wind turbine rotor. FEA is applied to investigate two basic designs with single skin and sandwich flanges respectively...
Compressive Behaviour and Energy Absorption of Aluminium Foam Sandwich
Endut, N. A.; Hazza, M. H. F. Al; Sidek, A. A.; Adesta, E. T. Y.; Ibrahim, N. A.
2018-01-01
Development of materials in automotive industries plays an important role in order to retain the safety, performance and cost. Metal foams are one of the idea to evolve new material in automotive industries since it can absorb energy when it deformed and good for crash management. Recently, new technology had been introduced to replace metallic foam by using aluminium foam sandwich (AFS) due to lightweight and high energy absorption behaviour. Therefore, this paper provides reliable data that can be used to analyze the energy absorption behaviour of aluminium foam sandwich by conducting experimental work which is compression test. Six experiments of the compression test were carried out to analyze the stress-strain relationship in terms of energy absorption behavior. The effects of input variables include varying the thickness of aluminium foam core and aluminium sheets on energy absorption behavior were evaluated comprehensively. Stress-strain relationship curves was used for energy absorption of aluminium foam sandwich calculation. The result highlights that the energy absorption of aluminium foam sandwich increases from 12.74 J to 64.42 J respectively with increasing the foam and skin thickness.
Blanco, Rancés; Blanco, Damián; Quintana, Yisel; Escobar, Xiomara; Rengifo, Charles E.; Osorio, Marta; Gutiérrez, Zailí; Lamadrid, Janet; Cedeño, Mercedes; Frómeta, Milagros; Carr, Adriana; Rengifo, Enrique
2013-01-01
The reactivity of the 14F7 Mab, a highly specific IgG1 against N-glycolyl GM3 ganglioside (NeuGcGM3) in normal tissues, lymphomas, lymph node metastasis, and other metastatic sites was assessed by immunohistochemistry. In addition, the effect of chemical fixation on the 14F7 Mab staining using monolayers of P3X63Ag.653 cells was also evaluated. Moreover, the ability of 14F7 to bind NeuGcGM3 ganglioside inducing complement-independent cytotoxicity by a flow cytometry-based assay was measured. The 14F7 Mab was reactive in unfixed, 4% paraformaldehyde, 4% formaldehyde, and acetone fixed cells. Postfixation with acetone did not alter the localization of NeuGcGM3, while the staining with 14F7 Mab was significantly eliminated in both cells fixed and postfixed with methanol but only partially reduced with ethanol. The staining with 14F7 Mab was evidenced in the 89.2%, 89.4%, and 88.9% of lymphomas, lymph node metastasis, and other metastatic sites, respectively, but not in normal tissues. The treatment with 14F7 Mab affected both morphology and membrane integrity of P3X63Ag.653 cells. This cytotoxic activity was dose-dependent and ranged from 24.0 to 84.7% (10–1000 μg/mL) as compared to the negative control. Our data could support the possible use of NeuGcGM3 as target for both active and passive immunotherapy against malignancies expressing this molecule. PMID:24381785
Proteomic Characterization of Primary Mouse Hepatocytes in Collagen Monolayer and Sandwich Culture.
Orsini, Malina; Sperber, Saskia; Noor, Fozia; Hoffmann, Esther; Weber, Susanne N; Hall, Rabea A; Lammert, Frank; Heinzle, Elmar
2018-01-01
Dedifferentiation of primary hepatocytes in vitro makes their application in long-term studies difficult. Embedding hepatocytes in a sandwich of extracellular matrix is reported to delay the dedifferentiation process to some extent. In this study, we compared the intracellular proteome of primary mouse hepatocytes (PMH) in conventional monolayer cultures (ML) to collagen sandwich culture (SW) after 1 day and 5 days of cultivation. Quantitative proteome analysis of PMH showed no differences between collagen SW and ML cultures after 1 day. Glycolysis and gluconeogenesis were strongly affected by long-term cultivation in both ML and SW cultures. Interestingly, culture conditions had no effect on cellular lipid metabolism. After 5 days, PMH in collagen SW and ML cultures exhibit characteristic indications of oxidative stress. However, in the SW culture the defense system against oxidative stress is significantly up-regulated to deal with this, whereas in the ML culture a down-regulation of these important enzymes takes place. Regarding the multiple effects of ROS and oxidative stress in cells, we conclude that the down-regulation of these enzymes seem to play a role in the loss of hepatic function observed in the ML cultivation. In addition, enzymes of the urea cycle were clearly down-regulated in ML culture. Proteomics confirms lack in oxidative stress defense mechanisms as the major characteristic of hepatocytes in monolayer cultures compared to sandwich cultures. J. Cell. Biochem. 119: 447-454, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
[11C]TASP457, a novel PET ligand for histamine H3 receptors in human brain
International Nuclear Information System (INIS)
Kimura, Yasuyuki; Seki, Chie; Ikoma, Yoko; Ichise, Masanori; Kawamura, Kazunori; Takahata, Keisuke; Moriguchi, Sho; Nagashima, Tomohisa; Ishii, Tatsuya; Kitamura, Soichiro; Niwa, Fumitoshi; Endo, Hironobu; Yamada, Makiko; Higuchi, Makoto; Zhang, Ming-Rong; Suhara, Tetsuya
2016-01-01
The histamine H 3 receptors are presynaptic neuroreceptors that inhibit the release of histamine and other neurotransmitters. The receptors are considered a drug target for sleep disorders and neuropsychiatric disorders with cognitive decline. We developed a novel PET ligand for the H 3 receptors, [ 11 C]TASP0410457 ([ 11 C]TASP457), with high affinity, selectivity and favorable kinetic properties in the monkey, and evaluated its kinetics and radiation safety profile for quantifying the H 3 receptors in human brain. Ten healthy men were scanned for 120 min with a PET scanner for brain quantification and three healthy men were scanned for radiation dosimetry after injection of 386 ± 6.2 MBq and 190 ± 7.5 MBq of [ 11 C]TASP457, respectively. For brain quantification, arterial blood sampling and metabolite analysis were performed using high-performance liquid chromatography. Distribution volumes (V T ) in brain regions were determined by compartment and graphical analyses using the Logan plot and Ichise multilinear analysis (MA1). For dosimetry, radiation absorbed doses were estimated using the Medical Internal Radiation Dose scheme. [ 11 C]TASP457 PET showed high uptake (standardized uptake values in the range of about 3 - 6) in the brain and fast washout in cortical regions and slow washout in the pallidum. The two-tissue compartment model and graphical analyses estimated V T with excellent identification using 60-min scan data (about 16 mL/cm 3 in the pallidum, 9 - 14 in the basal ganglia, 6 - 9 in cortical regions, and 5 in the pons), which represents the known distribution of histamine H 3 receptors. For parametric imaging, MA1 is recommended because of minimal underestimation with small intersubject variability. The organs with the highest radiation doses were the pancreas, kidneys, and liver. The effective dose delivered by [ 11 C]TASP457 was 6.9 μSv/MBq. [ 11 C]TASP457 is a useful novel PET ligand for the investigation of the density of histamine H 3
5 CFR 1651.11 - Simultaneous death.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Simultaneous death. 1651.11 Section 1651.11 Administrative Personnel FEDERAL RETIREMENT THRIFT INVESTMENT BOARD DEATH BENEFITS § 1651.11 Simultaneous death. If a beneficiary dies at the same time as the participant, the beneficiary will be treated...
5 CFR 1206.11 - Meeting place.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Meeting place. 1206.11 Section 1206.11 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES OPEN MEETINGS Conduct of Meetings § 1206.11 Meeting place. The Board will hold open meetings in meeting rooms designated in the...
Sandwiched Rényi divergence satisfies data processing inequality
International Nuclear Information System (INIS)
Beigi, Salman
2013-01-01
Sandwiched (quantum) α-Rényi divergence has been recently defined in the independent works of Wilde et al. [“Strong converse for the classical capacity of entanglement-breaking channels,” preprint http://arxiv.org/abs/arXiv:1306.1586 (2013)] and Müller-Lennert et al. [“On quantum Rényi entropies: a new definition, some properties and several conjectures,” preprint http://arxiv.org/abs/arXiv:1306.3142v1 (2013)]. This new quantum divergence has already found applications in quantum information theory. Here we further investigate properties of this new quantum divergence. In particular, we show that sandwiched α-Rényi divergence satisfies the data processing inequality for all values of α > 1. Moreover we prove that α-Holevo information, a variant of Holevo information defined in terms of sandwiched α-Rényi divergence, is super-additive. Our results are based on Hölder's inequality, the Riesz-Thorin theorem and ideas from the theory of complex interpolation. We also employ Sion's minimax theorem
Multi-objective optimal design of sandwich panels using a genetic algorithm
Xu, Xiaomei; Jiang, Yiping; Pueh Lee, Heow
2017-10-01
In this study, an optimization problem concerning sandwich panels is investigated by simultaneously considering the two objectives of minimizing the panel mass and maximizing the sound insulation performance. First of all, the acoustic model of sandwich panels is discussed, which provides a foundation to model the acoustic objective function. Then the optimization problem is formulated as a bi-objective programming model, and a solution algorithm based on the non-dominated sorting genetic algorithm II (NSGA-II) is provided to solve the proposed model. Finally, taking an example of a sandwich panel that is expected to be used as an automotive roof panel, numerical experiments are carried out to verify the effectiveness of the proposed model and solution algorithm. Numerical results demonstrate in detail how the core material, geometric constraints and mechanical constraints impact the optimal designs of sandwich panels.
Design Considerations for Thermally Insulating Structural Sandwich Panels for Hypersonic Vehicles
Blosser, Max L.
2016-01-01
Simplified thermal/structural sizing equations were derived for the in-plane loading of a thermally insulating structural sandwich panel. Equations were developed for the strain in the inner and outer face sheets of a sandwich subjected to uniaxial mechanical loads and differences in face sheet temperatures. Simple equations describing situations with no viable solution were developed. Key design parameters, material properties, and design principles are identified. A numerical example illustrates using the equations for a preliminary feasibility assessment of various material combinations and an initial sizing for minimum mass of a sandwich panel.
The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack
Energy Technology Data Exchange (ETDEWEB)
Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-01-24
This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.
Photocatalytic perfermance of sandwich-like BiVO_4 sheets by microwave assisted synthesis
International Nuclear Information System (INIS)
Liu, Suqin; Tang, Huiling; Zhou, Huan; Dai, Gaopeng; Wang, Wanqiang
2017-01-01
Graphical abstract: Sandwich-like BiVO_4 sheets were successfully synthesized via a facile microwave-assisted method. The as-prepared samples exhibit a high activity for the degradation of methyl orange under visible light irradiation. - Highlights: • Sandwich-like BiVO_4 sheets were synthesized by a facile microwave-assisted method. • The presence of PEG-10000 plays a critical role in the formation of BiVO_4 sheets. • Ostwald ripening is the primary driving force for the formation of sandwich-like BiVO_4. • The sandwich-like BiVO_4 sheets exhibit a high visible-light photocatalytic activity. - Abstract: Sandwich-like BiVO_4 sheets were successfully synthesized in an aqueous solution containing bismuth nitrate, ammonium metavanadate and polyethylene glycol with a molecular weight of 10,000 (PEG-10000) using a facile microwave-assisted method. The as-prepared samples were characterized by scanning electron microscopy, N_2 adsorption-desorption, X-ray diffraction, X-ray photoelectron spectroscopy (XPS), and UV–vis diffuse reflectance spectroscopy. The results show that the presence of PEG-10000 plays a critical role in the formation of BiVO_4 sheets, and Ostwald ripening is the primary driving force for the formation of sandwich-like structures. The sandwich-like BiVO_4 sheets exhibit a high activity for the degradation of methyl orange under visible light irradiation (λ ≥ 420 nm). The enhancement of photocatalytic activity of sandwich-like BiVO_4 sheets can be attributed to its large surface area over the irregular BiVO_4 particles.
Directory of Open Access Journals (Sweden)
Ann R Hunt
2010-07-01
Full Text Available Venezuelan equine encephalitis virus (VEEV is responsible for VEE epidemics that occur in South and Central America and the U.S. The VEEV envelope contains two glycoproteins E1 (mediates cell membrane fusion and E2 (binds receptor and elicits virus neutralizing antibodies. Previously we constructed E1 and E2 epitope maps using murine monoclonal antibodies (mMAbs. Six E2 epitopes (E2(c,d,e,f,g,h bound VEEV-neutralizing antibody and mapped to amino acids (aa 182-207. Nothing is known about the human antibody repertoire to VEEV or epitopes that engage human virus-neutralizing antibodies. There is no specific treatment for VEE; however virus-neutralizing mMAbs are potent protective and therapeutic agents for mice challenged with VEEV by either peripheral or aerosol routes. Therefore, fully human MAbs (hMAbs with virus-neutralizing activity should be useful for prevention or clinical treatment of human VEE.We used phage-display to isolate VEEV-specific hFabs from human bone marrow donors. These hFabs were characterized by sequencing, specificity testing, VEEV subtype cross-reactivity using indirect ELISA, and in vitro virus neutralization capacity. One E2-specific neutralizing hFAb, F5n, was converted into IgG, and its binding site was identified using competitive ELISA with mMAbs and by preparing and sequencing antibody neutralization-escape variants.Using 11 VEEV-reactive hFabs we constructed the first human epitope map for the alphaviral surface proteins E1 and E2. We identified an important neutralization-associated epitope unique to the human immune response, E2 aa115-119. Using a 9 A resolution cryo-electron microscopy map of the Sindbis virus E2 protein, we showed the probable surface location of this human VEEV epitope.The VEEV-neutralizing capacity of the hMAb F5 nIgG is similar to that exhibited by the humanized mMAb Hy4 IgG. The Hy4 IgG has been shown to limit VEEV infection in mice both prophylactically and therapeutically. Administration
Hui, Ada; Lam, Xanthe M; Kuehl, Christopher; Grauschopf, Ulla; Wang, Y John
2015-01-01
When isolator technology is applied to biotechnology drug product fill-finish process, hydrogen peroxide (H2O2) spiking studies for the determination of the sensitivity of protein to residual peroxide in the isolator can be useful for assessing a maximum vapor phase hydrogen peroxide (VPHP) level. When monoclonal antibody (mAb) drug products were spiked with H2O2, an increase in methionine (Met 252 and Met 428) oxidation in the Fc region of the mAbs with a decrease in H2O2 concentration was observed for various levels of spiked-in peroxide. The reaction between Fc-Met and H2O2 was stoichiometric (i.e., 1:1 molar ratio), and the reaction rate was dependent on the concentrations of mAb and H2O2. The consumption of H2O2 by Fc-Met oxidation in the mAb followed pseudo first-order kinetics, and the rate was proportional to mAb concentration. The extent of Met 428 oxidation was half of that of Met 252, supporting that Met 252 is twice as reactive as Met 428. Similar results were observed for free L-methionine when spiked with H2O2. However, mAb formulation excipients may affect the rate of H2O2 consumption. mAb formulations containing trehalose or sucrose had faster H2O2 consumption rates than formulations without the sugars, which could be the result of impurities (e.g., metal ions) present in the excipients that may act as catalysts. Based on the H2O2 spiking study results, we can predict the amount Fc-Met oxidation for a given protein concentration and H2O2 level. Our kinetic modeling of the reaction between Fc-Met oxidation and H2O2 provides an outline to design a H2O2 spiking study to support the use of VPHP isolator for antibody drug product manufacture. Isolator technology is increasing used in drug product manufacturing of biotherapeutics. In order to understand the impact of residual vapor phase hydrogen peroxide (VPHP) levels on protein product quality, hydrogen peroxide (H2O2) spiking studies may be performed to determine the sensitivity of monoclonal antibody
Carol Clausen
2004-01-01
In this study, three possible improvements to a remediation process for chromated-copper-arsenate (CCA) treated wood were evaluated. The process involves two steps: oxalic acid extraction of wood fiber followed by bacterial culture with Bacillus licheniformis CC01. The three potential improvements to the oxalic acid extraction step were (1) reusing oxalic acid for...
Buckling Analysis of Edge Cracked Sandwich Plate
Directory of Open Access Journals (Sweden)
Rasha Mohammed Hussein
2016-07-01
Full Text Available This work presents mainly the buckling load of sandwich plates with or without crack for different cases. The buckling loads are analyzed experimentally and numerically by using ANSYS 15. The experimental investigation was to fabricate the cracked sandwich plate from stainless steel and PVC to find mechanical properties of stainless steel and PVC such as young modulus. The buckling load for different aspect ratio, crack length, cracked location and plate without crack found. The experimental results were compared with that found from ANSYS program. Present of crack is decreased the buckling load and that depends on crack size, crack location and aspect ratio.
The deprotonation energies of BH{sub 5} and AlH{sub 5}: Comparisons to GaH{sub 5}
Energy Technology Data Exchange (ETDEWEB)
Speakman, Lucas D. [Center for Computational Chemistry, University of Georgia, 1004 Cedar Street, Athens, GA 30602-2556 (United States)], E-mail: speakman@ccqc.uga.edu; Turney, Justin M. [Center for Computational Chemistry, University of Georgia, 1004 Cedar Street, Athens, GA 30602-2556 (United States); Schaefer, Henry F. [Center for Computational Chemistry, University of Georgia, 1004 Cedar Street, Athens, GA 30602-2556 (United States)
2007-01-08
Hypercoordinate boron is most unusual, leading to considerable theoretical and experimental research on the parent BH{sub 5} molecule. The deprotonation energies of BH{sub 5} and the related molecules AlH{sub 5} and GaH{sub 5} have been of particular interest. Here the energy differences for XH{sub 5}->XH{sub 4}{sup -}+H(X=BandAl) are computed to be 332.4 and 326.3kcalmol{sup -1}, respectively, with an aug-cc-pVQZ basis set at the CCSD(T) level of theory. Vibrational frequencies for BH{sub 4}{sup -} and AlH{sub 4}{sup -} are also reported as 1098, 1210, 2263, and 2284cm{sup -1} and 760, 779, 1658, and 1745cm{sup -1}, respectively, again at the CCSD(T) aug-cc-pVQZ level of theory. Comparisons with the valence isoelectronic GaH{sub 5} molecule are made.
Behavior of composite sandwich panels with several core designs at different impact velocities
Jiga, Gabriel; Stamin, Ştefan; Dinu, Gabriela
2018-02-01
A sandwich composite represents a special class of composite materials that is manufactured by bonding two thin but stiff faces to a low density and low strength but thick core. The distance between the skins given by the core increases the flexural modulus of the panel with a low mass increase, producing an efficient structure able to resist at flexural and buckling loads. The strength of sandwich panels depends on the size of the panel, skins material and number or density of the cells within it. Sandwich composites are used widely in several industries, such as aerospace, automotive, medical and leisure industries. The behavior of composite sandwich panels with different core designs under different impact velocities are analyzed in this paper by numerical simulations performed on sandwich panels. The modeling was done in ANSYS and the analysis was performed through LS-DYNA.
Brenner, Tom; Chen, Johnny; Stait-Gardner, Tim; Zheng, Gang; Matsukawa, Shingo; Price, William S.
2018-03-01
A new family of binomial-like inversion sequences, named jump-and-return sandwiches (JRS), has been developed by inserting a binomial-like sequence into a standard jump-and-return sequence, discovered through use of a stochastic Genetic Algorithm optimisation. Compared to currently used binomial-like inversion sequences (e.g., 3-9-19 and W5), the new sequences afford wider inversion bands and narrower non-inversion bands with an equal number of pulses. As an example, two jump-and-return sandwich 10-pulse sequences achieved 95% inversion at offsets corresponding to 9.4% and 10.3% of the non-inversion band spacing, compared to 14.7% for the binomial-like W5 inversion sequence, i.e., they afforded non-inversion bands about two thirds the width of the W5 non-inversion band.
The H_6_0Si_6C_5_4 heterofullerene as high-capacity hydrogen storage medium
International Nuclear Information System (INIS)
Yong, Yongliang; Zhou, Qingxiao; Li, Xiaohong; Lv, Shijie
2016-01-01
With the great success in Si atoms doped C_6_0 fullerene and the well-established methods for synthesis of hydrogenated carbon fullerenes, this leads naturally to wonder whether Si-doped fullerenes are possible for special applications such as hydrogen storage. Here by using first-principles calculations, we design a novel high-capacity hydrogen storage material, H_6_0Si_6C_5_4 heterofullerene, and confirm its geometric stability. It is found that the H_6_0Si_6C_5_4 heterofullerene has a large HOMO-LUMO gap and a high symmetry, indicating it is high chemically stable. Further, our finite temperature simulations indicate that the H_6_0Si_6C_5_4 heterofullerene is thermally stable at 300 K. H_2 molecules would enter into the cage from the Si-hexagon ring because of lower energy barrier. Through our calculation, a maximum of 21 H_2 molecules can be stored inside the H_6_0Si_6C_5_4 cage in molecular form, leading to a gravimetric density of 11.11 wt% for 21H_2@H_6_0Si_6C_5_4 system, which suggests that the hydrogenated Si_6C_5_4 heterofullerene could be suitable as a high-capacity hydrogen storage material.
3-Isobutyl-4-phenylsulfanyl-1H-pyrazol-5-ol
Directory of Open Access Journals (Sweden)
Tara Shahani
2011-02-01
Full Text Available The asymmetric unit of the title compound, C13H16N2OS, contains two independent molecules (A and B. The pyrazole ring [maximum deviations = 0.0049 (17 Å in molecule A and 0.0112 (19 Å in molecule B] makes a dihedral angle of 70.23 (11 and 73.18 (12° with the phenyl ring in molecules A and B, respectively. The isobutyl group in molecule B is disordered over two sets of sites with a ratio of refined occupancies of 0.858 (5:0.142 (5. In the crystal, molecules A and B are linked via a pair of intermolecular N—H...O hydrogen bonds, generating an R22(8 ring motif. These ring motifs are further linked into two-dimensional arrays parallel to the bc plane by intermolecular N—H...O and weak C—H...S hydrogen bonds. The crystal is further stablized by weak π–π interactions [centroid–centroid distances = 3.5698 (13 and 3.5287 (12 Å].
Effect of microencapsulated phase change material in sandwich panels
Energy Technology Data Exchange (ETDEWEB)
Castellon, Cecilia; Medrano, Marc; Roca, Joan; Cabeza, Luisa F. [GREA Innovacio Concurrent, Edifici CREA, Universitat de Lleida, Pere de Cabrera s/n, 25001 Lleida (Spain); Navarro, Maria E.; Fernandez, Ana I. [Departamento de Ciencias de los Materiales e Ingenieria Metalurgica, Universitat de Barcelona, Marti i Franques 1, 08028 Barcelona (Spain); Lazaro, Ana; Zalba, Belen [Instituto de Investigacion en Ingenieria de Aragon, I3A, Grupo de Ingenieria Termica y Sistemas Energeticos (GITSE), Dpto. Ingenieria Mecanica, Area de Maquinas y Motores Termicos, Universidad de Zaragoza, Campus Politecnico Rio Ebro, Edificio ' ' Agustin de Betancourt,' ' Maria de Luna s/n, 50018 Zaragoza (Spain)
2010-10-15
Sandwich panels are a good option as building materials, as they offer excellent characteristics in a modular system. The goal of this study was to demonstrate the feasibility of using the microencapsulated PCM (Micronal BASF) in sandwich panels to increase their thermal inertia and to reduce the energy demand of the final buildings. In this paper, to manufacture the sandwich panel with microencapsulated PCM three different methods were tested. In case 1, the PCM was added mixing the microencapsulated PCM with one of the components of the polyurethane. In the other two cases, the PCM was added either a step before (case 2) or a step after (case 3) to the addition of the polyurethane to the metal sheets. The results show that in case 1 the effect of PCM was overlapped by a possible increase in thermal conductivity, but an increase of thermal inertia was found in case 3. In case 2, different results were obtained due to the poor distribution of the PCM. Some samples showed the effect of the PCM (higher thermal inertia), and other samples results were similar to the conventional sandwich panel. In both cases (2 and 3), it is required to industrialize the process to improve the results. (author)
International Nuclear Information System (INIS)
Elgqvist, J.; Boudousq, V.; Bobyk, L.; Busson, M.; Lozza, C.; Navarro-Teulon, I.; Pouget, J.P.; Maquaire, P.; Torgue, J.
2015-01-01
absorbed doses were shown to be higher for 212 Pb-35A7 mAb than for 212 Pb-Trastuzumab (35.5 Gy versus 27.6 Gy, respectively). Investigation of potential relationships between distribution of radioactivity at the tissue level and biological parameters is ongoing. Conclusions: we have investigated the therapeutic efficacy of 212 Pb-labeled mAbs in i.p. α-RIT of small tumors. A higher efficacy per decay, of internalizing versus non-internalizing 212 Pb-labeled mAbs was found. Investigations if a lack of absorbed dose/therapeutic efficacy relationship could be due to heterogeneity in the radioactivity distribution are ongoing. (authors)
Energy Technology Data Exchange (ETDEWEB)
Chen, Jia Nen; Liu, Jun [Tianjin Key Laboratory of the Design and Intelligent Control of the Advanced Mechatronical System, Tianjin University of Technology, Tianjin (China); Zhang, Wei; Yao, Ming Hui [College of Mechanical Engineering, Beijing University of Technology, Beijing (China); Sun, Min [School of Science, Tianjin Chengjian University, Tianjin (China)
2016-09-15
Nonlinear vibrations of carbon fiber reinforced composite sandwich plate with pyramidal truss core are investigated. The governing equation of motion for the sandwich plate is derived by using a Zig-Zag theory under consideration of geometrically nonlinear. The natural frequencies of sandwich plates with different dimensions are calculated and compared with those obtained from the classic laminated plate theory and Reddy's third-order shear deformation plate theory. The frequency responses and waveforms of the sandwich plate when 1:3 internal resonance occurs are obtained, and the characteristics of the internal resonance are discussed. The influences of layer number of face sheet, strut radius, core height and inclination angle on the nonlinear responses of the sandwich plate are analyzed. The results demonstrate that the strut radius and inclination angle mainly affect the resonance frequency band of the sandwich plate, and the layer number and core height not only influence the resonance frequency band but also significantly affect the response amplitude.
Nagane, Motoo; Shimizu, Saki; Mori, Eiji; Kataoka, Shiro; Shiokawa, Yoshiaki
2010-01-01
Tumor necrosis factor–related apoptosis-inducing ligand (TRAIL/Apo2 L) preferentially induces apoptosis in human tumor cells through its cognate death receptors DR4 or DR5, thereby being investigated as a potential agent for cancer therapy. Here, we applied fully human anti-human TRAIL receptor monoclonal antibodies (mAbs) to specifically target one of death receptors for TRAIL in human glioma cells, which could also reduce potential TRAIL-induced toxicity in humans. Twelve human glioma cell lines treated with several fully human anti-human TRAIL receptor mAbs were sensitive to only anti-DR5 mAbs, whereas they were totally insensitive to anti-DR4 mAb. Treatment with anti-DR5 mAbs exerted rapid cytotoxicity and lead to apoptosis induction. The cellular sensitivity was closely associated with cell-surface expression of DR5. Expression of c-FLIPL, Akt, and Cyclin D1 significantly correlated with sensitivity to anti-DR5 mAbs. Primary cultures of glioma cells were also relatively resistant to anti-DR5 mAbs, exhibiting both lower DR5 and higher c-FLIPL expression. Downregulation of c-FLIPL expression resulted in the sensitization of human glioma cells to anti-DR5 mAbs, whereas overexpression of c-FLIPL conferred resistance to anti-DR5 mAb. Treatment of tumor-burden nude mice with the direct agonist anti-DR5 mAb KMTR2 significantly suppressed growth of subcutaneous glioma xenografts leading to complete regression. Similarly, treatment of nude mice bearing intracerebral glioma xenografts with KMTR2 significantly elongated lifespan without tumor recurrence. These results suggest that DR5 is the predominant TRAIL receptor mediating apoptotic signals in human glioma cells, and sensitivity to anti-DR5 mAbs was determined at least in part by the expression level of c-FLIPL and Akt. Specific targeting of death receptor pathway through DR5 using fully human mAbs might provide a novel therapeutic strategy for intractable malignant gliomas. PMID:20511188
Failure Investigation of Debonded Sandwich Columns: An Experimental and Numerical Study
DEFF Research Database (Denmark)
Moslemian, Ramin; Berggreen, Christian; Carlsson, Leif A.
2009-01-01
Failure of compression loaded sandwich columns with an implanted through-width face/core debond is examined. Compression tests were conducted on sandwich columns containing implemented face/core debonds. The strains and out-of-plane displacements of the debonded region were monitored using the di...
Sargianis, James; Kim, Hyung-ick; Suhr, Jonghwan
2012-01-01
Carbon fiber-synthetic foam core sandwich composites are widely used for many structural applications due to their superior mechanical performance and low weight. Unfortunately these structures typically have very poor acoustic performance. There is increasingly growing demand in mitigating this noise issue in sandwich composite structures. This study shows that marrying carbon fiber composites with natural cork in a sandwich structure provides a synergistic effect yielding a noise-free sandwich composite structure without the sacrifice of mechanical performance or weight. Moreover the cork-core sandwich composites boast a 250% improvement in damping performance, providing increased durability and lifetime operation. Additionally as the world seeks environmentally friendly materials, the harvesting of cork is a natural, renewable process which reduces subsequent carbon footprints. Such a transition from synthetic foam cores to natural cork cores could provide unprecedented improvements in acoustic and vibrational performance in applications such as aircraft cabins or wind turbine blades.
Directory of Open Access Journals (Sweden)
C. Tkaczyk
2016-06-01
Full Text Available Staphylococcus aureus produces numerous virulence factors, each contributing different mechanisms to bacterial pathogenesis in a spectrum of diseases. Alpha toxin (AT, a cytolytic pore-forming toxin, plays a key role in skin and soft tissue infections and pneumonia, and a human anti-AT monoclonal antibody (MAb, MEDI4893*, has been shown to reduce disease severity in dermonecrosis and pneumonia infection models. However, interstrain diversity and the complex pathogenesis of S. aureus bloodstream infections suggests that MEDI4893* alone may not provide adequate protection against S. aureus sepsis. Clumping factor A (ClfA, a fibrinogen binding protein, is an important virulence factor facilitating S. aureus bloodstream infections. Herein, we report on the identification of a high-affinity anti-ClfA MAb, 11H10, that inhibits ClfA binding to fibrinogen, prevents bacterial agglutination in human plasma, and promotes opsonophagocytic bacterial killing (OPK. 11H10 prophylaxis reduced disease severity in a mouse bacteremia model and was dependent on Fc effector function and OPK. Additionally, prophylaxis with 11H10 in combination with MEDI4893* provided enhanced strain coverage in this model and increased survival compared to that obtained with the individual MAbs. The MAb combination also reduced disease severity in murine dermonecrosis and pneumonia models, with activity similar to that of MEDI4893* alone. These results indicate that an MAb combination targeting multiple virulence factors provides benefit over a single MAb neutralizing one virulence mechanism by providing improved efficacy, broader strain coverage, and protection against multiple infection pathologies.
Flexural wave attenuation in a sandwich beam with viscoelastic periodic cores
Guo, Zhiwei; Sheng, Meiping; Pan, Jie
2017-07-01
The flexural-wave attenuation performance of traditional constraint-layer damping in a sandwich beam is improved by using periodic constrained-layer damping (PCLD), where the monolithic viscoelastic core is replaced with two periodically alternating viscoelastic cores. Closed-form solutions of the wave propagation constants of the infinite periodic sandwich beam and the forced response of the corresponding finite sandwich structure are theoretically derived, providing computational support on the analysis of attenuation characteristics. In a sandwich beam with PCLD, the flexural waves can be attenuated by both Bragg scattering effect and damping effect, where the attenuation level is mainly dominated by Bragg scattering in the band-gaps and by damping in the pass-bands. Affected by these two effects, when the parameters of periodic cores are properly selected, a sandwich beam with PCLD can effectively reduce vibrations of much lower frequencies than that with traditional constrained-layer damping. The effects of the parameters of viscoelastic periodic cores on band-gap properties are also discussed, showing that the average attenuation in the desired frequency band can be maximized by tuning the length ratio and core thickness to proper values. The research in this paper could possibly provide useful information for the researches and engineers to design damping structures.
Robust and Air-Stable Sandwiched Organo-Lead Halide Perovskites for Photodetector Applications
Mohammed, Omar F.; Banavoth, Murali; Saidaminov, Makhsud I.; Abdelhady, Ahmed L.; Pan, Jun; Liu, Jiakai; Peng, Wei; Bakr, Osman
2016-01-01
We report the simplest possible method to date for fabricating robust, air-stable, sandwiched perovskite photodetectors. Our proposed sandwiched structure is devoid of electron or hole transporting layers and also the expensive electrodes
Magne, Pascal; Silva, Silvana; Andrada, Mauro de; Maia, Hamilton
2016-01-01
To assess the influence of conventional glass ionomer cement (GIC) vs resin-modified GIC (RMGIC) as a base material for novel, super-closed sandwich restorations (SCSR) and its effect on shrinkage-induced crack propensity and in vitro accelerated fatigue resistance. A standardized MOD slottype tooth preparation was applied to 30 extracted maxillary molars (5 mm depth/5 mm buccolingual width). A modified sandwich restoration was used, in which the enamel/dentin bonding agent was applied first (Optibond FL, Kerr), followed by a Ketac Molar (3M ESPE)(group KM, n = 15) or Fuji II LC (GC) (group FJ, n = 15) base, leaving 2 mm for composite resin material (Miris 2, Coltène-Whaledent). Shrinkageinduced enamel cracks were tracked with photography and transillumination. Samples were loaded until fracture or to a maximum of 185,000 cycles under isometric chewing (5 H z), starting with a load of 200 N (5,000 X), followed by stages of 400, 600, 800, 1,000, 1,200, and 1,400 N at a maximum of 30,000 X each. Groups were compared using the life table survival analysis (α = .008, Bonferroni method). Group FJ showed the highest survival rate (40% intact specimens) but did not differ from group KM (20%) or traditional direct restorations (13%, previous data). SCSR generated less shrinkage-induced cracks. Most failures were re-restorable (above the cementoenamel junction [CEJ]). Inclusion of GIC/RMGIC bases under large direct SCSRs does not affect their fatigue strength but tends to decrease the shrinkage-induced crack propensity. The use of GIC/ RMGIC bases and the SCSR is an easy way to minimize polymerization shrinkage stress in large MOD defects without weakening the restoration.
Determination of chromated copper arsenate (CCA) in treated wood of Eucalyptus
International Nuclear Information System (INIS)
Parreira, Paulo S.; Vendrametto, Guilherme R.; Cunha, Magda E.T.
2009-01-01
This work deals with the possible application of a portable energy dispersive handmade system (PXRF-LFNA-02) for the determination of Chromium, Copper and Arsenic in the preservative solution used to protect commercial wood of Eucalyptus, which are employed as wood fence, posts, contention fences, railroad sleepers, etc. It was prepared five body-of-proof made of eucalyptus alburnum with different concentrations for each element varying from 0.0061 to 0.0180 (g/g) for CrO 3 , 0.0024 to 0.0070 (g/g) for CuO and 0.0044 to 0.0129 (g/g) for As 2 O 5 . Four of them were used for calibration curves and one used as reference sample. It was used a commercial CCA (Chromated Copper Arsenate ) solution to prepare the samples. The results show a good linear regression between concentrations and X-rays intensities, after applied the multiple linear regression methodology for interelemental corrections. The values obtained with this methodology were 3.01(kg/m 3 ), 1.18 (kg/m 3 ) e 2.21 (kg/m 3 ) for CrO 3 , CuO and As 2 O 5 , respectively, while the nominal values are 2.90 (kg/m 3 ) for CrO 3 , 1.13 (kg/m 3 ) for CuO and 2.07 (kg/m 3 ) for As 2 O 5 . The ED-XRF (Energy Dispersive X-Rays Fluorescence) is a well established technique with high-speed of analytical procedure and its portable configuration allowing a multielemental, simultaneous and non destructive analyses besides in situ application. (author)
Godfrey, Charlotte L; Mead, Emma J; Daramola, Olalekan; Dunn, Sarah; Hatton, Diane; Field, Ray; Pettman, Gary; Smales, C Mark
2017-08-01
mRNA translation is a key process determining growth, proliferation and duration of a Chinese hamster ovary (CHO) cell culture and influences recombinant protein synthesis rate. During bioprocessing, CHO cells can experience stresses leading to reprogramming of translation and decreased global protein synthesis. Here we apply polysome profiling to determine reprogramming and translational capabilities in host and recombinant monoclonal antibody-producing (mAb) CHO cell lines during batch culture. Recombinant cell lines with the fastest cell specific growth rates were those with the highest global translational efficiency. However, total ribosomal capacity, determined from polysome profiles, did not relate to the fastest growing or highest producing mAb cell line, suggesting it is the ability to utilise available machinery that determines protein synthetic capacity. Cell lines with higher cell specific productivities tended to have elevated recombinant heavy chain transcript copy numbers, localised to the translationally active heavy polysomes. The highest titre cell line was that which sustained recombinant protein synthesis and maintained high recombinant transcript copy numbers in polysomes. Investigation of specific endogenous transcripts revealed a number that maintained or reprogrammed into heavy polysomes, identifying targets for potential cell engineering or those with 5' untranslated regions that might be utilised to enhance recombinant transcript translation. © 2017 The Authors. Biotechnology Journal published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Intelligent CAMAC crate controller with CC-A2 functionality and VICbus interface
International Nuclear Information System (INIS)
Erven, W.; Holzer, J.; Kopp, H.; Loevenich, H.W.; Meiling, W.; Zwoll, K.; Bovier, J.; Re, G.; Worm, F.
1992-01-01
This paper reports that for nuclear physics experiments at the Julich Cooler Synchrotron COSY a data acquisition system is under development. With this background, and in order to enhance existing CAMAC systems, an intelligent CAMAC crate controller with CC-A2 functionality was developed. The main enhancement is the replacement of the Branch Highway with a new standard of inter-crate connection: the VICbus. The other highlights are: optional use of a Motorola 68030 microprocessor as CAMAC list-processor and optimization of CAMAC blocktransfers, optional Ethernet or Cheapernet connection. This controller is commercially available from CES, Geneva and called VCC 2117
DEFF Research Database (Denmark)
Martakos, G.; Andreasen, J. H.; Berggreen, Christian
2017-01-01
A novel crack arresting device has been implemented in sandwich panels and tested using a special rig to apply out-of-plane loading on the sandwich panel face-sheets. Fatigue crack propagation was induced in the face-core interface of the sandwich panels which met the crack arrester. The effect o...
CdBr2 complexes of 1,2-bis-[2-(5-H/methyl/chloro/nitro)-1H-benzimidazolyl]-1,2-ethanediols
International Nuclear Information System (INIS)
Aydin Tavman
2005-01-01
The complexes of 1,2-bis-[2-(5-H/methyl/chloro/nitro)-1H-benzimidazolyl]-1,2-ethanediols with CdBr 2 were synthesized and characterized by elemental analysis, molar conductivity, IR and NMR spectra. The ligands act as a bidentate only through both oxygen atoms of hydroxyl groups in complexes with ratio M:L=1:1 [ru
Crystal structure of [NEt3H]2[TaOF5
International Nuclear Information System (INIS)
Furmanova, N.G.; Verin, I.A.; Zanin, I.E.; Zozulin, A.N.; Il'in, E.G.
1991-01-01
By means of isothermal evaporation of triethylammonium oxofluorotantalate solution crystals are grown and studied by the methods of 19 F NMR spectrocopy and X-ray diffraction analysis. The crystals grown are monoclinic, a=9.926, b=7.906, c=11.657 A, β=90.83 deg, Z=2, sp. gr. P2 1 /n. The structure is composed of [TaOF 5 ] 2- anions and [NEt 3 H] + cations bound with the anions by H-bonds. Only the Van der Waals interaction is realized between the complexes
It All Starts with a Sandwich: Identification of Sialidases with Trans-Glycosylation Activity
DEFF Research Database (Denmark)
Nordvang, Rune Thorbjørn; Nyffenegger, Christian; Holck, Jesper
2016-01-01
structure of two amino acids proximal to the active site of the T. cruzi trans-sialidase infers trans-sialidase activity. On this basis, four enzymes with putative trans-sialidase activity were identified through an iterative alignment from 2909 native sialidases available in GenBank, which were cloned...... and expressed in Escherichia coli. Of these, one enzyme, SialH, derived from Haemophilus parasuis had an aromatic sandwich structure on the protein surface facing the end of the catalytic site (Phe168; Trp366), and was indeed found to exhibit trans-sialidase activity. SialH catalyzed production of the human...... provided data that help understand structure-function relations of trans-sialidases....
Lee, Yi Feng; Jöhnck, Matthias; Frech, Christian
2018-02-21
The efficiencies of mono gradient elution and dual salt-pH gradient elution for separation of six mAb charge and size variants on a preparative-scale ion exchange chromatographic resin are compared in this study. Results showed that opposite dual salt-pH gradient elution with increasing pH gradient and simultaneously decreasing salt gradient is best suited for the separation of these mAb charge and size variants on Eshmuno ® CPX. Besides giving high binding capacity, this type of opposite dual salt-pH gradient also provides better resolved mAb variant peaks and lower conductivity in the elution pools compared to single pH or salt gradients. To have a mechanistic understanding of the differences in mAb variants retention behaviors of mono pH gradient, parallel dual salt-pH gradient, and opposite dual salt-pH gradient, a linear gradient elution model was used. After determining the model parameters using the linear gradient elution model, 2D plots were used to show the pH and salt dependencies of the reciprocals of distribution coefficient, equilibrium constant, and effective ionic capacity of the mAb variants in these gradient elution systems. Comparison of the 2D plots indicated that the advantage of opposite dual salt-pH gradient system with increasing pH gradient and simultaneously decreasing salt gradient is the noncontinuous increased acceleration of protein migration. Furthermore, the fitted model parameters can be used for the prediction and optimization of mAb variants separation in dual salt-pH gradient and step elution. © 2018 American Institute of Chemical Engineers Biotechnol. Prog., 2018. © 2018 American Institute of Chemical Engineers.
Tailoring Sandwich Face/Core Interfaces for Improved Damage Tolerance
DEFF Research Database (Denmark)
Lundsgaard-Larsen, Christian; Berggreen, Christian; Carlsson, Leif A.
2010-01-01
A face/core debond in a sandwich structure may propagate in the interface or kink into either the face or core. It is found that certain modifications of the face/core interface region influence the kinking behavior, which is studied experimentally in the present paper. A sandwich double cantilever....... The transition points where the crack kinks are identified and the influence of four various interface design modifications on the propagation path and fracture resistance are investigated....
Endogenous bile acid disposition in rat and human sandwich-cultured hepatocytes
Energy Technology Data Exchange (ETDEWEB)
Marion, Tracy L., E-mail: tracylmarion@qualyst.com [Curriculum in Toxicology, UNC School of Medicine, The University of North Carolina at Chapel Hill, Chapel Hill, North Carolina 27599-7270 (United States); Perry, Cassandra H., E-mail: cassandraperry@qualyst.com [Qualyst, Inc., Durham, NC 27713 (United States); St Claire, Robert L., E-mail: bobstclaire@qualyst.com [Qualyst, Inc., Durham, NC 27713 (United States); Brouwer, Kim L.R., E-mail: kbrouwer@unc.edu [Division of Pharmacotherapy and Experimental Therapeutics, UNC Eshelman School of Pharmacy, The University of North Carolina at Chapel Hill, CB 7569 Kerr Hall, Chapel Hill, NC 27599-7569 (United States)
2012-05-15
Sandwich-cultured hepatocytes (SCH) are used commonly to investigate hepatic transport protein-mediated uptake and biliary excretion of substrates. However, little is known about the disposition of endogenous bile acids (BAs) in SCH. In this study, four endogenous conjugated BAs common to rats and humans [taurocholic acid (TCA), glycocholic acid (GCA), taurochenodeoxycholic acid (TCDCA), and glycochenodeoxycholic acid (GCDCA)], as well as two BA species specific to rodents (α- and β-tauromuricholic acid; α/β TMCA), were profiled in primary rat and human SCH. Using B-CLEAR{sup ®} technology, BAs were measured in cells + bile canaliculi, cells, and medium of SCH by LC-MS/MS. Results indicated that, just as in vivo, taurine-conjugated BA species were predominant in rat SCH, while glycine-conjugated BAs were predominant in human SCH. Total intracellular BAs remained relatively constant over days in culture in rat SCH. Total BAs in control (CTL) cells + bile, cells, and medium were approximately 3.4, 2.9, and 8.3-fold greater in human than in rat. The estimated intracellular concentrations of the measured total BAs were 64.3 ± 5.9 μM in CTL rat and 183 ± 56 μM in CTL human SCH, while medium concentrations of the total BAs measured were 1.16 ± 0.21 μM in CTL rat SCH and 9.61 ± 6.36 μM in CTL human SCH. Treatment of cells for 24 h with 10 μM troglitazone (TRO), an inhibitor of the bile salt export pump (BSEP) and the Na{sup +}-taurocholate cotransporting polypeptide (NTCP), had no significant effect on endogenous BAs measured at the end of the 24-h culture period, potentially due to compensatory mechanisms that maintain BA homeostasis. These data demonstrate that BAs in SCH are similar to in vivo, and that SCH may be a useful in vitro model to study alterations in BA disposition if species differences are taken into account. -- Highlights: ► Bile acids (BAs) were measured in rat and human sandwich-cultured hepatocytes (SCH). ► Cell and medium BA
Endogenous bile acid disposition in rat and human sandwich-cultured hepatocytes
International Nuclear Information System (INIS)
Marion, Tracy L.; Perry, Cassandra H.; St Claire, Robert L.; Brouwer, Kim L.R.
2012-01-01
Sandwich-cultured hepatocytes (SCH) are used commonly to investigate hepatic transport protein-mediated uptake and biliary excretion of substrates. However, little is known about the disposition of endogenous bile acids (BAs) in SCH. In this study, four endogenous conjugated BAs common to rats and humans [taurocholic acid (TCA), glycocholic acid (GCA), taurochenodeoxycholic acid (TCDCA), and glycochenodeoxycholic acid (GCDCA)], as well as two BA species specific to rodents (α- and β-tauromuricholic acid; α/β TMCA), were profiled in primary rat and human SCH. Using B-CLEAR ® technology, BAs were measured in cells + bile canaliculi, cells, and medium of SCH by LC-MS/MS. Results indicated that, just as in vivo, taurine-conjugated BA species were predominant in rat SCH, while glycine-conjugated BAs were predominant in human SCH. Total intracellular BAs remained relatively constant over days in culture in rat SCH. Total BAs in control (CTL) cells + bile, cells, and medium were approximately 3.4, 2.9, and 8.3-fold greater in human than in rat. The estimated intracellular concentrations of the measured total BAs were 64.3 ± 5.9 μM in CTL rat and 183 ± 56 μM in CTL human SCH, while medium concentrations of the total BAs measured were 1.16 ± 0.21 μM in CTL rat SCH and 9.61 ± 6.36 μM in CTL human SCH. Treatment of cells for 24 h with 10 μM troglitazone (TRO), an inhibitor of the bile salt export pump (BSEP) and the Na + -taurocholate cotransporting polypeptide (NTCP), had no significant effect on endogenous BAs measured at the end of the 24-h culture period, potentially due to compensatory mechanisms that maintain BA homeostasis. These data demonstrate that BAs in SCH are similar to in vivo, and that SCH may be a useful in vitro model to study alterations in BA disposition if species differences are taken into account. -- Highlights: ► Bile acids (BAs) were measured in rat and human sandwich-cultured hepatocytes (SCH). ► Cell and medium BA concentrations
Effect of Different Concentration of Sodium Hydroxide [NaOH] on Kenaf Sandwich Structures
Aziz, M.; Halim, Z.; Othman, M.
2018-01-01
Sandwich panels are structures that made of three layers, low-density core inserted in between thin skin layers. This structures allow the achievement of excellent mechanical performance with low weight, thus this characteristic fulfil requirement to be use in aircraft application. In recent time, sandwich structures have been studied due to it has multifunction properties and lightweight. The aim of this study is to fabricate a composite sandwich structures with biodegradable material for face sheet [skin] where the fibre being treat with different concentration of sodium hydroxide [NaOH] with 10 and 20 hours of soaking time. Kenaf fibre [treated] reinforced epoxy will be used as skins and Nomex honeycomb is chosen to perform as core for this sandwich composite structure. The mechanical properties that are evaluated such as flexural strength and impact energy of kenaf fibre-reinforced epoxy sandwich structures. For flexural test, the optimum flexural strength is 13.4 MPa and impact strength is 18.3 J.
International Nuclear Information System (INIS)
Sardroodi, Jaber Jahanbin; Atabay, Maryam; Azamat, Jafar
2012-01-01
Highlights: ► The osmotic coefficients of the solutions of ionic liquid in ethanol have been measured. ► Measured osmotic coefficients were correlated using Pitzer, e-NRTL and NRF models and polynomial equation. ► Vapour pressures were evaluated from the correlated osmotic coefficients. - Abstract: Osmotic coefficients of the solutions of room temperature ionic liquid N-R-4-(N,N-dimethylamino)pyridinium tetrafluoroborate (R = C 4 H 9 , C 5 H 11 , C 6 H 13 ) in ethanol have been measured at T = 298.15 K by the isopiestic method. The experimental osmotic coefficients have been correlated using the ion interaction model of Pitzer, electrolyte non-random two liquid (e-NRTL) model of Chen, non-random factor (NRF) and a fourth-order polynomial in terms of molality. The vapour pressures of the solutions studied have been evaluated from the osmotic coefficients.
Energy Technology Data Exchange (ETDEWEB)
Zhou, Xin-Hui, E-mail: iamxhzhou@njupt.edu.cn; Chen, Qiang [Nanjing University of Posts and Telecommunications, Key Laboratory for Organic Electronics and Information Displays and Institute of Advanced Materials, National Jiangsu Syngerstic Innovation Center for Advanced Materials (SICAM) (China)
2017-03-15
The title coordination polymer ([Cd{sub 12}(tda){sub 8}(H{sub 2}O){sub 11}] · (H{sub 2}O){sub 6.25}){sub n} (H{sub 3}tda = 1,2,3-triazole-4,5-dicarboxylic acid), has been hydrothermally synthesized and structurally characterized by single-crystal X-ray diffraction. Complex crystallizes in orthorhombic sp. gr. Pmn2{sub 1} with Z = 4. The Cd{sub 2} unit doublebridged by one carboxylate oxygen atom and two neighboring nitrogen atoms from the tda{sup 3–} ligands are linked by the tda{sup 3–}ligands to lead to the 2D (4,4) network in the ac plane. The almost coplanar Cd{sub 2}(μ{sub 5}-tda){sub 2} unit comprised of two Cd ions double-bridged by two tda{sup 3–} ligands through the neighboring nitrogen atoms is connected with the other four Cd{sub 2}(μ{sub 5}-tda){sub 2} units form the undulating 2D network in the ac plane. The (4,4) networks and undulating 2D networks are alternatively connected along the b axis by the tda{sup 3–} ligands coordinating to the Cd ions to form the 3D framework.
Fracture Behaviours in Compression-loaded Triangular Corrugated Core Sandwich Panels
Directory of Open Access Journals (Sweden)
Zaid N.Z.M.
2016-01-01
Full Text Available The failure modes occurring in sandwich panels based on the corrugations of aluminium alloy, carbon fibre-reinforced plastic (CFRP and glass fibre-reinforced plastic (GFRP are analysed in this work. The fracture behaviour of these sandwich panels under compressive stresses is determined through a series of uniform lateral compression performed on samples with different cell wall thicknesses. Compression test on the corrugated-core sandwich panels were conducted using an Instron series 4505 testing machine. The post-failure examinations of the corrugated-core in different cell wall thickness were conducted using optical microscope. Load-displacement graphs of aluminium alloy, GFRP and CFRP specimens were plotted to show progressive damage development with five unit cells. Four modes of failure were described in the results: buckling, hinges, delamination and debonding. Each of these failure modes may dominate under different cell wall thickness or loading condition, and they may act in combination. The results indicate that thicker composites corrugated-core panels tend can recover more stress and retain more stiffness. This analysis provides a valuable insight into the mechanical behaviour of corrugated-core sandwich panels for use in lightweight engineering applications.
Jhung, Michael A; Nelson, Deborah I
2015-02-06
During December 15, 2014-January 16, 2015, the U.S. Department of Agriculture received 14 reports of birds infected with Asian-origin, highly pathogenic avian influenza A (HPAI) (H5N2), (H5N8), and (H5N1) viruses. These reports represent the first reported infections with these viruses in U.S. wild or domestic birds. Although these viruses are not known to have caused disease in humans, their appearance in North America might increase the likelihood of human infection in the United States. Human infection with other avian influenza viruses, such as HPAI (H5N1) and (H5N6) viruses and (H7N9) virus, has been associated with severe, sometimes fatal, disease, usually following contact with poultry.
Numerical simulation of the hole-flanging process for steel-polymer sandwich sheets
Griesel, Dominic; Keller, Marco C.; Groche, Peter
2018-05-01
In light of increasing demand for lightweight structures, hybrid materials are frequently used in load-optimized parts. Sandwich structures like metal-polymer sandwich sheets provide equal bending stiffness as their monolithic counterparts at a drastically reduced weight. In addition, sandwich sheets have noise-damping properties, thus they are well-suited for a large variety of parts, e.g. façade and car body panels, but also load-carrying components. However, due to the creep tendency and low heat resistance of the polymer cores, conventional joining technologies are only applicable to a limited degree. Through hole-flanging it is possible to create branches in sandwich sheets to be used as reinforced joints. While it is state of the art for monolithic materials, hole-flanging of sandwich sheets has not been investigated yet. In order to simulate this process for different material combinations and tool geometries, an axisymmetric model has been developed in the FE software Abaqus/CAE. In the present paper, various modeling strategies for steel-polymer sandwich sheets are examined, including volume elements, shell elements and combinations thereof. Different methods for joining the distinct layers in the FE model are discussed. By comparison with CT scans and optical 3D measurements of experimentally produced hole-flanges, the feasibility of the presented models is evaluated. Although a good agreement of the numerical and experimental results has been achieved, it becomes clear that the classical forming limit diagram (FLD) does not adequately predict failure of the steel skins.
On the use of a woven mat to control the crack path in composite sandwich structures
DEFF Research Database (Denmark)
Lundsgaard-Larsen, Christian; Berggreen, Christian; Carlsson, Leif A.
2008-01-01
tractionsbetween the separated crack surfaces [4, 5]. The outline of a crack propagating under large scale bridging in a sandwich structure can be seen in Figure 1. The fiber bridging mechanism possesses an increased potential damage tolerance capacity for the sandwich structure if it can be predicatively....... The sign of the moment ratio can be reversed by changing the mounting direction of the wire. If moments with opposite signs are applied e.g. M1/M2 = -1, crack opening in the normal direction is dominating (mode I). If moments with the same sign are applied the crack opening in the tangential direction...
Speakman, Lucas D.; Turney, Justin M.; Schaefer, Henry F.
2005-11-01
The existence or nonexistence of GaH5 has been widely discussed [N. M. Mitzel, Angew. Chem. Int. Ed. 42, 3856 (2003)]. Seven possible structures for gallium pentahydride have been systematically investigated using ab initio electronic structure theory. Structures and vibrational frequencies have been determined employing self-consistent field, coupled cluster including all single and double excitations (CCSD), and CCSD with perturbative triples levels of theory, with at least three correlation-consistent polarized-valence-(cc-pVXZ and aug-cc-pVXZ) type basis sets. The X˜A'1 state for GaH5 is predicted to be weakly bound complex 1 between gallane and molecular hydrogen, with Cs symmetry. The dissociation energy corresponding to GaH5→GaH3+H2 is predicted to be De=2.05kcalmol-1. The H-H stretching fundamental is predicted to be v =4060cm-1, compared to the tentatively assigned experimental feature of Wang and Andrews [J. Phys. Chem. A 107, 11371 (2003)] at 4087cm-1. A second Cs structure 2 with nearly equal energy is predicted to be a transition state, corresponding to a 90° rotation of the H2 bond. Thus the rotation of the hydrogen molecule is essentially free. However, hydrogen scrambling through the C2v structure 3 seems unlikely, as the activation barrier for scrambling is at least 30kcalmol-1 higher in energy than that for the dissociation of GaH5 to GaH3 and H2. Two additional structures consisting of GaH3 with a dihydrogen bond perpendicular to gallane (C3v structure 4) and an in-plane dihydrogen bond [Cs(III) structure 5] were also examined. A C3v symmetry second-order saddle point has nearly the same energy as the GaH3+H2 dissociation limit, while the Cs(III) structure 5 is a transition structure to the C3v structure. The C4v structure 6 and the D3h structure 7 are much higher in energy than GaH3+H2 by 88 and 103kcalmol-1, respectively.
Lu, Sharon M; Chang-Halpenny, Christine; Hwang-Graziano, Julie
2015-04-01
To compare the efficacy and tolerance of adjuvant chemotherapy and radiotherapy delivered in sequential (chemotherapy followed by radiation) versus "sandwich" fashion (chemotherapy, interval radiation, and remaining chemotherapy) after surgery in patients with FIGO stage III uterine endometrioid adenocarcinoma. From 2004 to 2011, we identified 51 patients treated at our institution fitting the above criteria. All patients received surgical staging followed by adjuvant chemoradiation (external-beam radiation therapy (EBRT) with or without high-dose rate (HDR) vaginal brachytherapy (VB)). Of these, 73% and 27% of patients received their adjuvant therapy in sequential and sandwich fashion, respectively. There were no significant differences in clinical or pathologic factors between patients treated with either regimen. Thirty-nine (76%) patients had stage IIIC disease. The majority of patients received 6 cycles of paclitaxel with carboplatin or cisplatin. Median EBRT dose was 45 Gy and 54% of patients received HDR VB boost (median dose 21 Gy). There were no significant differences in the estimated 5-year overall survival, local progression-free survival, and distant metastasis-free survival between the sequential and sandwich groups: 87% vs. 77% (p=0.37), 89% vs. 100% (p=0.21), and 78% vs. 85% (p=0.79), respectively. No grade 3-4 genitourinary or gastrointestinal toxicities were reported in either group. There was a trend towards higher incidence of grade 3-4 hematologic toxicity in the sandwich group. Adjuvant chemoradiation for FIGO stage III endometrioid uterine cancer given in either sequential or sandwich fashion appears to offer equally excellent early clinical outcomes and acceptably low toxicity. Copyright © 2015 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Moretta, A.; Poggi, A.; Olive, D.; Bottino, C.; Fortis, C.; Pantaleo, G.; Moretta, L.
1987-01-01
A clone of the interleukin 2-producing Jurkat leukemia cell line termed JA3 (surface phenotype, T3 + , Ti + , T44 + , T11 + , T40 + ) has been used to induce and select cell variants lacking surface molecules involved in T-cell activation. Following 200 rad of γ-radiation (1 rad = 0.01 Gy), cells were treated with monoclonal antibodies (mAbs) directed to T3, Ti, T44, or T11 antigen and complement. After growth of the residual cells in culture, negative cells were cloned under limiting conditions. Depending on the specificity of the mAb used for the immunoselection, three groups of variants were obtained. (i) The use of mAbs directed to T3 or Ti resulted in cell variants that expressed the T3 - Ti - T44 + Leu1 + T11 + T40 + 4F2 + HLA class I + surface phenotype. (ii) Immunoselection with anti-T44 mAb resulted in 2 variants that shared the T3 - Ti - T44 - Leu1 - T11 - T40 - 4F2 - HLA class I + phenotype. (iii) Cell treatment with anti-T11 mAb resulted in 15 variants characterized by the lack of T11 antigen expression and of all the other T-cell-specific surface antigens. Therefore, it appears that the different sets of JA3 cell variants, like T cells at discrete stages of intrathymic differentiation, may follow a coordinated expression of surface differentiation antigens. Analysis of the functional responsiveness of the three distinct groups of JA3 cell variants to different stimuli showed that all produced interleukin 2 in response to A23187 calcium ionophore plus phorbol 12-myristate 13-acetate
STRUCTURE AND THERMAL STABILITY OF THE BENZO-15-CROWN-5 WITH LANTHANUM (III BROMIDE COMPLEX
Directory of Open Access Journals (Sweden)
Muhammad Idiris Saleh
2010-06-01
Full Text Available The reaction of benzo-15-crown-5 (C14H20O5 ligand with La(NO33.7H2O in the presence of HBr has resulted in the production of an exotic sandwich complex, [LaC28H36Br4O10][3Br]. The crystal system is triclinic with space group P1, a = 12.5834(14 Å, b = 13.5816(16 Å, c = 13.8403(16 Å, a = 70.751(2°, b = 66.773(2° and g = 67.631(2°. The cation comprises of the lanthanum atom coordinated to two crowns via three oxygen atoms from each crown in a η3-sandwich fashion. The two phenyl groups of the crown are brominated. The La-OLigand bond lengths are between 2.857(7 and 2.949(7 Å. The trianion [3Br]3- is linear with Br-Br bond lengths of 2.518(2 and 2.560(2 Å respectively. The molecule is stabilized by intermolecular interactions of the type C-H...Br to form dimers and are arranged parallel to bc face. Keywords: lanthanum, benzo-15-crown-5, hydrogen bonding, bromination, x-ray structure
International Nuclear Information System (INIS)
De Almeida, Lucie; Grandjean, Stephane; Abraham, Francis; Rivenet, Murielle; Patisson, Fabrice
2014-01-01
New hydrazinium lanthanide oxalates N_2H_5[Ln_2(C_2O_4)_4(N_2H_5)].4H_2O, Ln = Ce (Ce-H_yO_x) and Nd (Nd- H_yO_x), were synthesized by hydrothermal reaction at 150 C between lanthanide nitrate, oxalic acid and hydrazine solutions. The structure of the Nd compound was determined from single-crystal X-ray diffraction data, space group P2_1/c with a = 16.315(4), b = 12.127(3), c = 11.430(2) Angstroms, β = 116.638(4) degrees, V = 2021.4(7) Angstroems"3, Z = 4, and R1 = 0.0313 for 4231 independent reflections. Two distinct neodymium polyhedra are formed, NdO_9 and NdO_8N, an oxygen of one monodentate oxalate in the former being replaced by a nitrogen atom of a coordinated hydrazinium ion in the latter. The infrared absorption band at 1005 cm"-"1 confirms the coordination of N_2H_5"+ to the metal. These polyhedra are connected through μ"2 and μ"3 oxalate ions to form an anionic three-dimensional neodymium-oxalate arrangement. A non-coordinated charge-compensating hydrazinium ion occupies, with water molecules, the resulting tunnels. The N-N stretching frequencies of the infrared spectra demonstrate the existence of the two types of hydrazine ions. Thermal reactivity of these hydrazinium oxalates and of the mixed isotypic Ce/Nd (CeNd-H_yO_x) oxalate were studied by using thermogravimetric and differential thermal analyses coupled with gas analyzers, and high temperature X-ray diffraction. Under air, fine particles of CeO_2 and Ce_0_._5Nd_0_._5O_1_._7_5 are formed at low temperature from Ce-H_yO_x and CeNd-H_yO_x, respectively, thanks to a decomposition/oxidation process. Under argon flow, dioxy-mono-cyanamides Ln_2O_2CN_2 are formed. (authors)
International Nuclear Information System (INIS)
Horvath, J.
1993-01-01
The relationship between gravity sag of a precision cathode strip chamber and its sandwich panel structural design is explored parametrically. An algorithm for estimating the dominant component of gravity sag is defined. Graphs of normalized gravity sag as a function of gap frame width and material, sandwich core edge filler width and material, panel skin thickness, gap height, and support location are calculated using the gravity sag algorithm. The structural importance of the sandwich-to-sandwich ''gap frame'' connection is explained
Functional grading of metal foam cores for yield-limited lightweight sandwich beams
International Nuclear Information System (INIS)
Conde, Yves; Pollien, Arnaud; Mortensen, Andreas
2006-01-01
We show that grading the porosity in a bent metal skin/metal foam core sandwich can generate significant weight savings in yield-limited design when, and only when, there is a gradient in the applied moment along the sandwich beam
International Nuclear Information System (INIS)
Manalo, Allan; Aravinthan, Thiru
2012-01-01
Highlights: ► Fibre Model Analysis is used to examine the flexural behaviour of sandwich beams. ► Theoretical prediction using FMA is in good agreement with the experiment. ► Using the constituent materials in FMA predicted accurately the beam’s behaviour. ► FMA can be used for analysing sandwich beams with high-strength core in flexure. -- Abstract: The behaviour of glued composite sandwich beams in flexure was investigated with a view of using this material for structural and civil engineering applications. The building block of this glue-laminated beam is a new generation composite sandwich structure made up of glass fibre reinforced polymer skins and a high strength phenolic core material. A simplified Fibre Model Analysis (FMA) usually used to analyse a concrete beam section is adopted to theoretically describe the flexural behaviour of the innovative sandwich beam structure. The analysis included the flexural behaviour of the glued sandwich beams in the flatwise and the edgewise positions. The FMA accounted for the non-linear behaviour of the phenolic core in compression, the cracking of the core in tension and the linear elastic behaviour of the fibre composite skin. The results of the FMA showed a good agreement with the experimental data showing the efficiency and practical applications of the simplified FMA in analysing and designing sandwich structures with high strength core material.
International Nuclear Information System (INIS)
Vaqueiro, Paz
2006-01-01
Two new main group metal sulphides, [C 1 N 4 H 26 ] 0.5 [InS 2 ] (1) and [C 1 N 4 H 26 ] 0.5 [GaS 2 ] (2) have been prepared solvothermally in the presence of 1,4-bis(3-aminopropyl)piperazine and their crystal structures determined by single-crystal X-ray diffraction. Both compounds are isostructural and crystallise in the monoclinic space group P2 1 /n (Z=4), with a=6.5628(5), b=11.2008(9), c=12.6611(9) A and β=94.410(4) o (wR=0.035) for compound (1) and a=6.1094(5), b=11.2469(9), c=12.7064(10) A and β=94.313(4) o (wR=0.021) for compound (2). The structure of [C 1 N 4 H 26 ] 0.5 [MS 2 ] (M=In,Ga) consists of one-dimensional [MS 2 ] - chains which run parallel to the crystallographic a axis and are separated by diprotonated amine molecules. These materials represent the first example of solvothermally prepared one-dimensional gallium and indium sulphides. -- Graphical abstract: [C 1 N 4 H 26 ] 0.5 [InS 2 ] and [C 1 N 4 H 26 ] 0.5 [GaS 2 ], prepared under solvothermal conditions, consist of one-dimensional [MS 2 ] - chains separated by diprotonated 1,4-bis(3-aminopropyl)piperazine molecules
Nitrogen-rich salts of 5,5‧-bistetrazole-1,1‧-diolate: Syntheses, structures and properties
Yang, Ting; Zhang, Jian-Guo; Zhang, Zhi-Bin; Gozin, Michael
2018-03-01
A series of new nitrogen-rich energetic salts containing 1H,1‧H-[5,5‧-bitetrazole]-1,1‧-diol (BTO) anion and ethane-1,2-diaminium (1), 1-amino-1H-1,2,3-triazol-3-ium (2), 4-amino-4H-1,2,4-triazol-1-ium (3) and 4,5-diamino-4H-1,2,4-triazol-1-ium (4) cations were synthesized by direct salt formation or by metathesis strategy. The structures of energetic salts 1-4 were comprehensively characterized by elemental analysis, mass spectrometry, IR and NMR spectroscopies and by X-ray crystallography. DSC and TGA methods were used to study thermal properties of these salts. Additionally, the non-isothermal kinetic parameters and thermodynamic parameters were calculated by utilizing the Kissinger's and Ozawa-Doyle's methods. The enthalpies of formation for all target compounds in this study were calculated, and their sensitivity to mechanical impact and friction was tested according to BAM guidelines. We found these new energetic salts exhibit good thermal stability and have typical decomposition temperatures above 230 °C, except for the salt 2. All our salts have highly-positive enthalpies of formation (311.1-473.6 kJ mol-1) and are insensitive to impact and friction stimuli (>40 J, 120 N). With a high nitrogen-rich content, high enthalpy of formation, good thermostability and very low sensitivity to impact, some of these new salts may have a potential for application in the field of environmentally friendly insensitive energetic materials.
Energy Technology Data Exchange (ETDEWEB)
Kelly, Rory P.; Scopelliti, Rosario; Mazzanti, Marinella [Institut des Sciences et Ingenierie Chimiques, Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Maron, Laurent [Laboratoire de Physique et Chimie des Nano-objets, Institut National des Sciences Appliquees, Toulouse (France)
2017-12-04
Organometallic multi-decker sandwich complexes containing f-elements remain rare, despite their attractive magnetic and electronic properties. The reduction of the Ce{sup III} siloxide complex, [KCeL{sub 4}] (1; L=OSi(OtBu){sub 3}), with excess potassium in a THF/toluene mixture afforded a quadruple-decker arene-bridged complex, [K(2.2.2-crypt)]{sub 2}[{(KL_3Ce)(μ-η"6:η"6-C_7H_8)}{sub 2}Ce] (3). The structure of 3 features a [Ce(C{sub 7}H{sub 8}){sub 2}] sandwich capped by [KL{sub 3}Ce] moieties with a linear arrangement of the Ce ions. Structural parameters, UV/Vis/NIR data, and DFT studies indicate the presence of Ce{sup II} ions involved in δ bonding between the Ce cations and toluene dianions. Complex 3 is a rare lanthanide multi-decker complex and the first containing non-classical divalent lanthanide ions. Moreover, oxidation of 1 by AgOTf (OTf=O{sub 3}SCF{sub 3}) yielded the Ce{sup IV} complex, [CeL{sub 4}] (2), showing that siloxide ligands can stabilize Ce in three oxidation states. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Applications of thin-film sandwich crystallization platforms
Energy Technology Data Exchange (ETDEWEB)
Axford, Danny, E-mail: danny.axford@diamond.ac.uk; Aller, Pierre; Sanchez-Weatherby, Juan; Sandy, James [Diamond Light Source, Harwell Oxford, Didcot OX11 0DE (United Kingdom)
2016-03-24
Crystallization via sandwiches of thin polymer films is presented and discussed. Examples are shown of protein crystallization in, and data collection from, solutions sandwiched between thin polymer films using vapour-diffusion and batch methods. The crystallization platform is optimal for both visualization and in situ data collection, with the need for traditional harvesting being eliminated. In wells constructed from the thinnest plastic and with a minimum of aqueous liquid, flash-cooling to 100 K is possible without significant ice formation and without any degradation in crystal quality. The approach is simple; it utilizes low-cost consumables but yields high-quality data with minimal sample intervention and, with the very low levels of background X-ray scatter that are observed, is optimal for microcrystals.
Uddin, Md. Hafiz; Li, Shunyu; Jin, Yan; Choi, Min-Ho; Jang, Ja June; Hong, Sung-Tae
2016-01-01
Clonorchis sinensis is a Group-I bio-carcinogen, associated with cholangiocarcinoma (CCA). The hamster is the only experimental model of C. sinensis-mediated CCA, but we oblige another animal model. The present study intended to develop a C. sinensis (Cs) mediated CCA model using C3H/He mice, co-stimulated with N-nitrosodimethyl-amine (NDMA) and dicyclanil (DC). The mice were divided into 8 groups with different combinations of Cs, NDMA, and DC. Six months later the mice were sacrificed and subjected to gross and histopathological examination. The body weights were significantly reduced among the groups treated with 2 or more agents (eg. Cs+NDMA, Cs+DC, NDMA+DC, and Cs+NDMA+DC). In contrast, liver weight percentages to body weight were increased in above groups by 4.1% to 4.7%. A Change of the spleen weight was observed only in Cs+NDMA group. Though C. sinensis infection is evident from hyperplastic changes, only 1 worm was recovered. T wo mice, 1 from Cs and the other from Cs+DC group, showed mass forming lesions; 1 (281.2 mm3) from the Cs group was a hepatocellular adenoma and the other (280.6 mm3) from the Cs+DC group was a cystic mass (peliosis). Higher prevalence of gray-white nodules was observed in Cs group (42.9%) followed by Cs+NDMA+DC group (21.4%). The mice of the Cs+NDMA+DC group showed hyper-proliferation of the bile duct with fibrotic changes. No characteristic change for CCA was recognized in any of the groups. In conclusion, C3H/He mice produce no CCA but extensive fibrosis when they are challenged by Cs, NDMA, and DC together. PMID:27417082
Uddin, Md Hafiz; Li, Shunyu; Jin, Yan; Choi, Min-Ho; Jang, Ja June; Hong, Sung-Tae
2016-06-01
Clonorchis sinensis is a Group-I bio-carcinogen, associated with cholangiocarcinoma (CCA). The hamster is the only experimental model of C. sinensis-mediated CCA, but we oblige another animal model. The present study intended to develop a C. sinensis (Cs) mediated CCA model using C3H/He mice, co-stimulated with N-nitrosodimethyl-amine (NDMA) and dicyclanil (DC). The mice were divided into 8 groups with different combinations of Cs, NDMA, and DC. Six months later the mice were sacrificed and subjected to gross and histopathological examination. The body weights were significantly reduced among the groups treated with 2 or more agents (eg. Cs+NDMA, Cs+DC, NDMA+DC, and Cs+NDMA+DC). In contrast, liver weight percentages to body weight were increased in above groups by 4.1% to 4.7%. A Change of the spleen weight was observed only in Cs+NDMA group. Though C. sinensis infection is evident from hyperplastic changes, only 1 worm was recovered. T wo mice, 1 from Cs and the other from Cs+DC group, showed mass forming lesions; 1 (281.2 mm(3)) from the Cs group was a hepatocellular adenoma and the other (280.6 mm(3)) from the Cs+DC group was a cystic mass (peliosis). Higher prevalence of gray-white nodules was observed in Cs group (42.9%) followed by Cs+NDMA+DC group (21.4%). The mice of the Cs+NDMA+DC group showed hyper-proliferation of the bile duct with fibrotic changes. No characteristic change for CCA was recognized in any of the groups. In conclusion, C3H/He mice produce no CCA but extensive fibrosis when they are challenged by Cs, NDMA, and DC together.
High performance sandwich structured Si thin film anodes with LiPON coating
Luo, Xinyi; Lang, Jialiang; Lv, Shasha; Li, Zhengcao
2018-04-01
The sandwich structured silicon thin film anodes with lithium phosphorus oxynitride (LiPON) coating are synthesized via the radio frequency magnetron sputtering method, whereas the thicknesses of both layers are in the nanometer range, i.e. between 50 and 200 nm. In this sandwich structure, the separator simultaneously functions as a flexible substrate, while the LiPON layer is regarded as a protective layer. This sandwich structure combines the advantages of flexible substrate, which can help silicon release the compressive stress, and the LiPON coating, which can provide a stable artificial solidelectrolyte interphase (SEI) film on the electrode. As a result, the silicon anodes are protected well, and the cells exhibit high reversible capacity, excellent cycling stability and good rate capability. All the results demonstrate that this sandwich structure can be a promising option for high performance Si thin film lithium ion batteries.
Photocatalytic perfermance of sandwich-like BiVO{sub 4} sheets by microwave assisted synthesis
Energy Technology Data Exchange (ETDEWEB)
Liu, Suqin, E-mail: liusuqin888@126.com [Department of Chemical engineering and Food Science, Hubei University of arts and science, Xiangyang 441053 (China); Hubei Key Laboratory of Low Dimensional Optoelectronic Materials and Devices, Xiangyang 441053 (China); Tang, Huiling; Zhou, Huan [Department of Chemical engineering and Food Science, Hubei University of arts and science, Xiangyang 441053 (China); Dai, Gaopeng, E-mail: dgp2000@126.com [Department of Chemical engineering and Food Science, Hubei University of arts and science, Xiangyang 441053 (China); Wang, Wanqiang [Department of Chemical engineering and Food Science, Hubei University of arts and science, Xiangyang 441053 (China)
2017-01-01
Graphical abstract: Sandwich-like BiVO{sub 4} sheets were successfully synthesized via a facile microwave-assisted method. The as-prepared samples exhibit a high activity for the degradation of methyl orange under visible light irradiation. - Highlights: • Sandwich-like BiVO{sub 4} sheets were synthesized by a facile microwave-assisted method. • The presence of PEG-10000 plays a critical role in the formation of BiVO{sub 4} sheets. • Ostwald ripening is the primary driving force for the formation of sandwich-like BiVO{sub 4}. • The sandwich-like BiVO{sub 4} sheets exhibit a high visible-light photocatalytic activity. - Abstract: Sandwich-like BiVO{sub 4} sheets were successfully synthesized in an aqueous solution containing bismuth nitrate, ammonium metavanadate and polyethylene glycol with a molecular weight of 10,000 (PEG-10000) using a facile microwave-assisted method. The as-prepared samples were characterized by scanning electron microscopy, N{sub 2} adsorption-desorption, X-ray diffraction, X-ray photoelectron spectroscopy (XPS), and UV–vis diffuse reflectance spectroscopy. The results show that the presence of PEG-10000 plays a critical role in the formation of BiVO{sub 4} sheets, and Ostwald ripening is the primary driving force for the formation of sandwich-like structures. The sandwich-like BiVO{sub 4} sheets exhibit a high activity for the degradation of methyl orange under visible light irradiation (λ ≥ 420 nm). The enhancement of photocatalytic activity of sandwich-like BiVO{sub 4} sheets can be attributed to its large surface area over the irregular BiVO{sub 4} particles.
First line shape analysis and spectroscopic parameters for the ν11 band of 12C2H4
Es-sebbar, Et-touhami
2016-08-11
An accurate knowledge of line intensities, collisional broadening coefficients and narrowing parameters is necessary for the interpretation of high-resolution infrared spectra of the Earth and other planetary atmospheres. One of the most promising spectral domains for (C2H4)-C-12 monitoring in such environments is located near the 336 gm window, through its v(11) C-H stretching mode. In this paper, we report an extensive study in which we precisely determine spectroscopic parameters of (C2H4)-C-12 v(11) band at 297 +/- 1 K, using a narrow Difference-Frequency-Generation (DFG) laser with 10(-4) cm(-1) resolution. Absorption measurements were performed in the 2975-2980 cm(-1) spectral window to investigate 32 lines corresponding to where, J\\'ka\\',kc\\'<- Jka,kc, 5 <= J <= 7; 0.5 <= K-a <= 6 and 1 <= K-c <= 14. Spectroscopic parameters are retrieved using either Voigt or appropriate Galatry profile to simulate the measured (C2H4)-C-12 line shape. Line intensities along with self-broadening coefficients are reported for all lines. Narrowing coefficients for each isolated line are also derived. To our knowledge, the current study reports the first extensive spectroscopic parameter measurements of the (C2H4)-C-12 v(11) band in the 2975-2980 cm(-1) range. (C) 2016 Elsevier Ltd. All rights reserved.
First line shape analysis and spectroscopic parameters for the ν11 band of 12C2H4
Es-sebbar, Et-touhami; Mantzaras, John; Benilan, Yves; Farooq, Aamir
2016-01-01
An accurate knowledge of line intensities, collisional broadening coefficients and narrowing parameters is necessary for the interpretation of high-resolution infrared spectra of the Earth and other planetary atmospheres. One of the most promising spectral domains for (C2H4)-C-12 monitoring in such environments is located near the 336 gm window, through its v(11) C-H stretching mode. In this paper, we report an extensive study in which we precisely determine spectroscopic parameters of (C2H4)-C-12 v(11) band at 297 +/- 1 K, using a narrow Difference-Frequency-Generation (DFG) laser with 10(-4) cm(-1) resolution. Absorption measurements were performed in the 2975-2980 cm(-1) spectral window to investigate 32 lines corresponding to where, J'ka',kc'<- Jka,kc, 5 <= J <= 7; 0.5 <= K-a <= 6 and 1 <= K-c <= 14. Spectroscopic parameters are retrieved using either Voigt or appropriate Galatry profile to simulate the measured (C2H4)-C-12 line shape. Line intensities along with self-broadening coefficients are reported for all lines. Narrowing coefficients for each isolated line are also derived. To our knowledge, the current study reports the first extensive spectroscopic parameter measurements of the (C2H4)-C-12 v(11) band in the 2975-2980 cm(-1) range. (C) 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Dyah Ayu Hewajuli
2014-05-01
Full Text Available H5N1 subtype Avian Influenza (AI virus is the causal agent of AI disease in humans. In Indonesia,the first human AI occurred in Tangerang 2005. Human AI in Indonesia has now spread into 12 provinces,including West Java, Jakarta, Banten, North Sumatra, East Java, Central Java, Lampung, South Sulawesi,West Sumatra, South Sumatra, Riau, and Bali. Until 2011, the total human AI cases were 182 cases with150 deaths. This study was conducted to identify of H5N1 AI virus in birds in area surrounding a humanAI human case in Bekasi city in March 2011 and to investigate its role in the spread of AI to humans usingmethods of Hemaglutination Inhibition (HI , and Reverse Transcriptase-Polymerase Chain Reaction(RT-PCR. The result showed that 80% of birds in the area surrounding AI surrounding H5N1 AI humancase in Bekasi 2011 were antibody negative against H5N1-AI virus. Antibody against H5N1-AI viruswith the titer less than 4 log 2 was detected in 4.4% of birds and with antibody titer 04 4-7 log 2 in 15%of birds. By RT-PCR, H5N1 AI virus was not detected in 47.6% of bird samples. H5 positive and N1negative AI virus was detected in 30.2% samples. Only 11.2% samples showed positive for H5N1 AI virus.The results suggest that H5N1-AI virus affecting birds may have a positive role in transmitting to thevirus to human in Bekasi 2011.
High renewable content sandwich structures based on flax-basalt hybrids and biobased epoxy polymers
Colomina, S.; Boronat, T.; Fenollar, O.; Sánchez-Nacher, L.; Balart, R.
2014-05-01
In the last years, a growing interest in the development of high environmental efficiency materials has been detected and this situation is more accentuated in the field of polymers and polymer composites. In this work, green composite sandwich structures with high renewable content have been developed with core cork materials. The base resin for composites was a biobased epoxy resin derived from epoxidized vegetable oils. Hybrid basalt-flax fabrics have been used as reinforcements for composites and the influence of the stacking sequence has been evaluated in order to optimize the appropriate laminate structure for the sandwich bases. Core cork materials with different thickness have been used to evaluate performance of sandwich structures thus leading to high renewable content composite sandwich structures. Results show that position of basalt fabrics plays a key role in flexural fracture of sandwich structures due to differences in stiffness between flax and basalt fibers.
Wu, Zhongbin; Sun, Ning; Zhu, Liping; Sun, Hengda; Wang, Jiaxiu; Yang, Dezhi; Qiao, Xianfeng; Chen, Jiangshan; Alshehri, Saad M; Ahamad, Tansir; Ma, Dongge
2016-02-10
It has been demonstrated that the efficiency roll-off is generally caused by the accumulation of excitons or charge carriers, which is intimately related to the emissive layer (EML) architecture in organic light-emitting diodes (OLEDs). In this article, an efficient sandwich-type EML structure with a mixed-host EML sandwiched between two single-host EMLs was designed to eliminate this accumulation, thus simultaneously achieving high efficiency, low efficiency roll-off and good operational stability in the resulting OLEDs. The devices show excellent electroluminescence performances, realizing a maximum external quantum efficiency (EQE) of 24.6% with a maximum power efficiency of 105.6 lm W(-1) and a maximum current efficiency of 93.5 cd A(-1). At the high brightness of 5,000 cd m(-2), they still remain as high as 23.3%, 71.1 lm W(-1), and 88.3 cd A(-1), respectively. And, the device lifetime is up to 2000 h at initial luminance of 1000 cd m(-2), which is significantly higher than that of compared devices with conventional EML structures. The improvement mechanism is systematically studied by the dependence of the exciton distribution in EML and the exciton quenching processes. It can be seen that the utilization of the efficient sandwich-type EML broadens the recombination zone width, thus greatly reducing the exciton quenching and increasing the probability of the exciton recombination. It is believed that the design concept provides a new avenue for us to achieve high-performance OLEDs.
Ko, William L.; Jackson, Raymond H.
1991-01-01
Combined compressive and shear buckling analysis was conducted on flat rectangular sandwich panels with the consideration of transverse shear effects of the core. The sandwich panel is fabricated with titanium honeycomb core and laminated metal matrix composite face sheets. The results show that the square panel has the highest combined load buckling strength, and that the buckling strength decreases sharply with the increases of both temperature and panel aspect ratio. The effect of layup (fiber orientation) on the buckling strength of the panels was studied in detail. The metal matrix composite sandwich panel was much more efficient than the sandwich panel with nonreinforced face sheets and had the same specific weight.
Energy Technology Data Exchange (ETDEWEB)
Takaoka, Yuki [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan); Kawamoto, Seiji, E-mail: skawa@hiroshima-u.ac.jp [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan); Katayama, Akiko [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan); Nakano, Toshiaki [Liver Transplantation Program, Chang Gung Memorial Hospital-Kaohsiung Medical Center, Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Yamanaka, Yasushi; Takahashi, Miki [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan); Shimada, Yayoi; Chiang, Kuei-Chen [Kazusa Institute for Drug Discovery, Josai International University, Kisarazu (Japan); Ohmori, Naoya [Kazusa Institute for Drug Discovery, Josai International University, Kisarazu (Japan); Faculty of Nursing, Josai International University, Togane (Japan); Aki, Tsunehiro [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan); Goto, Takeshi; Sato, Shuji [Kazusa Institute for Drug Discovery, Josai International University, Kisarazu (Japan); Faculty of Nursing, Josai International University, Togane (Japan); Goto, Shigeru [Liver Transplantation Program, Chang Gung Memorial Hospital-Kaohsiung Medical Center, Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Iwao Hospital, Yufuin (Japan); Chen, Chao-Long [Liver Transplantation Program, Chang Gung Memorial Hospital-Kaohsiung Medical Center, Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Ono, Kazuhisa [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, Higashi-Hiroshima (Japan)
2013-02-08
Highlights: ► Anti-histone H1 autoantibody (anti-H1) acts on T cells to inhibit their activation. ► Anti-H1 suppresses T cell activation in Treg cell-dependent and -independent manners. ► Suboptimal dose of anti-H1 enhances suppressor function of Treg cells. ► High dose of anti-H1 directly inhibits T cell receptor signaling. -- Abstract: Induction of anti-nuclear antibodies against DNA or histones is a hallmark of autoimmune disorders, but their actual contribution to disease predisposition remains to be clarified. We have previously reported that autoantibodies against histone H1 work as a critical graft survival factor in a rat model of tolerogeneic liver transplantation. Here we show that an immunosuppressive anti-histone H1 monoclonal antibody (anti-H1 mAb) acts directly on T cells to inhibit their activation in response to T cell receptor (TCR) ligation. Intriguingly, the T cell activation inhibitory activity of anti-H1 mAb under suboptimal dosages required regulatory T (Treg) cells, while high dose stimulation with anti-H1 mAb triggered a Treg cell-independent, direct negative regulation of T cell activation upon TCR cross-linking. In the Treg cell-dependent mode of immunosuppressive action, anti-H1 mAb did not induce the expansion of CD4{sup +}Foxp3{sup +} Treg cells, but rather potentiated their regulatory capacity. These results reveal a previously unappreciated T cell regulatory role of anti-H1 autoantibody, whose overproduction is generally thought to be pathogenic in the autoimmune settings.
International Nuclear Information System (INIS)
Takaoka, Yuki; Kawamoto, Seiji; Katayama, Akiko; Nakano, Toshiaki; Yamanaka, Yasushi; Takahashi, Miki; Shimada, Yayoi; Chiang, Kuei-Chen; Ohmori, Naoya; Aki, Tsunehiro; Goto, Takeshi; Sato, Shuji; Goto, Shigeru; Chen, Chao-Long; Ono, Kazuhisa
2013-01-01
Highlights: ► Anti-histone H1 autoantibody (anti-H1) acts on T cells to inhibit their activation. ► Anti-H1 suppresses T cell activation in Treg cell-dependent and -independent manners. ► Suboptimal dose of anti-H1 enhances suppressor function of Treg cells. ► High dose of anti-H1 directly inhibits T cell receptor signaling. -- Abstract: Induction of anti-nuclear antibodies against DNA or histones is a hallmark of autoimmune disorders, but their actual contribution to disease predisposition remains to be clarified. We have previously reported that autoantibodies against histone H1 work as a critical graft survival factor in a rat model of tolerogeneic liver transplantation. Here we show that an immunosuppressive anti-histone H1 monoclonal antibody (anti-H1 mAb) acts directly on T cells to inhibit their activation in response to T cell receptor (TCR) ligation. Intriguingly, the T cell activation inhibitory activity of anti-H1 mAb under suboptimal dosages required regulatory T (Treg) cells, while high dose stimulation with anti-H1 mAb triggered a Treg cell-independent, direct negative regulation of T cell activation upon TCR cross-linking. In the Treg cell-dependent mode of immunosuppressive action, anti-H1 mAb did not induce the expansion of CD4 + Foxp3 + Treg cells, but rather potentiated their regulatory capacity. These results reveal a previously unappreciated T cell regulatory role of anti-H1 autoantibody, whose overproduction is generally thought to be pathogenic in the autoimmune settings
Impact damage in aircraft composite sandwich panels
Mordasky, Matthew D.
An experimental study was conducted to develop an improved understanding of the damage caused by runway debris and environmental threats on aircraft structures. The velocities of impacts for stationary aircraft and aircraft under landing and takeoff speeds was investigated. The impact damage by concrete, asphalt, aluminum, hail and rubber sphere projectiles was explored in detail. Additionally, a kinetic energy and momentum experimental study was performed to look at the nature of the impacts in more detail. A method for recording the contact force history of the impact by an instrumented projectile was developed and tested. The sandwich composite investigated was an IM7-8552 unidirectional prepreg adhered to a NOMEXRTM core with an FM300K film adhesive. Impact experiments were conducted with a gas gun built in-house specifically for delivering projectiles to a sandwich composite target in this specic velocity regime (10--140 m/s). The effect on the impact damage by the projectile was investigated by ultrasonic C-scan, high speed camera and scanning electron and optical microscopy. Ultrasonic C-scans revealed the full extent of damage caused by each projectile, while the high speed camera enabled precise projectile velocity measurements that were used for striking velocity, kinetic energy and momentum analyses. Scanning electron and optical images revealed specific features of the panel failure and manufacturing artifacts within the lamina and honeycomb core. The damage of the panels by different projectiles was found to have a similar damage area for equivalent energy levels, except for rubber which had a damage area that increased greatly with striking velocity. Further investigation was taken by kinetic energy and momentum based comparisons of 19 mm diameter stainless steel sphere projectiles in order to examine the dominating damage mechanisms. The sandwich targets were struck by acrylic, aluminum, alumina, stainless steel and tungsten carbide spheres of the
Precast concrete sandwich panels subjected to impact loading
Runge, Matthew W.
Precast concrete sandwich panels are a relatively new product in the construction industry. The design of these panels incorporates properties that allow for great resilience against temperature fluctuation as well as the very rapid and precise construction of facilities. The concrete sandwich panels investigated in this study represent the second generation of an ongoing research and development project. This second generation of panels have been engineered to construct midsized commercial buildings up to three stories in height as well as residential dwellings. The panels consist of a double-tee structural wythe, a foam core and a fascia wythe, joined by shear connectors. Structures constructed from these panels may be subjected to extreme loading including the effects of seismic and blast loading in addition to wind. The aim of this work was to investigate the behaviour of this particular sandwich panel when subjected to structural impact events. The experimental program consisted of fourteen concrete sandwich panels, five of which were considered full-sized specimens (2700 mm X 1200mm X 270 mm) and nine half-sized specimens (2700mm X 600mm X 270 mm) The panels were subjected to impact loads from a pendulum impact hammer where the total energy applied to the panels was varied by changing the mass of the hammer. The applied loads, displacements, accelerations, and strains at the mid-span of the panel as well as the reaction point forces were monitored during the impact. The behaviour of the panels was determined primarily from the experimental results. The applied loads at low energy levels that caused little to no residual deflection as well as the applied loads at high energy levels that represent catastrophic events and thus caused immediate failure were determined from an impact on the structural and the fascia wythes. Applied loads at intermediate energy levels representing extreme events were also used to determine whether or not the panels could withstand
Determination of chromated copper arsenate (CCA) in treated wood of Eucalyptus
Energy Technology Data Exchange (ETDEWEB)
Parreira, Paulo S., E-mail: parreira@uel.b [Universidade Estadual de Londrina (UEL), PR (Brazil). Dept. de Fisica. Lab.de Fisica Nuclear Aplicada; Vendrametto, Guilherme R.; Cunha, Magda E.T., E-mail: grvendrametto@gmail.co [Universidade Norte do Parana, Arapongas, PR (Brazil). Centro de Ciencias Humanas, da Saude, Exatas e Tecnologicas-A
2009-07-01
This work deals with the possible application of a portable energy dispersive handmade system (PXRF-LFNA-02) for the determination of Chromium, Copper and Arsenic in the preservative solution used to protect commercial wood of Eucalyptus, which are employed as wood fence, posts, contention fences, railroad sleepers, etc. It was prepared five body-of-proof made of eucalyptus alburnum with different concentrations for each element varying from 0.0061 to 0.0180 (g/g) for CrO{sub 3}, 0.0024 to 0.0070 (g/g) for CuO and 0.0044 to 0.0129 (g/g) for As{sub 2}O{sub 5}. Four of them were used for calibration curves and one used as reference sample. It was used a commercial CCA (Chromated Copper Arsenate ) solution to prepare the samples. The results show a good linear regression between concentrations and X-rays intensities, after applied the multiple linear regression methodology for interelemental corrections. The values obtained with this methodology were 3.01(kg/m{sup 3}), 1.18 (kg/m{sup 3}) e 2.21 (kg/m{sup 3}) for CrO{sub 3}, CuO and As{sub 2}O{sub 5}, respectively, while the nominal values are 2.90 (kg/m{sup 3}) for CrO{sub 3}, 1.13 (kg/m{sup 3}) for CuO and 2.07 (kg/m{sup 3}) for As{sub 2}O{sub 5}. The ED-XRF (Energy Dispersive X-Rays Fluorescence) is a well established technique with high-speed of analytical procedure and its portable configuration allowing a multielemental, simultaneous and non destructive analyses besides in situ application. (author)
DEFF Research Database (Denmark)
Mentzel, Uffe Vie; Rovik, Anne; Christensen, Claus H.
2009-01-01
Ethane and methanol are converted simultaneously over Ga/H-ZSM-5, Mo/H-ZSM-5 and Ga-Mo/H-ZSM-5 to produce light olefins and aromatics. The presence of methanol in the reactant stream is intended to facilitate activation of ethane following literature reports on co-conversion of methane and methan...... and in the carbonaceous compounds deposited on the catalysts. This indicates that both reactants take part in the formation of the hydrocarbon pool, which is the origin of all products....
Ghandi, Mehdi; Salahi, Saleh; Taheri, Abuzar; Abbasi, Alireza
2018-05-01
A facile one-pot method has been developed for the synthesis of novel pyrrolo[2,1-a]pyrazine scaffolds. A variety of 1-(1H-tetrazol-5-yl)-1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazine derivatives were obtained in moderate to high yields in methanol using a one-pot four-component condensation of 1-(2-bromoethyl)-1H-pyrrole-2-carbaldehyde, amine, isocyanide and sodium azide at room temperature. These reactions presumably proceed via a domino imine formation, intramolecular annulation and Ugi-azide reaction. Unambiguous assignment of the molecular structures was carried out by single-crystal X-ray diffraction.
DEFF Research Database (Denmark)
Sillesen, A.; Ratajczak, E.; Pagsberg, P.
1993-01-01
Formation of methyl radicals via the consecutive reactions H+C2H4+M-->C2H5+M (1) and H+C2H5-->CH3+CH3 (2a) was initiated by pulse radiolysis of 10-100 mbar H-2 in the presence of ethylene. The kinetics of CH3 Were studied by monitoring the transient infrared absorption at the Q(3, 3) line of the ...
Identification of material properties of sandwich structure with piezoelectric patches
Directory of Open Access Journals (Sweden)
Zemčík R.
2008-11-01
Full Text Available The work focuses on light-weight sandwich structures made of carbon-epoxy skins and foam core which have unique bending stiffness compared to conventional materials. The skins are manufactured by vacuum autoclave technology from unidirectional prepregs and the sandwich is then glued together. The resulting material properties of the structure usually differ from those provided by manufacturer or even those obtained from experimental tests on separate materials, which makes computational models unreliable. Therefore, the properties are identified using the combination of experimental analysis of the sandwich with attached piezoelectric transducer and corresponding static and modal finite element analyses. Simple mathematical optimization with repetitive finite element solution is used. The model is then verified by transient analysis when the piezoelectric patch is excited by harmonic signals covering the first two eigen-frequencies and the induced oscillations are measured by laser sensor.
[Sb{sub 4}Au{sub 4}Sb{sub 4}]{sup 2−}: A designer all-metal aromatic sandwich
Energy Technology Data Exchange (ETDEWEB)
Tian, Wen-Juan; You, Xue-Rui [Nanocluster Laboratory, Institute of Molecular Science, Shanxi University, Taiyuan 030006 (China); Guo, Jin-Chang [Department of Chemistry, Xinzhou Teachers University, Xinzhou 034000 (China); Li, Da-Zhi, E-mail: hj.zhai@sxu.edu.cn, E-mail: ldz005@126.com [Department of Chemical Engineering, Binzhou University, Binzhou 256603 (China); Wang, Ying-Jin [Nanocluster Laboratory, Institute of Molecular Science, Shanxi University, Taiyuan 030006 (China); Department of Chemistry, Xinzhou Teachers University, Xinzhou 034000 (China); Sun, Zhong-Ming [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zhai, Hua-Jin, E-mail: hj.zhai@sxu.edu.cn, E-mail: ldz005@126.com [Nanocluster Laboratory, Institute of Molecular Science, Shanxi University, Taiyuan 030006 (China); State Key Laboratory of Quantum Optics and Quantum Optics Devices, Shanxi University, Taiyuan 030006 (China)
2016-07-28
We report on the computational design of an all-metal aromatic sandwich, [Sb{sub 4}Au{sub 4}Sb{sub 4}]{sup 2−}. The triple-layered, square-prismatic sandwich complex is the global minimum of the system from Coalescence Kick and Minima Hopping structural searches. Following a standard, qualitative chemical bonding analysis via canonical molecular orbitals, the sandwich complex can be formally described as [Sb{sub 4}]{sup +}[Au{sub 4}]{sup 4−}[Sb{sub 4}]{sup +}, showing ionic bonding characters with electron transfers in between the Sb{sub 4}/Au{sub 4}/Sb{sub 4} layers. For an in-depth understanding of the system, one needs to go beyond the above picture. Significant Sb → Au donation and Sb ← Au back-donation occur, redistributing electrons from the Sb{sub 4}/Au{sub 4}/Sb{sub 4} layers to the interlayer Sb–Au–Sb edges, which effectively lead to four Sb–Au–Sb three-center two-electron bonds. The complex is a system with 30 valence electrons, excluding the Sb 5s and Au 5d lone-pairs. The two [Sb{sub 4}]{sup +} ligands constitute an unusual three-fold (π and σ) aromatic system with all 22 electrons being delocalized. An energy gap of ∼1.6 eV is predicted for this all-metal sandwich. The complex is a rare example for rational design of cluster compounds and invites forth-coming synthetic efforts.
Natural fabric sandwich laminate composites: development and ...
Indian Academy of Sciences (India)
3Department of Production Technology, MIT Campus, Anna University, Chennai 600044, India. MS received ... In this work, eco-friendly natural fabric sandwich laminate (NFSL) composites are formulated using ... and eco-friendly quality [22].
Kwak, Dong Hoon; Moussavou, Ghislain; Lee, Ju Hyoung; Heo, Sung Youn; Ko, Kisung; Hwang, Kyung-A; Jekal, Seung-Joo; Choo, Young-Kug
2014-11-14
We have generated the transgenic Tabaco plants expressing multiple monoclonal antibody (mAb) CO7-1A × BR55 by cross-pollinating with mAb CO17-1A and mAb BR55. We have demonstrated the anti-cancer effect of plant-derived multiple mAb CO17-1A × BR55. We find that co-treatment of colorectal mAbs (anti-epithelial cellular adhesion molecule (EpCAM), plant-derived monoclonal antibody (mAb(P)) CO17-1A and mAb(P) CO17-1A × BR55) with RAW264.7 cells significantly inhibited the cell growth in SW620 cancer cells. In particular, multi mAb(P) CO17-1A × BR55 significantly and efficiently suppressed the growth of SW620 cancer cells compared to another mAbs. Apoptotic death-positive cells were significantly increased in the mAb(P) CO17-1A × BR55-treated. The mAb(P) CO17-1A × BR55 treatment significantly decreased the expression of B-Cell lymphoma-2 (BCl-2), but the expression of Bcl-2-associated X protein (Bax), and cleaved caspase-3 were markedly increased. In vivo, the mAb(P) CO17-1A × BR55 significantly and efficiently inhibited the growth of colon tumors compared to another mAbs. The apoptotic cell death and inhibition of pro-apoptotic proteins expression were highest by treatment with mAb(P) CO17-1A × BR55. In addition, the mAb(P) CO17-1A × BR55 significantly inhibited the extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation in cancer cells and tumors. Therefore, this study results suggest that multiple mAb(P) CO17-1A × BR55 has a significant effect on apoptosis-mediated anticancer by suppression of ERK1/2 phosphorylation in colon cancer compared to another mAbs. In light of these results, further clinical investigation should be conducted on mAb(P) CO17-1A × BR55 to determine its possible chemopreventive and/or therapeutic efficacy against human colon cancer.
Directory of Open Access Journals (Sweden)
Liming Chen
Full Text Available Abstract The projectile impact resistance of sandwich panels with cellular cores with different layer numbers has been numerically investigated by perpendicular impact of rigid blunt projectile in ABAQUS/Explicit. These panels with corrugation, hexagonal honeycomb and pyramidal truss cores are impacted at velocities between 50 m/s and 202 m/s while the relative density ranges from 0.001 to 0.15 The effects of core configuration and layer number on projectile impact resistance of sandwich panels with cellular cores are studied. At low impact velocity, sandwich panels with cellular cores outperform the corresponding solid ones and non-montonicity between relative density and projectile resistance of sandwich panels is found and analyzed. Multiplying layer can reduce the maximum central deflection of back face sheet of the above three sandwich panels except pyramidal truss ones in high relative density. Hexagonal honeycomb sandwich panel is beneficial to increasing layer numbers in lowering the contact force and prolonging the interaction time. At high impact velocity, though corrugation and honeycomb sandwich panels are inferior to the equal-weighted solid panels, pyramidal truss ones with high relative density outperform the corresponding solid panels. Multiplying layer is not the desirable way to improve high-velocity projectile resistance.
International Nuclear Information System (INIS)
Aly, Mohamed F.; Hamza, Karim T.; Farag, Mahmoud M.
2014-01-01
Highlights: • Sandwich panels optimization model. • Sandwich panels design procedure. • Study of sandwich panels for automotive vehicle flooring. • Study of sandwich panels for truck cabin exterior. - Abstract: The future of automotive industry faces many challenges in meeting increasingly strict restrictions on emissions, energy usage and recyclability of components alongside the need to maintain cost competiveness. Weight reduction through innovative design of components and proper material selection can have profound impact towards attaining such goals since most of the lifecycle energy usage occurs during the operation phase of a vehicle. In electric and hybrid vehicles, weight reduction has another important effect of extending the electric mode driving range between stops or gasoline mode. This paper adopts parametric models for design optimization and material selection of sandwich panels with the objective of weight and cost minimization subject to structural integrity constraints such as strength, stiffness and buckling resistance. The proposed design procedure employs a pre-compiled library of candidate sandwich panel material combinations, for which optimization of the layered thicknesses is conducted and the best one is reported. Example demonstration studies from the automotive industry are presented for the replacement of Aluminum and Steel panels with polypropylene-filled sandwich panel alternatives
Stals, Ambroos; Jacxsens, Liesbeth; Baert, Leen; Van Coillie, Els; Uyttendaele, Mieke
2015-03-02
Human noroviruses (HuNoVs) are a major cause of food borne gastroenteritis worldwide. They are often transmitted via infected and shedding food handlers manipulating foods such as deli sandwiches. The presented study aimed to simulate HuNoV transmission during the preparation of deli sandwiches in a sandwich bar. A quantitative exposure model was developed by combining the GoldSim® and @Risk® software packages. Input data were collected from scientific literature and from a two week observational study performed at two sandwich bars. The model included three food handlers working during a three hour shift on a shared working surface where deli sandwiches are prepared. The model consisted of three components. The first component simulated the preparation of the deli sandwiches and contained the HuNoV reservoirs, locations within the model allowing the accumulation of NoV and the working of intervention measures. The second component covered the contamination sources being (1) the initial HuNoV contaminated lettuce used on the sandwiches and (2) HuNoV originating from a shedding food handler. The third component included four possible intervention measures to reduce HuNoV transmission: hand and surface disinfection during preparation of the sandwiches, hand gloving and hand washing after a restroom visit. A single HuNoV shedding food handler could cause mean levels of 43±18, 81±37 and 18±7 HuNoV particles present on the deli sandwiches, hands and working surfaces, respectively. Introduction of contaminated lettuce as the only source of HuNoV resulted in the presence of 6.4±0.8 and 4.3±0.4 HuNoV on the food and hand reservoirs. The inclusion of hand and surface disinfection and hand gloving as a single intervention measure was not effective in the model as only marginal reductions of HuNoV levels were noticeable in the different reservoirs. High compliance of hand washing after a restroom visit did reduce HuNoV presence substantially on all reservoirs. The
Controlling the Glycosylation Profile in mAbs Using Time-Dependent Media Supplementation
Directory of Open Access Journals (Sweden)
Devesh Radhakrishnan
2017-12-01
Full Text Available In order to meet desired drug product quality targets, the glycosylation profile of biotherapeutics such as monoclonal antibodies (mAbs must be maintained consistently during manufacturing. Achieving consistent glycan distribution profiles requires identifying factors that influence glycosylation, and manipulating them appropriately via well-designed control strategies. Now, the cell culture media supplement, MnCl2, is known to alter the glycosylation profile in mAbs generally, but its effect, particularly when introduced at different stages during cell growth, has yet to be investigated and quantified. In this study, we evaluate the effect of time-dependent addition of MnCl2 on the glycan profile quantitatively, using factorial design experiments. Our results show that MnCl2 addition during the lag and exponential phases affects the glycan profile significantly more than stationary phase supplementation does. Also, using a novel computational technique, we identify various combinations of glycan species that are affected by this dynamic media supplementation scheme, and quantify the effects mathematically. Our experiments demonstrate the importance of taking into consideration the time of addition of these trace supplements, not just their concentrations, and our computational analysis provides insight into what supplements to add, when, and how much, in order to induce desired changes.
Directory of Open Access Journals (Sweden)
Gene S Tan
2016-04-01
Full Text Available In the early spring of 2013, Chinese health authorities reported several cases of H7N9 influenza virus infections in humans. Since then the virus has established itself at the human-animal interface in Eastern China and continues to cause several hundred infections annually. In order to characterize the antibody response to the H7N9 virus we generated several mouse monoclonal antibodies against the hemagglutinin of the A/Shanghai/1/13 (H7N9 virus. Of particular note are two monoclonal antibodies, 1B2 and 1H5, that show broad reactivity to divergent H7 hemagglutinins. Monoclonal antibody 1B2 binds to viruses of the Eurasian and North American H7 lineages and monoclonal antibody 1H5 reacts broadly to virus isolates of the Eurasian lineage. Interestingly, 1B2 shows broad hemagglutination inhibiting and neutralizing activity, while 1H5 fails to inhibit hemagglutination and demonstrates no neutralizing activity in vitro. However, both monoclonal antibodies were highly protective in an in vivo passive transfer challenge model in mice, even at low doses. Experiments using mutant antibodies that lack the ability for Fc/Fc-receptor and Fc/complement interactions suggest that the protection provided by mAb 1H5 is, at least in part, mediated by the Fc-fragment of the mAb. These findings highlight that a protective response to a pathogen may not only be due to neutralizing antibodies, but can also be the result of highly efficacious non-neutralizing antibodies not readily detected by classical in vitro neutralization or hemagglutination inhibition assays. This is of interest because H7 influenza virus vaccines induce only low hemagglutination inhibiting antibody titers while eliciting robust antibody titers as measured by ELISA. Our data suggest that these binding but non-neutralizing antibodies contribute to protection in vivo.
Víctor, Sanabria-Ayala; Yolanda, Medina-Flores; Araceli, Zavala-Carballo; Lucía, Jiménez; Abraham, Landa
2013-08-01
In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile. Copyright © 2013 Elsevier Inc. All rights reserved.
Novel sandwich structure adsorptive membranes for removal of 4-nitrotoluene from water
Energy Technology Data Exchange (ETDEWEB)
Guo, Yuexin [College of Chemistry, Beijing Normal University, Beijing 100875 (China); School of Pharmacy, North China University of Science and Technology, Tangshan 063000 (China); Jia, Zhiqian, E-mail: zhqjia@bnu.edu.cn [College of Chemistry, Beijing Normal University, Beijing 100875 (China)
2016-11-05
Highlights: • Novel sandwich PES-SPES/PS-PDVB/PTFE adsorptive membranes were prepared. • The removal efficiency for 4-nitrotoluene is greater than 95% after five recycles. • The membrane showed higher adsorption capacity than that of mixed matrix membrane. - Abstract: Novel sandwich PES-SPES/PS-PDVB/PTFE adsorptive membranes were prepared by a filtration/immersion precipitation method and employed for the removal of 4-nitrotoluene from water. The static adsorption thermodynamics, kinetics, dynamic adsorption/desorption and membrane reusability were investigated. The results showed that the Freundlich model describes the adsorption isotherm satisfactorily. With increased PS-PDVB content, the maximum static adsorption capacity, partition coefficient, apparent adsorption rate constant, and dynamic adsorption capacity all significantly increased. The sandwich membranes showed much higher removal efficiency and adsorption capacity than those of mixed matrix membranes. With respect to dynamics adsorption/desorption, the sandwich membranes exhibited excellent reusability, with a removal efficiency greater than 95% even after five recycles.
Sivrikoz, Emre; Timirci-Kahraman, Özlem; Ergen, Arzu; Zeybek, Ümit; Aksoy, Murat; Yanar, Fatih; İsbir, Turgay; Kurtoğlu, Mehmet
2015-01-01
The purpose of this study was to investigate the gene expression levels of elastin and fibulin-5 according to differences between carotid plaque regions and to correlate it with clinical features of plaque destabilization. The study included 44 endarterectomy specimens available from operated symptomatic carotid artery stenoses. The specimens were separated according to anatomic location: internal carotid artery (ICA), external carotid artery (ECA) and common carotid artery (CCA), and then stored in liquid nitrogen. The amounts of cDNA for elastin and fibulin-5 were determined by Quantitative real-time PCR (Q-RT-PCR). Target gene copy numbers were normalized using hypoxanthine-guanine phosphoribosyltransferase (HPRT1) gene. The delta-delta CT method was applied for relative quantification. Q-RT-PCR data showed that relative fibulin-5 gene expression was increased in ICA plaque regions when compared to CCA regions but not reaching significance (p=0.061). At the same time, no differences were observed in elastin mRNA level between different anatomic plaque regions (p>0.05). Moreover, elastin and fibulin-5 mRNA expression and clinical parameters were compared in ICA plaques versus CCA and ECA regions, respectively. Up-regulation of elastin and fibulin-5 mRNA levels in ICA were strongly correlated with family history of cardiovascular disease when compared to CCA (p<0.05). Up-regulation of fibulin-5 in ICA was significantly associated with diabetes, and elevated triglycerides and very low density lipoprotein (VLDL) when compared to ECA (p<0.05). The clinical significance is the differences between the proximal and distal regions of the lesion, associated with the ICA, CCA and ECA respectively, with increased fibulin-5 in the ICA region. Copyright © 2015 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.
Synthesis of 9H-Indeno [1, 2-b] Pyrazine and 11H-Indeno [1, 2-b ...
African Journals Online (AJOL)
NICO
Synthesis of 9H-Indeno [1, 2-b] Pyrazine and. 11H-Indeno [1, 2-b] Quinoxaline Derivatives in. One-step Reaction from 2-Bromo-4-chloro-1-indanone. S. Jasouri1,2, J. Khalafy1,*, M. Badali2 and R.H. Prager3. 1Department of Chemistry, Urmia University, Urmia 57154, Iran. 2Daana Pharmaceutical Co., P.O. Box 5181, Tabriz ...
1-Methyl-1H-pyrazolo[3,4-d]pyrimidin-4(5H-one
Directory of Open Access Journals (Sweden)
Mohamed El Hafi
2018-03-01
Full Text Available The title molecule, C6H6N4O, is essentially planar [dihedral angle between the rings = 0.46 (9°]. The crystal structure consists of sheets of molecules lying parallel to (\\overline{1}11 formed by a combination of N—H...O, C—H...O and C—H...H hydrogen bonds. The sheets are connected through π–π stacking interactions.
International Nuclear Information System (INIS)
Chaturvedi, Richa; Heimburg, Jamie; Yan, Jun; Koury, Stephen; Sajjad, Munawwar; Abdel-Nabi, Hani H.; Rittenhouse-Olson, Kate
2008-01-01
Clinical immunolocalization has been attempted by others with an anti-Thomsen-Friedenreich antigen (TF-Ag) mAb that bound both alpha- and beta-linked TF-Ag. In this report, 124 I-labeled mAb JAA-F11 specific for alpha-linked TF-Ag showed higher tumor specificity in in vivo micro-positron emission tomography (micro-PET) of the mouse mammary adenocarcinoma line, 4T1, showing no preferential uptake by the kidney. Labeled product remained localized in the tumor for at least 20 days. Glycan array analysis showed structural specificity of the antibody
Chen, Lian; Conda-Sheridan, Martin; Reddy, P V Narasimha; Morrell, Andrew; Park, Eun-Jung; Kondratyuk, Tamara P; Pezzuto, John M; van Breemen, Richard B; Cushman, Mark
2012-06-28
Activation of the retinoid X receptor (RXR), which is involved in cell proliferation, differentiation, and apoptosis, is a strategy for cancer chemotherapy and chemoprevention, and 3-amino-6-(3'-aminopropyl)-5H-indeno[1,2-c]isoquinoline-5,11-(6H)dione (AM6-36) (3) is among the few RXR ligands known. The presently reported studies of 3 include its binding to human plasma proteins, metabolic stability using human liver microsomes, metabolism by human liver microsomes and hepatocytes, and in vivo disposition in rat serum, liver, and mammary tissue. Compound 3 was 75% bound to human plasma proteins, and its metabolic stability was much greater than propranolol. One phase I metabolite was formed by human liver microsomes, seven phase I and II metabolites were formed by human hepatocytes, and five metabolites were detected in rat serum and liver after oral administration. The putative metabolites predicted using LC-MS-MS were synthesized to confirm their structures and to provide sufficient material for investigation of induction of RXRE transcriptional activity and inhibition of NFκB.