International Nuclear Information System (INIS)
Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated
Low temperature heat capacity of lutetium and lutetium hydrogen alloys
International Nuclear Information System (INIS)
Thome, D.K.
1977-10-01
The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium
Lutetium oxide-based transparent ceramic scintillators
Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.
2016-01-19
In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.
Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride
Energy Technology Data Exchange (ETDEWEB)
Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)
2014-11-15
Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.
International Nuclear Information System (INIS)
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.
PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid
International Nuclear Information System (INIS)
Kostromina, N.A.; Novikova, L.B.
1975-01-01
Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined
Saturated vapor pressure of lutetium tris-acetylacetonate
Energy Technology Data Exchange (ETDEWEB)
Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))
1983-12-01
By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.
First principles study of electronic, elastic and thermal properties of lutetium intermetallics
International Nuclear Information System (INIS)
Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.
2011-01-01
In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)
International Nuclear Information System (INIS)
Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe
2008-01-01
We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer
Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex
Energy Technology Data Exchange (ETDEWEB)
Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)
2016-05-28
The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.
International Nuclear Information System (INIS)
Warmińska, Dorota; Wawer, Jarosław
2012-01-01
Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.
Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium
International Nuclear Information System (INIS)
Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2006-01-01
The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)
Thermal decomposition of lutetium propionate
DEFF Research Database (Denmark)
Grivel, Jean-Claude
2010-01-01
The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Energy Technology Data Exchange (ETDEWEB)
Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)
2017-11-15
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.
2017-11-01
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Separation of thulium, ytterbium and lutetium from uranium
International Nuclear Information System (INIS)
Lopez, G.H.
1987-01-01
The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)
International Nuclear Information System (INIS)
Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer
2007-01-01
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film
Independent fissile inventory verification in a large tank employing lutetium double spikes
International Nuclear Information System (INIS)
Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.
1987-01-01
A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas
DOTA-TATE peptides labelling with Lutetium 177: Preliminary study
International Nuclear Information System (INIS)
Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor
2014-01-01
he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).
Energy Technology Data Exchange (ETDEWEB)
Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr
2007-11-09
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.
Effect of pressure on the bandstructure and superconductivity in lutetium
International Nuclear Information System (INIS)
Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.
1984-08-01
The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)
International Nuclear Information System (INIS)
Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.
1997-01-01
With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)
Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators
International Nuclear Information System (INIS)
Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.
2007-01-01
For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV
X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.
1985-01-01
An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)
Hyperfine interactions in 111Cd-doped lutetium sesquioxide
International Nuclear Information System (INIS)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.
1999-01-01
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample
21 CFR 182.3890 - Tocopherols.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tocopherols. 182.3890 Section 182.3890 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Chemical Preservatives § 182.3890 Tocopherols. (a) Product. Tocopherols. (b) Conditions of use. This substance is generally recognized as safe when...
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Employee. 182.640 Section 182.640 Grants and... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.640 Employee. (a) Employee means the employee of a recipient directly engaged in the performance of work under the award...
21 CFR 182.8890 - Tocopherols.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tocopherols. 182.8890 Section 182.8890 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Nutrients § 182.8890 Tocopherols. (a) Product. Tocopherols. (b) Conditions of use. This substance is generally recognized as safe when used in accordance...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 18.2 Section 18.2 Judicial Administration DEPARTMENT OF JUSTICE OFFICE OF JUSTICE PROGRAMS HEARING AND APPEAL PROCEDURES § 18.2 Application. (a) These procedures apply to all appeals and hearings of State formula or block grant applicants or...
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Biotin. 182.8159 Section 182.8159 Food and Drugs... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Nutrients § 182.8159 Biotin. (a) Product. Biotin. (b) Conditions of use. This substance is generally recognized as safe when used in accordance...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 18.2 Section 18.2 Labor Office of the Secretary of Labor RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS BEFORE THE OFFICE OF ADMINISTRATIVE LAW JUDGES General § 18.2 Definitions. For purposes of these rules: (a) Adjudicatory proceeding...
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false State. 182.665 Section 182.665 Grants and... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Definitions. 18.2 Section 18.2 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY DISCLOSURE OF FINANCIAL AND OTHER INFORMATION BY NATIONAL BANKS § 18.2 Definitions. Unless otherwise defined in this part, the terms used have...
Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium
International Nuclear Information System (INIS)
Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented
Optical emission spectrographic analysis of lutetium oxide for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Dixit, V.S.
1986-01-01
An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)
International Nuclear Information System (INIS)
Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel
2013-01-01
Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions
Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide
Energy Technology Data Exchange (ETDEWEB)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)
1999-09-15
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.
21 CFR 182.3225 - Calcium sorbate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium sorbate. 182.3225 Section 182.3225 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Chemical Preservatives § 182.3225 Calcium sorbate. (a) Product. Calcium sorbate. (b) Conditions of use. This substance is generally recognized as...
42 CFR 460.182 - Medicaid payment.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Medicaid payment. 460.182 Section 460.182 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...) Payment § 460.182 Medicaid payment. (a) Under a PACE program agreement, the State administering agency...
46 CFR 182.540 - Ballast systems.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Ballast systems. 182.540 Section 182.540 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) MACHINERY INSTALLATION Bilge and Ballast Systems § 182.540 Ballast systems. (a) Ballast piping must not be...
21 CFR 182.1748 - Sodium caseinate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium caseinate. 182.1748 Section 182.1748 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1748 Sodium caseinate. (a) Product. Sodium caseinate. (b) Conditions of use. This substance...
21 CFR 182.1125 - Aluminum sulfate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...
21 CFR 182.3089 - Sorbic acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sorbic acid. 182.3089 Section 182.3089 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Chemical Preservatives § 182.3089 Sorbic acid. (a) Product. Sorbic acid. (b) Conditions of use. This substance is generally recognized as safe when...
46 CFR 182.420 - Engine cooling.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Engine cooling. 182.420 Section 182.420 Shipping COAST...) MACHINERY INSTALLATION Specific Machinery Requirements § 182.420 Engine cooling. (a) Except as otherwise provided in paragraphs (b), (c), (d), and (e) of this section, all engines must be water cooled and meet...
21 CFR 182.8985 - Zinc chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Zinc chloride. 182.8985 Section 182.8985 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Nutrients § 182.8985 Zinc chloride. (a) Product. Zinc chloride. (b) Conditions of use. This substance is generally recognized as safe when used in...
21 CFR 182.8013 - Ascorbic acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ascorbic acid. 182.8013 Section 182.8013 Food and... CONSUMPTION (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Nutrients § 182.8013 Ascorbic acid. (a) Product. Ascorbic acid. (b) Conditions of use. This substance is generally recognized as safe when used in...
46 CFR 182.320 - Water heaters.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Water heaters. 182.320 Section 182.320 Shipping COAST...) MACHINERY INSTALLATION Auxiliary Machinery § 182.320 Water heaters. (a) A water heater must meet the...), except that an electric water heater is also acceptable if it: (1) Has a capacity of not more than 454...
Neutron capture cross section measurements: case of lutetium isotopes
International Nuclear Information System (INIS)
Roig, O.; Meot, V.; Belier, G.
2011-01-01
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Individual. 182.655 Section 182.655 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS... Individual. Individual means a natural person. ...
Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A
2017-07-01
Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.
International Nuclear Information System (INIS)
Hu, Andrew Teh; Hu Tenyi; Liu Lungchang
2003-01-01
Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Caffeine. 182.1180 Section 182.1180 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN....1180 Caffeine. (a) Product. Caffeine. (b) Tolerance. 0.02 percent. (c) Limitations, restrictions, or...
47 CFR 36.182 - Cash working capital.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cash working capital. 36.182 Section 36.182... PROCEDURES; STANDARD PROCEDURES FOR SEPARATING TELECOMMUNICATIONS PROPERTY COSTS, REVENUES, EXPENSES, TAXES... Cash Working Capital § 36.182 Cash working capital. (a) The amount for cash working capital, if not...
21 CFR 182.1047 - Glutamic acid hydrochloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Glutamic acid hydrochloride. 182.1047 Section 182.1047 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1047 Glutamic acid hydrochloride. (a) Product. Glutamic acid hydrochloride. (b...
21 CFR 182.1781 - Sodium aluminum phosphate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium aluminum phosphate. 182.1781 Section 182.1781 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1781 Sodium aluminum phosphate. (a) Product. Sodium aluminum phosphate. (b...
2 CFR 182.635 - Drug-free workplace.
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Drug-free workplace. 182.635 Section 182.635... Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.635 Drug-free workplace. Drug-free workplace means a site for the performance of work done in connection...
46 CFR 182.435 - Integral fuel tanks.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Integral fuel tanks. 182.435 Section 182.435 Shipping...) MACHINERY INSTALLATION Specific Machinery Requirements § 182.435 Integral fuel tanks. (a) Gasoline fuel tanks must be independent of the hull. (b) Diesel fuel tanks may not be built integral with the hull of...
46 CFR 182.610 - Main steering gear.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Main steering gear. 182.610 Section 182.610 Shipping...) MACHINERY INSTALLATION Steering Systems § 182.610 Main steering gear. (a) A vessel must be provided with a main steering gear that is: (1) Of adequate strength and capable of steering the vessel at all service...
21 CFR 169.182 - Vanilla-vanillin powder.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Vanilla-vanillin powder. 169.182 Section 169.182... Dressings and Flavorings § 169.182 Vanilla-vanillin powder. (a) Vanilla-vanillin powder conforms to the... § 169.3(c) contained therein, the article also contains not more than 1 ounce of added vanillin. (b) The...
Electrochromism of solid films of blue form of lutetium phthalocyanine complexe
Energy Technology Data Exchange (ETDEWEB)
Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V
1986-12-01
Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.
21 CFR 182.1045 - Glutamic acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Glutamic acid. 182.1045 Section 182.1045 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN....1045 Glutamic acid. (a) Product. Glutamic acid. (b) [Reserved] (c) Limitations, restrictions, or...
Labelling of the peptide Dota-Octreotate with Lutetium 177
International Nuclear Information System (INIS)
Hernandez B, C.A.
2004-01-01
In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
21 CFR 182.2227 - Calcium silicate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Calcium silicate. 182.2227 Section 182.2227 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Calcium silicate. (a) Product. Calcium silicate. (b) Tolerance. 2 percent and 5 percent. (c) Limitations...
21 CFR 182.8252 - Choline chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Choline chloride. 182.8252 Section 182.8252 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... chloride. (a) Product. Choline chloride. (b) Conditions of use. This substance is generally recognized as...
21 CFR 182.3041 - Erythorbic acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Erythorbic acid. 182.3041 Section 182.3041 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... acid. (a) Product. Erythorbic acid. (b) Conditions of use. This substance is generally recognized as...
21 CFR 182.1073 - Phosphoric acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Phosphoric acid. 182.1073 Section 182.1073 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN....1073 Phosphoric acid. (a) Product. Phosphoric acid. (b) Conditions of use. This substance is generally...
46 CFR 182.430 - Engine exhaust pipe installation.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Engine exhaust pipe installation. 182.430 Section 182... 100 GROSS TONS) MACHINERY INSTALLATION Specific Machinery Requirements § 182.430 Engine exhaust pipe... equipment might come in contact with an exhaust pipe. (b) Exhaust gas must not leak from the piping or any...
36 CFR 13.182 - Temporary facilities.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Temporary facilities. 13.182... NATIONAL PARK SYSTEM UNITS IN ALASKA Cabins Use of Temporary Facilities Related to Taking Fish and Wildlife § 13.182 Temporary facilities. In a national preserve where the taking of fish and wildlife is...
21 CFR 182.3013 - Ascorbic acid.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ascorbic acid. 182.3013 Section 182.3013 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... acid. (a) Product. Ascorbic acid. (b) Conditions of use. This substance is generally recognized as safe...
21 CFR 211.182 - Equipment cleaning and use log.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Equipment cleaning and use log. 211.182 Section 211.182 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Reports § 211.182 Equipment cleaning and use log. A written record of major equipment cleaning...
Energy Technology Data Exchange (ETDEWEB)
Loeser, Anastassia
2016-09-28
The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.
21 CFR 182.2122 - Aluminum calcium silicate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c...
50 CFR 18.2 - Scope of regulations.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Scope of regulations. 18.2 Section 18.2 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED... with respect to cetacea (whales and porpoises), pinnipedia, other than walrus (seals and sea lions...
46 CFR 182.450 - Vent pipes for fuel tanks.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Vent pipes for fuel tanks. 182.450 Section 182.450... TONS) MACHINERY INSTALLATION Specific Machinery Requirements § 182.450 Vent pipes for fuel tanks. (a) Each unpressurized fuel tank must be fitted with a vent pipe connected to the highest point of the tank...
21 CFR 182.8892 - α-Tocopherol acetate.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true α-Tocopherol acetate. 182.8892 Section 182.8892 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...-Tocopherol acetate. (a) Product. α-Tocopherol acetate. (b) Conditions of use. This substance is generally...
miR-182 integrates apoptosis, growth, and differentiation programs in glioblastoma.
Kouri, Fotini M; Hurley, Lisa A; Daniel, Weston L; Day, Emily S; Hua, Youjia; Hao, Liangliang; Peng, Chian-Yu; Merkel, Timothy J; Queisser, Markus A; Ritner, Carissa; Zhang, Hailei; James, C David; Sznajder, Jacob I; Chin, Lynda; Giljohann, David A; Kessler, John A; Peter, Marcus E; Mirkin, Chad A; Stegh, Alexander H
2015-04-01
Glioblastoma multiforme (GBM) is a lethal, therapy-resistant brain cancer consisting of numerous tumor cell subpopulations, including stem-like glioma-initiating cells (GICs), which contribute to tumor recurrence following initial response to therapy. Here, we identified miR-182 as a regulator of apoptosis, growth, and differentiation programs whose expression level is correlated with GBM patient survival. Repression of Bcl2-like12 (Bcl2L12), c-Met, and hypoxia-inducible factor 2α (HIF2A) is of central importance to miR-182 anti-tumor activity, as it results in enhanced therapy susceptibility, decreased GIC sphere size, expansion, and stemness in vitro. To evaluate the tumor-suppressive function of miR-182 in vivo, we synthesized miR-182-based spherical nucleic acids (182-SNAs); i.e., gold nanoparticles covalently functionalized with mature miR-182 duplexes. Intravenously administered 182-SNAs penetrated the blood-brain/blood-tumor barriers (BBB/BTB) in orthotopic GBM xenografts and selectively disseminated throughout extravascular glioma parenchyma, causing reduced tumor burden and increased animal survival. Our results indicate that harnessing the anti-tumor activities of miR-182 via safe and robust delivery of 182-SNAs represents a novel strategy for therapeutic intervention in GBM. © 2015 Kouri et al.; Published by Cold Spring Harbor Laboratory Press.
Energy Technology Data Exchange (ETDEWEB)
Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)
2006-07-01
solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)
International Nuclear Information System (INIS)
Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de
2008-01-01
In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process
$\\alpha$-decay study of $^{182,184}$Tl
Van Beveren, C; Barzakh, A E; Cocolios, T E; de Groote, R P; Fedorov, D; Fedosseev, V N; Ferrer, R; Ghys, L; Huyse, M; Köster, U; Lane, J; Liberati, V; Lynch, K M; Marsh, B A; Molkanov, P L; Procter, T J; Rapisarda, E; Sandhu, K; Seliverstov, M D; Van Duppen, P; Venhart, M; Veselský, M
2016-01-01
α -decay spectroscopy of 182,184 Tl has been performed at the CERN isotope separator on-line ( ISOLDE ) facility. New fi ne-structure α decays have been observed for both isotopes. α -decay branching ratios of 0.089 ( 19 ) %, 0.047 ( 6 ) % and 1.22 ( 30 ) % have been deduced for the ( 10 − ) , ( 7 + ) and ( 2 − ) states respectively in 184 Tl and a lower limit of 0.49% for the α -decay branching ratio of 182 Tl. A new half-life of 9.5 ( 2 ) s for the ( 2 − ) state in 184 Tl and 1.9 ( 1 ) s for the low-spin state in 182 Tl has been deduced. Using α – γ coincidence analysis, multiple γ rays were observed de-exciting levels in 178,18 0 Au fed by 182,184 Tl α decays. The γ transitions connecting these low-lying states in 178,18 0 Au are essential to sort the data and possibly identify bands from in- beam studies in these isotopes. Owing to the complex fi ne-structure α decays and limited knowledge about the structure of the daughter nuclei, only partial level schemes could be constructed for bot...
27 CFR 40.182 - Record of processed tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Record of processed tobacco. 40.182 Section 40.182 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...
50 CFR 300.182 - HMS international trade permit.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false HMS international trade permit. 300.182... FISHERIES REGULATIONS International Trade Documentation and Tracking Programs for Highly Migratory Species § 300.182 HMS international trade permit. (a) General. An importer, entering for consumption fish or...
Energy Technology Data Exchange (ETDEWEB)
Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)
2008-10-31
In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.
Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C
2014-02-01
Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum
Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications
Directory of Open Access Journals (Sweden)
Kamal Yavari
2012-06-01
Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical. Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h. Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours. Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.
Methylation Status of miR-182 Promoter in Lung Cancer Cell Lines
Directory of Open Access Journals (Sweden)
Yongwen LI
2015-05-01
Full Text Available Background and objective It has been proven that the abnormal expression of miR-182 was related to the occurrence and development of tumors. The aim of this study is to explore the relationship between the methylation of miR-182 promoter and its expression in lung cancer cell lines. Methods Real-time quantitative PCR and methylation-specific PCR were used to detect the expression level of miR-182 and its promoter methylation status in five lung cancer cell lines (A549, L9981, NL9980, 95C and 95D. DNA sequencing was used to confirm the methylation results. Results The level of miR-182 expression significantly differs among these lung cancer cell lines. The highly metastatic human lung cancer cell lines, namely, A549 and L9981, demonstrate a relatively lower expression level of miR-182 compared with the lowly metastatic human lung cancer cell line 95C. Methylation-specific PCR and DNA sequencing assay results indicate that these lung cancer cell lines present different levels of miR-182 promoter methylation, and the highest methylation level is observed in A549 cells. Furthermore, the expression of miR-182 in these cell lines significantly increases when treated with 10 μM 5’-Aza-dC. Conclusion DNA methylation occurs in the miR-182 promoter region in lung cancer cell lines. This methylation can regulate the expression level of miR-182. Further study must be conducted to explore the function of miR-182 promoter methylation in lung cancer occurrence and development.
Yrast four-quasi-particle states in 182W
International Nuclear Information System (INIS)
Regan, P.H.; Walker, P.M.; Dracoulis, G.D.; Anderssen, S.S.; Byrne, A.P.; Davidson, P.M.; Kibedi, T.; Lane, G.J.; Stuchbery, A.E.; Yeung, K.C.
1994-01-01
High-spin states of the stable isotope 182 W have been studied using the reactions 176 Yb( 13 C,α3n) 182 W and 176 Yb( 9 Be,3n) 182 W at beam energies of 65 and 40 MeV, respectively. Three, possibly four, new intrinsic states at high spins have been observed corresponding to different high-K four-quasi-particle structures. The K π =15 + and 17 - levels have lifetimes of 78(15) and 25(10) ns, respectively. Rotational bands are observed built on the K π =16 + and 17 - yrast states. The coupling of Nilsson orbitals which give rise to high-K states at the yrast line and the K-forbiddenness of the K π =15 + isomeric decay are discussed. (orig.)
21 CFR 182.10 - Spices and other natural seasonings and flavorings.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Spices and other natural seasonings and flavorings. 182.10 Section 182.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... Provisions § 182.10 Spices and other natural seasonings and flavorings. Spices and other natural seasonings...
Holst, Jesper C; Olsen, Mia B; Paton, Chad; Nagashima, Kazuhide; Schiller, Martin; Wielandt, Daniel; Larsen, Kirsten K; Connelly, James N; Jørgensen, Jes K; Krot, Alexander N; Nordlund, Ake; Bizzarro, Martin
2013-05-28
Refractory inclusions [calcium-aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., (26)Al, (41)Ca, and (182)Hf) synthesized in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed with the canonical abundance of (26)Al corresponding to (26)Al/(27)Al of ∼5 × 10(-5), rare CAIs with fractionation and unidentified nuclear isotope effects (FUN CAIs) record nucleosynthetic isotopic heterogeneity and (26)Al/(27)Al of Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the (182)Hf-(182)W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with (26)Al/(27)Al of ∼3 × 10(-6). The decoupling between (182)Hf and (26)Al requires distinct stellar origins: steady-state galactic stellar nucleosynthesis for (182)Hf and late-stage contamination of the protosolar molecular cloud by a massive star(s) for (26)Al. Admixing of stellar-derived (26)Al to the protoplanetary disk occurred during the epoch of CAI formation and, therefore, the (26)Al-(26)Mg systematics of CAIs cannot be used to define their formation interval. In contrast, our results support (182)Hf homogeneity and chronological significance of the (182)Hf-(182)W clock.
2 CFR 182.100 - How is this part written?
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false How is this part written? 182.100 Section 182.100 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and...
Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals
Energy Technology Data Exchange (ETDEWEB)
Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry
2017-01-15
The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.
Interband transitions in 106Pd, 152Sm, 152Gd and 182W
International Nuclear Information System (INIS)
Kartashov, V.M.; Oborovskij, A.I.; Troitskaya, A.G.
1990-01-01
Internal transitions in 106 Pd, 152 Sm, 152 Gd, 182 W nuclei, observed during decay of 152,152m Eu, 182,183 Ta, 106m Ag, are studied. The experimental characteristics of E0-transitions and E0-components of E0+M1+E2 type transitions in the studied nuclei, relative intensities of internal conversion electron lines during 182 Ta decay, multipolar composition and forbidden factor for 182 W and 183 W low-energy transitions, characteristics of transitions are presented
International Nuclear Information System (INIS)
Silva, Giovana Pasqualini da
2008-01-01
The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
49 CFR 173.182 - Barium azide-50 percent or more water wet.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or more...
2 CFR 182.115 - Does this part apply to me?
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Does this part apply to me? 182.115 Section 182.115 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and...
Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix
Directory of Open Access Journals (Sweden)
Marc Debliquy
2018-03-01
Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.
miR-182 Regulates Metabolic Homeostasis by Modulating Glucose Utilization in Muscle
Directory of Open Access Journals (Sweden)
Duo Zhang
2016-07-01
Full Text Available Understanding the fiber-type specification and metabolic switch in skeletal muscle provides insights into energy metabolism in physiology and diseases. Here, we show that miR-182 is highly expressed in fast-twitch muscle and negatively correlates with blood glucose level. miR-182 knockout mice display muscle loss, fast-to-slow fiber-type switching, and impaired glucose metabolism. Mechanistic studies reveal that miR-182 modulates glucose utilization in muscle by targeting FoxO1 and PDK4, which control fuel selection via the pyruvate dehydrogenase complex (PDHC. Short-term high-fat diet (HFD feeding reduces muscle miR-182 levels by tumor necrosis factor α (TNFα, which contributes to the upregulation of FoxO1/PDK4. Restoration of miR-182 expression in HFD-fed mice induces a faster muscle phenotype, decreases muscle FoxO1/PDK4 levels, and improves glucose metabolism. Together, our work establishes miR-182 as a critical regulator that confers robust and precise controls on fuel usage and glucose homeostasis. Our study suggests that a metabolic shift toward a faster and more glycolytic phenotype is beneficial for glucose control.
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1992-01-01
The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)
Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.
Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M
2006-10-01
Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in
46 CFR 154.182 - Contiguous hull structure: Production weld test.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Production weld test. 154.182... Equipment Hull Structure § 154.182 Contiguous hull structure: Production weld test. If a portion of the contiguous hull structure is designed for a temperature colder than −34 °C (−30 °F) and is not part of the...
Ground state shape and crossing of near spherical and deformed bands in 182Hg
International Nuclear Information System (INIS)
Ma, W.C.; Ramayya, A.V.; Hamilton, J.H.; Robinson, S.J.; Barclay, M.E.; Zhao, K.; Cole, J.D.; Zganjar, E.F.; Spejewski, E.H.
1983-01-01
The energy levels of 182 Hg have been identified for the first time through comparison of in-beam studies of the reactions 156 154 Gd( 32 S,4n) 184 182 Hg. Levels up to 12 + in 182 Hg were established from γ-γ coincidence and singles measurement. The data establish that the ground state shape is near spherical, and that the ground band is crossed by a well deformed band at 4 + . In contrast to IBA model predictions that the deformed band will rise in energy in 182 Hg compared to 184 Hg, the energies of the deformed levels in 182 Hg continue to drop. 7 references
NMR-ON of 182Ta and 183Ta in Fe
International Nuclear Information System (INIS)
Allsop, A.L.; Chaplin, D.H.; Murray, D.W.; Stone, N.J.
1980-01-01
Nuclear magnetic resonance has been observed on radioactive 182 Ta and 183 Ta oriented at low temperature in an Fe host, by detection of the change in spatial anisotropy of γ-rays emitted during nuclear decay. By measuring the resonant frequencies of 183 Ta in four different applied magnetic fields the nuclear magnetic moment and hyperfine field have been deduced. These are: vertical stroke μ( 183 Ta;I = 7/2) = 2.28(3)μsub(N) and Bsub(h)sub(f)(TaFe at 0 K) = -67.2(1.3)T. The sin of the ground state of 182 Ta has been determined as I = 3 by comparing resonance results with those obtained in a thermal equilibrium nuclear orientation study. The ratio of the resonant frequencies observed for 182 Ta and 183 Ta at one applied field value yields a magnetic moment for the former of vertical stroke μ( 182 Ta;I = 3) vertical stroke = 2.91(3)μsub(N). The spin lattice relaxation time for 183 TaFe (0.12 at% Ta) at 18 mK in an applied field of 0.5 T has been found to be 40(10)s. (orig.)
2010-10-01
... system is of nickel-copper or copper-nickel. When making tube connections, the tubing must be cut square...) MACHINERY INSTALLATION Specific Machinery Requirements § 182.455 Fuel piping. (a) Materials and workmanship. The materials and construction of fuel lines, including pipe, tube, and hose, must comply with the...
46 CFR 182.470 - Ventilation of spaces containing diesel fuel tanks.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation of spaces containing diesel fuel tanks. 182... Ventilation of spaces containing diesel fuel tanks. (a) Unless provided with ventilation that complies with § 182.465, a space containing a diesel fuel tank and no machinery must meet the requirements of this...
Li, Pei; Hu, Jing; Zhang, Ying; Li, Jianping; Dang, Yunzhi; Zhang, Rui; Wei, Lichun; Shi, Mei
2018-02-01
Objective To investigate the role and mechanism of microRNA-182 (miR-182) in the proliferation of cervical cancer cells. Methods With liposome-mediated transient transfection method, the level of miR-182 in HeLa and SiHa cells was increased or decreased. CCK-8 assay and colony formation assay were used to observe the effect of miR-182 on the proliferation of cervical cancer cells. Using bioinformatics predictions, real-time quantitative PCR, and dual luciferase reporter assay, we clarified the role of miR-182 in posttranscriptional regulation of adenomatous polyposis coli (APC) gene and its effect on the downstream molecules (c-Myc and cyclin D1) of Wnt singling pathway. Results Up-regulation of miR-182 significantly promoted the proliferation of cervical cancer cells, while down-regulation of miR-182 significantly inhibited the proliferation of cervical cancer cells. Over-expression of miR-182 inhibited the expression of APC gene in cervical cancer cells and the regulation of miR-182 affected the expression of canonical Wnt signaling pathway downstream molecules in cervical cancer cells. Conclusion The miR-182 stimulates canonical Wnt signaling pathway by targeting APC gene and enhances the proliferation of cervical cancer cells.
46 CFR 182.480 - Flammable vapor detection systems.
2010-10-01
... 100 GROSS TONS) MACHINERY INSTALLATION Specific Machinery Requirements § 182.480 Flammable vapor... permit calibration in a vapor free atmosphere. (g) Electrical connections, wiring, and components for a...
Residue 182 influences the second step of protein-tyrosine phosphatase-mediated catalysis
DEFF Research Database (Denmark)
Pedersen, A.K.; Guo, X.; Møller, K.B.
2004-01-01
Previous enzyme kinetic and structural studies have revealed a critical role for Asp(181) (PTP1B numbering) in PTP (protein-tyrosine phosphatase)-mediated catalysis. In the E-P (phosphoenzyme) formation step, Asp(181) functions as a general acid, while in the E-P hydrolysis step it acts...... as a general base. Most of our understanding of the role of Asp(181). is derived from studies with the Yersinia PTP and the mammalian PTP1B, and to some extent also TC (T-cell)-PTP and, the related PTPalpha and PTPepsilon. The neighbouring residue 182 is a phenylalanine in these four mammalian enzymes...... and a glutamine in Yersinia PTP. Surprisingly, little attention has been paid to the fact that this residue is a histidine in most other mammalian PTPs. Using a reciprocal single-point mutational approach with introduction of His(182) in PTP1B and Phe(182) in PTPH1, we demonstrate here that His(182)-PTPs...
Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.
Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J
2015-01-01
Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.
46 CFR 182.620 - Auxiliary means of steering.
2010-10-01
... TONS) MACHINERY INSTALLATION Steering Systems § 182.620 Auxiliary means of steering. (a) Except as... personnel hazards during normal or heavy weather operation. (b) A suitable hand tiller may be acceptable as...
Corrosion Evaluation of INTEC Waste Storage Tank WM-182
International Nuclear Information System (INIS)
Dirk, W. J.; Anderson, P. A.
1999-01-01
Irradiated nuclear fuel has been stored and reprocessed at the Idaho National Engineering and Environmental Laboratory since 1953 using facilities located at the Idaho Nuclear Technology and Engineering Center (INTEC). This reprocessing produced radioactive liquid waste which was stored in the Tank Farm. The INTEC Tank Farm consists of eleven vaulted 300,000-gallon underground tanks including Tank WM-182. Tank WM-182 was put into service in 1955, has been filled four times, and has contained aluminum and zirconium fuel reprocessing wastes as well as sodium bearing waste. A program to monitor corrosion in the waste tanks was initiated in 1953 when the first of the eleven Tank Farm tanks was placed in service. Austenitic stainless steel coupons representative of the materials of construction of the tanks are used to monitor internal tank corrosion. This report documents the final inspection of the WM-182 corrosion coupons. Physical examination of the welded corrosion test coupons exposed to the tank bottom conditions of Tank WM-182 revealed very light uniform corrosion. Examination of the external surfaces of the extruded pipe samples showed very light uniform corrosion with slight indications of preferential attack parallel to extrusion marks and start of end grain attack of the cut edges. These indications were only evident when examined under stereo microscope at magnifications of 20X and above. There were no definite indications of localized corrosion, such as cracking, pitting, preferential weld attack, or weld heat affected zone attack on either the welded or extruded coupons. Visual examination of the coupon support cables, where they were not encased in plastic, failed to reveal any indication of liquid-liquid interface attack of any crevice corrosion. Based on the WM-182 coupon evaluations, which have occurred throughout the life of the tank, the metal loss from the tank wall due to uniform corrosion is not expected to exceed 5.5 x 10-1 mil (0.00 055 inch
Generation of novel metabolites of dietary linoleic acid (18:2n6) by guinea pig epidermis
Energy Technology Data Exchange (ETDEWEB)
Chapkin, R.S.; Ziboh, V.A.
1986-03-05
Although the authors have demonstrated the inability of rat and guinea pig (GP) skin enzyme preparations to desaturate 18:2n6 into gammalinolenic acid (18:3n6) using an in vitro microsomal system, the fate of this dietary essential fatty acid in the GP epidermis is unknown. To explore the fate of 18:2n6, intact tissue slices from GP epidermis were incubated with (1-/sup 14/C)18:2n6. After incubation, the extracted lipids were transesterified using methanolic-HCL. The fatty acid methyl esters were analyzed using a combination of (i) argentation TLC, scanned using a proportional TLC radioscanner, and (ii) reverse phase HPLC, equipped with a flow through radioscanner. The results indicate that the intact epidermis metabolized /sup 14/C-18:2n6 to a group of novel products more polar than 18:2n6. In subsequent experiments, /sup 14/C-18:2n6 was either incubated with the 800 xg supernatant, the 105,000 xg pellet or supernatant from GP epidermis. Metabolism of 18:2n6 by the high speed supernatant resulted in the generation of polar products with chromatographic properties of not greater than 2 double bonds. These results indicate that although the GP epidermis lacks the capacity to desaturate 18:2n6 to 18:3n6, it can convert dietary 18:2n6 into a group of novel polar metabolites via a cytosolic mediated process. The function of these metabolites in the GP integumentary system remains to be determined.
Generation of novel metabolites of dietary linoleic acid (18:2n6) by guinea pig epidermis
International Nuclear Information System (INIS)
Chapkin, R.S.; Ziboh, V.A.
1986-01-01
Although the authors have demonstrated the inability of rat and guinea pig (GP) skin enzyme preparations to desaturate 18:2n6 into gammalinolenic acid (18:3n6) using an in vitro microsomal system, the fate of this dietary essential fatty acid in the GP epidermis is unknown. To explore the fate of 18:2n6, intact tissue slices from GP epidermis were incubated with [1- 14 C]18:2n6. After incubation, the extracted lipids were transesterified using methanolic-HCL. The fatty acid methyl esters were analyzed using a combination of (i) argentation TLC, scanned using a proportional TLC radioscanner, and (ii) reverse phase HPLC, equipped with a flow through radioscanner. The results indicate that the intact epidermis metabolized 14 C-18:2n6 to a group of novel products more polar than 18:2n6. In subsequent experiments, 14 C-18:2n6 was either incubated with the 800 xg supernatant, the 105,000 xg pellet or supernatant from GP epidermis. Metabolism of 18:2n6 by the high speed supernatant resulted in the generation of polar products with chromatographic properties of not greater than 2 double bonds. These results indicate that although the GP epidermis lacks the capacity to desaturate 18:2n6 to 18:3n6, it can convert dietary 18:2n6 into a group of novel polar metabolites via a cytosolic mediated process. The function of these metabolites in the GP integumentary system remains to be determined
Directory of Open Access Journals (Sweden)
Brits C.P.
2017-01-01
Full Text Available Enhanced γ-decay on the tail of the giant electric dipole resonance, such as the scissors or pygmy resonances, can have significant impact on (n,γ reaction rates. These rates are important input for modeling processes that take place in astrophysical environments and nuclear reactors. Recent results from the University of Oslo indicate the existence of a significant enhancement in the photon strength function for nuclei in the actinide region due to the scissors resonance. Further, the M1 strength distribution of the scissors resonances in rare earth nuclei has been studied extensively over the years. To investigate the evolution and persistence of the scissor resonance in other mass regions, an experiment was performed utilizing the NaI(Tl γ-ray detector array (CACTUS and silicon particle telescopes (SiRi at the University of Oslo Cyclotron laboratory. Particle-γ coincidences from the 181Ta(d,p182Ta and 181Ta(d,d'181Ta reactions were used to measure the nuclear level density and photon strength function of the well-deformed 181Ta and 182Ta systems, to investigate the existence of resonances below the neutron separation energy.
DEFF Research Database (Denmark)
Holst, Jesper Christian; Olsen, Mia Bjørg Stolberg; Paton, Chad
2013-01-01
provide a unique window into the earliest Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the 182Hf–182W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with 26Al/27Al......Refractory inclusions [calcium–aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., 26Al, 41Ca, and 182Hf) synthesized...... in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed...
Image collection: 182 [Togo Picture Gallery[Archive
Lifescience Database Archive (English)
Full Text Available 182 Physeter_macrocephalus_NL.png マッコウクジラ Sperm whale Physeter macrocephalus 9755 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,クジラ目
40 CFR 180.1144 - Candida oleophila isolate I-182; exemption from the requirement of a tolerance.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Candida oleophila isolate I-182... RESIDUES IN FOOD Exemptions From Tolerances § 180.1144 Candida oleophila isolate I-182; exemption from the requirement of a tolerance. Candida oleophila isolate I-182, when used as a post-harvest biological fungicide...
Displaying of formation of atomic clusters in radioactive lutetium oxide films
International Nuclear Information System (INIS)
Kartashov, V.M.; Troitskata, A.G.
2002-01-01
We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds
International Nuclear Information System (INIS)
Vockenhuber, C.; Golser, R.; Kutschera, W.; Priller, A.; Steier, P.; Winkler, S.; Ahmad, I.; Bichler, M.
2002-01-01
Full text: The neutron-rich isotope 182 Hf has a half-life of 9 ± 2 million years. It can be used to study the early development of the Earth and the Moon through isotopic anomalies of its stable decay product 182 W. The system 182 Hf - 182 W forms a geochronometer, which offers an excellent way to determine the time-scale for the early Solar System's accretion and the core formation of the planets. Many applications in the last few years yielded impressive results, e.g. concerning the origin of the Moon. However, the half-life of 182 Hf was measured 40 years ago, and a reduction of the large uncertainty would be very desirable. We are engaged in a re-measurement of the half-life, and the current status of this effort will be reported. 182 Hf may also complement a few other radionuclides in the million-year half-life range to trace relatively recent stellar events with high neutron fluxes in the vicinity of the Earth. This may be accomplished by finding measurable traces of live 182 Hf in suitable terrestrial archives. Since 182 Hf has no significant natural sources on earth, live 182 Hf is an ideal indicator of a recent, nearby supernova or other explosive stellar events. The AMS detection method of 182 Hf with the upgraded VERA facility, and first results of this new AMS nuclide will be presented. Refs. 2 (author)
Brits, C. P.; Wiedeking, M.; Bello Garrote, F. L.; Bleuel, D. L.; Giacoppo, F.; Görgen, A.; Guttormsen, M.; Hadynska-Klek, K.; Hagen, T. W.; Ingeberg, V. W.; Kheswa, B. V.; Klintefjord, M.; Larsen, A. C.; Malatji, K. L.; Nyhus, H. T.; Papka, P.; Renstrøm, T.; Rose, S.; Sahin, E.; Siem, S.; Tveten, G. M.; Zeiser, F.
2017-09-01
Enhanced γ-decay on the tail of the giant electric dipole resonance, such as the scissors or pygmy resonances, can have significant impact on (n,γ) reaction rates. These rates are important input for modeling processes that take place in astrophysical environments and nuclear reactors. Recent results from the University of Oslo indicate the existence of a significant enhancement in the photon strength function for nuclei in the actinide region due to the scissors resonance. Further, the M1 strength distribution of the scissors resonances in rare earth nuclei has been studied extensively over the years. To investigate the evolution and persistence of the scissor resonance in other mass regions, an experiment was performed utilizing the NaI(Tl) γ-ray detector array (CACTUS) and silicon particle telescopes (SiRi) at the University of Oslo Cyclotron laboratory. Particle-γ coincidences from the 181Ta(d,p)182Ta and 181Ta(d,d')181Ta reactions were used to measure the nuclear level density and photon strength function of the well-deformed 181Ta and 182Ta systems, to investigate the existence of resonances below the neutron separation energy. Note to the reader: the title of this article has been corrected on September 19, 2017.
26 CFR 1.182-2 - Definition of “the business of farming.”
2010-04-01
... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of âthe business of farming.â 1.182-2...-2 Definition of “the business of farming.” Under section 182, the election to deduct expenditures incurred in the clearing of land is applicable only to a taxpayer who is engaged in “the business of...
Evaluation of miR-182/miR-100 Ratio for Diagnosis and Survival Prediction in Bladder Cancer.
Chen, Zhanguo; Wu, Lili; Lin, Qi; Shi, Jing; Lin, Xiangyang; Shi, Liang
2016-09-01
Abnormal expression of microRNAs (miRNAs) plays an important role in development of several cancer types, including bladder cancer (BCa). However, the relationship between the ratio of miR-181/miR-100 and the prognosis of BCa has not been studied yet. The aim of this study was to evaluate the expression of miR-182, miR-100 and their clinical significance in BCa. Upregulation of miR-182 and down-regulation of miR-100 were validated in tissue specimens of 134 BCa cases compared with 148 normal bladder epithelia (NBE) specimens using TaqMan-based real-time reverse transcription quantitative PCR (RT-qPCR). The diagnostic and prognostic evaluation of miR-182, miR-100, and miR-182/miR-100 ratio was also performed. miR-182 was upregulated in BCa and miR-100 was down-regulated in BCa compared with NBE (P ratio increased the diagnostic performance, yielding an AUC of 0.981 (97.01% sensitivity and 90.54% specificity). Moreover, miR-182/miR-100 ratio was associated with pT-stage, histological grade, BCa recurrence and carcinoma in situ (P analysis indicated that miR-182/miR-100 ratio was an independent prognostic factor for overall survival (Hazard ratio: 7.142; 95% CI: 2.106 - 9.891; P analysis revealed that high-level of miR-182/miR-100 ratio was significantly correlated with shortened survival time for BCa patients (P ratio may serve as a novel promising biomarker for diagnosis and survival prediction in BCa. Further studies are needed to elucidate the role of miR-182/miR-100 ratio as a non‑invasive diagnostic tool for BCa.
Kashuba, Elena; Carbone, Ennio; Di Fabrizio, Enzo M.; Tirinato, Luca; Petruchek, Maria; Drummond, Catherine; Kovalevska, Larysa; Gurrapu, Sreeharsha; Mushtaq, Muhammad; Darekar, Suhas D.
2015-01-01
We have shown earlier that overexpression of the human mitochondrial ribosomal protein MRPS18-2 (S18-2) led to immortalization of primary rat embryonic fibroblasts. The derived cells expressed the embryonic stem cell markers, and cellular pathways
2 CFR 182.125 - Does this part affect the Federal contracts that I receive?
2010-01-01
... GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.125 Does this part affect the Federal contracts that I... violation of the requirements of this part, as described in § 182.510(c). However, this part does not apply...
Energy Technology Data Exchange (ETDEWEB)
Hernandez B, C.A
2004-07-01
In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
Kashuba, Elena
2015-05-12
We have shown earlier that overexpression of the human mitochondrial ribosomal protein MRPS18-2 (S18-2) led to immortalization of primary rat embryonic fibroblasts. The derived cells expressed the embryonic stem cell markers, and cellular pathways that control cell proliferation, oxidative phosphorylation, cellular respiration, and other redox reactions were activated in the immortalized cells. Here we report that, upon overexpression of S18-2 protein, primary rat skin fibroblasts underwent cell transformation. Cells passed more than 300 population doublings, and two out of three tested clones gave rise to tumors in experimental animals. Transformed cells showed anchorage-independent growth and loss of contact inhibition; they expressed epithelial markers, such as E-cadherin and β-catenin. Transformed cells showed increased telomerase activity, disturbance of the cell cycle, and chromosomal instability. Taken together, our data suggest that S18-2 is a newly identified oncoprotein that may be involved in cancerogenesis.
182Pt as a possible candidate for X(5) symmetry
International Nuclear Information System (INIS)
Petkov, P; Gladnsihki, K A; Dewald, A; Fransen, C; Hackstein, M; Jolie, J; Pissulla, Th; Rother, W; Zell, K O
2012-01-01
Recently, a new island of X(5) nuclei has been suggested around A=180 exemplified by some Osmium isotopes. To investigate the limits of its region, a Recoil-distance Doppler shift lifetime measurement has been performed for 182 Pt. For the data analysis, the Differential decay curve method has been applied in a newly developed version convenient for low recoil velocities and a non-negligible fraction of nuclei stopped already in the target. The level energies and the newly deduced transition quadrupole moments in the yrast band reveal the persistence of X(5) features in the investigated nucleus, but other spectroscopic data and IBM and GCM calculations indicate shape coexistence and a position of 182 Pt close but not at the critical point of the shape-transition.
MELCOR 1.8.2 assessment: Surry PWR TMLB' (with a DCH study)
International Nuclear Information System (INIS)
Kmetyk, L.N.; Cole, R.K. Jr.; Smith, R.C.; Summers, R.M.; Thompson, S.L.
1994-02-01
MELCOR is a fully integrated, engineering-level computer code, being developed at Sandia National Laboratories for the USNRC. This code models the entire spectrum of severe accident phenomena in a unified framework for both BWRs and PWRs. As part of an ongoing assessment program, the MELCOR computer code has been used to analyze a station blackout transient in Surry, a three-loop Westinghouse PWR. Basecase results obtained with MELCOR 1.8.2 are presented, and compared to earlier results for the same transient calculated using MELCOR 1.8.1. The effects of new models added in MELCOR 1.8.2 (in particular, hydrodynamic interfacial momentum exchange, core debris radial relocation and core material eutectics, CORSOR-Booth fission product release, high-pressure melt ejection and direct containment heating) are investigated individually in sensitivity studies. The progress in reducing numeric effects in MELCOR 1.8.2, compared to MELCOR 1.8.1, is evaluated in both machine-dependency and time-step studies; some remaining sources of numeric dependencies (valve cycling, material relocation and hydrogen burn) are identified
26 CFR 1.182-4 - Definition of “land suitable for use in farming”, etc.
2010-04-01
... (continued) § 1.182-4 Definition of “land suitable for use in farming”, etc. For purposes of section 182, the term land suitable for use in farming means land which, as a result of the land clearing activities... term livestock includes cattle, hogs, horses, mules, donkeys, sheep, goats, captive fur-bearing animals...
Energy Technology Data Exchange (ETDEWEB)
Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2012-04-16
Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the
2010-04-01
... conjunction with spices, seasonings, and flavorings. 182.40 Section 182.40 Food and Drugs FOOD AND DRUG... in conjunction with spices, seasonings, and flavorings. Natural extractives (solvent-free) used in conjunction with spices, seasonings, and flavorings that are generally recognized as safe for their intended...
36 CFR 18.2 - What definitions do you need to know to understand this part?
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false What definitions do you need to know to understand this part? 18.2 Section 18.2 Parks, Forests, and Public Property NATIONAL PARK... need to know to understand this part? In addition to the definitions contained in 36 CFR Part 1, the...
Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium
International Nuclear Information System (INIS)
Bretheau-Raynal, Francoise
1981-01-01
Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr
27 CFR 19.182 - Change in name of proprietor.
2010-04-01
... Plants Changes After Original Qualification § 19.182 Change in name of proprietor. Where there is to be a change in the individual, firm, or corporate name, the proprietor shall file application to amend the... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change in name of...
46 CFR 182.460 - Ventilation of spaces containing machinery powered by, or fuel tanks for, gasoline.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation of spaces containing machinery powered by, or fuel tanks for, gasoline. 182.460 Section 182.460 Shipping COAST GUARD, DEPARTMENT OF HOMELAND..., gasoline. (a) A space containing machinery powered by, or fuel tanks for, gasoline must have a ventilation...
21 CFR 182.70 - Substances migrating from cotton and cotton fabrics used in dry food packaging.
2010-04-01
... used in dry food packaging. 182.70 Section 182.70 Food and Drugs FOOD AND DRUG ADMINISTRATION... used in dry food packaging. Substances migrating to food from cotton and cotton fabrics used in dry food packaging that are generally recognized as safe for their intended use, within the meaning of...
2012-11-27
... NUCLEAR REGULATORY COMMISSION [NRC-2012-0285] Regulatory Guide 1.182, ``Assessing and Managing Risk Before Maintenance Activities at Nuclear Power Plants'' AGENCY: Nuclear Regulatory Commission... withdrawing Regulatory Guide (RG)1.182, Revision (Rev.) 0, ``Assessing and Managing Risk Before Maintenance...
Hsa-mir-182 suppresses lung tumorigenesis through down regulation of RGS17 expression in vitro
International Nuclear Information System (INIS)
Sun, Yihua; Fang, Rong; Li, Chenguang; Li, Li; Li, Fei; Ye, Xiaolei; Chen, Haiquan
2010-01-01
Lung cancer is one of the most devastating diseases worldwide. RGS17 is previously shown to be over-expressed in human lung adenocarcinomas and plays an important role in lung tumor growth. Here we have identified a miRNA, has-mir-182, involved in the regulation of RGS17 expression through two conserved sites located in its 3' UTR region. Consistently, endogenous RGS17 expression level is regulated by hsa-mir-182 in human lung cancer cell lines. Similar to the knockdown of RGS17, ectopic expression of hsa-mir-182 significantly inhibits lung cancer cell proliferation and anchorage-independent cell growth, which can be rescued by re-expression of RGS17. Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer.
Directory of Open Access Journals (Sweden)
Guillaume Jannot
2016-12-01
Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.
Analysis of well ER-18-2 testing, Western Pahute Mesa - Oasis Valley FY 2000 testing program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-18-2 during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-18-2 Data Report for Development and Hydraulic Testing.
Determination of the disintegration rate and gamma emission probabilities per decay of 182 Ta
International Nuclear Information System (INIS)
Silva, Eliezer Antonio da
2008-01-01
In this work the procedure developed for the standardization of 182 Ta sources produced by irradiation at the IPEN IEA-R1 research reactor is presented. The 182 Ta decays with a half-life of 114 days by β - emission, populating the excited levels of 182 W. It emits gamma rays with several energies mainly between 31 keV and 264 keV and between 1001 keV and 1453 keV. The measurements were performed in a 4πβ-γ coincidence system by using the extrapolation technique. The coincidence system is composed of a 4 π proportional counter coupled to a NaI(Tl) cristal. The measurements were undertaken selecting two windows in the γ-channel, in order to check the consistency of the results. A Monte Carlo calculation was performed in order to predict the behavior of the observed activity as a function of 4πβ the detector efficiency and the results were compared to experimental values. The most intense gamma-ray emission probabilities of 182 Ta were determined by means of an HPGe gamma spectrometer, the germanium efficiency curve was obtained by using sources 152 Eu, 241 Am, 60 Co, 133 Ba and 166m Ho standardized in a primary system. The uncertainties involved in the measurements were treated by the covariance methodology. The results obtained are in good agreement with the experimental uncertainty compared with literature values. (author)
46 CFR 182.465 - Ventilation of spaces containing diesel machinery.
2010-10-01
... furnish natural or powered supply and exhaust ventilation. The total inlet area and the total outlet area... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation of spaces containing diesel machinery. 182... Ventilation of spaces containing diesel machinery. (a) A space containing diesel machinery must be fitted with...
Study of high-spin states in 181,182Os
International Nuclear Information System (INIS)
Kutsarova, T.; Fallon, P.; Howe, D.; Mokhtar, A.R.; Sharpey-Schafer, J.F.; Walker, P.; Chowdhury, P.; Fabricius, B.; Sletten, G.; Frauendorf, S.
1995-01-01
High-spin states in the nuclei 181,182 Os have been populated in the 150 Nd( 36 S,xn) reactions and studied with the ESSA30 array. The nucleus 181 Os has also been studied at the NBI tandem accelerator using the 167 Er( 18 O,4n) reaction. The previously known bands in both nuclei have been extended to higher spins and two new side bands have been found in 181 Os. In the latter nucleus the ground state has been established to have I π =(1)/(2) - . The extraction of the ratios of reduced transition probabilities B(M1)/B(E2) from branching and E2/M1 mixing ratios permitted configuration assignments for most of the bands in both nuclei. The analysis has been carried out within the semiclassical vector model for M1 radiation. The positive-parity yrare sequences in 182 Os and the band based on the I π = K π =(23)/(2) - state in 181 Os have been interpreted as t-bands arising from a rotation about a tilted axis. The alignment behaviour and the crossing frequencies are for most of the bands consistent with predictions of the cranked shell model. ((orig.))
2010-04-01
... required in case of tax-paid articles used for further manufacture. 53.182 Section 53.182 Alcohol, Tobacco... articles used for further manufacture. (a) Evidence to be submitted by claimant. No claim for credit or... material in the manufacture or production of, or as a component part of, a second article manufactured or...
Decay of the 16.3 min Decay of the 16.3 min {sup 182}Ta Isomer
Energy Technology Data Exchange (ETDEWEB)
Hoejeberg, M [Inst. of Physics, Univ. of Stockholm, Stockholm (Sweden); Malmskog, S G [AB Atomenergi, Nykoeping (Sweden)
1967-01-15
Some transitions in the decay of the 16.3 min {sup 182}Ta isomer have been studied with a Ge(Li) detector and a double lens electron coincidence spectrometer. Gamma ray and conversion electron intensities were measured. From a delayed coincidence experiment it was concluded that both of the two lowest excited states in {sup 182}Ta had a half life less than 30 psec.
2 CFR 182.105 - Do terms in this part have special meanings?
2010-01-01
... FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.105 Do terms in this part have special meanings? This part uses terms...
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
2009-01-01
Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even
Energy Technology Data Exchange (ETDEWEB)
Yao, Jingjing [Department of Urology, Shanghai Changhai Hospital, Second Military Medical University, Shanghai, 200433 (China); Xu, Chen [Research Center of Developmental Biology, Second Military Medical University, 800th Xiangyin Road, Shanghai, 200433 (China); Department of Orthopedics, Changzheng Hospital Affiliated to Second Military Medical University, 415th Feng Yang Road, Shanghai, 200003 (China); Fang, Ziyu; Li, Yaoming [Department of Urology, Shanghai Changhai Hospital, Second Military Medical University, Shanghai, 200433 (China); Liu, Houqi; Wang, Yue [Research Center of Developmental Biology, Second Military Medical University, 800th Xiangyin Road, Shanghai, 200433 (China); Translational Medicine Center, Second Military Medical University, 800th Xiangyin Road, Shanghai, 200433 (China); Xu, Chuanliang [Department of Urology, Shanghai Changhai Hospital, Second Military Medical University, Shanghai, 200433 (China); Sun, Yinghao, E-mail: sunyh@medmail.com.cn [Department of Urology, Shanghai Changhai Hospital, Second Military Medical University, Shanghai, 200433 (China)
2016-05-20
Abstracts: MicroRNAs (miRNAs) are important endogenous gene regulators that play key roles in prostate cancer development and metastasis. However, specific miRNA expression patterns in prostate cancer tissues from Chinese patients remain largely unknown. In this study, we compared miRNA expression patterns in 65 pairs of prostate cancer and para-cancer tissues by RNA sequencing and found that miR-182-5p was the most up-regulated miRNA in prostate cancer tissues. The result was validated using realtime PCR in 18 pairs of prostate cancer and para-cancer tissues. In in vitro analysis, it was confirmed that miR-182-5p promotes prostate cancer cell proliferation, invasion and migration and inhibit apoptosis. In addition, the androgen receptor directly regulated the transcription of miR-182-5p, which could target to the 3′UTR of ARRDC3 mRNA and affect the expression of ARRDC3 and its downstream gene ITGB4. For the in vivo experiment, miR-182-5p overexpression also promoted the growth and progression of prostate cancer tumors. In this regard, we suggest that miR-182-5p may be a key androgen receptor-regulated factor that contributes to the development and metastasis of Chinese prostate cancers and may be a potential target for the early diagnosis and therapeutic studies of prostate cancer. -- Highlights: •miR-182-5p is the mostly up-regulated miRNA in Chinese prostate cancer. •miR-182-5p is regulated by androgen receptor. •miR-182-5p promotes prostate cancer progression. •miR-182-5p regulates ARRDC3/ITGB4 pathway.
International Nuclear Information System (INIS)
Yao, Jingjing; Xu, Chen; Fang, Ziyu; Li, Yaoming; Liu, Houqi; Wang, Yue; Xu, Chuanliang; Sun, Yinghao
2016-01-01
Abstracts: MicroRNAs (miRNAs) are important endogenous gene regulators that play key roles in prostate cancer development and metastasis. However, specific miRNA expression patterns in prostate cancer tissues from Chinese patients remain largely unknown. In this study, we compared miRNA expression patterns in 65 pairs of prostate cancer and para-cancer tissues by RNA sequencing and found that miR-182-5p was the most up-regulated miRNA in prostate cancer tissues. The result was validated using realtime PCR in 18 pairs of prostate cancer and para-cancer tissues. In in vitro analysis, it was confirmed that miR-182-5p promotes prostate cancer cell proliferation, invasion and migration and inhibit apoptosis. In addition, the androgen receptor directly regulated the transcription of miR-182-5p, which could target to the 3′UTR of ARRDC3 mRNA and affect the expression of ARRDC3 and its downstream gene ITGB4. For the in vivo experiment, miR-182-5p overexpression also promoted the growth and progression of prostate cancer tumors. In this regard, we suggest that miR-182-5p may be a key androgen receptor-regulated factor that contributes to the development and metastasis of Chinese prostate cancers and may be a potential target for the early diagnosis and therapeutic studies of prostate cancer. -- Highlights: •miR-182-5p is the mostly up-regulated miRNA in Chinese prostate cancer. •miR-182-5p is regulated by androgen receptor. •miR-182-5p promotes prostate cancer progression. •miR-182-5p regulates ARRDC3/ITGB4 pathway.
Yoshida, Kazuko; Ma, Dawei; Constabel, C Peter
2015-03-01
Trees in the genus Populus (poplar) contain phenolic secondary metabolites including the proanthocyanidins (PAs), which help to adapt these widespread trees to diverse environments. The transcriptional activation of PA biosynthesis in response to herbivory and ultraviolet light stress has been documented in poplar leaves, and a regulator of this process, the R2R3-MYB transcription factor MYB134, has been identified. MYB134-overexpressing transgenic plants show a strong high-PA phenotype. Analysis of these transgenic plants suggested the involvement of additional MYB transcription factors, including repressor-like MYB factors. Here, MYB182, a subgroup 4 MYB factor, was found to act as a negative regulator of the flavonoid pathway. Overexpression of MYB182 in hairy root culture and whole poplar plants led to reduced PA and anthocyanin levels as well as a reduction in the expression of key flavonoid genes. Similarly, a reduced accumulation of transcripts of a MYB PA activator and a basic helix-loop-helix cofactor was observed in MYB182-overexpressing hairy roots. Transient promoter activation assays in poplar cell culture demonstrated that MYB182 can disrupt transcriptional activation by MYB134 and that the basic helix-loop-helix-binding motif of MYB182 was essential for repression. Microarray analysis of transgenic plants demonstrated that down-regulated targets of MYB182 also include shikimate pathway genes. This work shows that MYB182 plays an important role in the fine-tuning of MYB134-mediated flavonoid metabolism. © 2015 American Society of Plant Biologists. All Rights Reserved.
Directory of Open Access Journals (Sweden)
Chunlong Li
2014-04-01
Full Text Available To determine the relationships between miR-96-5p/-182-5p and GPC1 in pancreatic cancer (PC, we conducted the population and in vitro studies. We followed 38 pancreatic cancer patients, measured and compared the expression of miR-96-5p/-182-5p, GPC1, characteristics and patients’ survival time of different miR-96-5p/-182-5p expression levels in PC tissues. In an in vitro study, we investigated the proliferation, cycle and apotosis in cells transfected with mimics/inhibitors of the two miRNAs, and determine their effects on GPC1 by dual-luciferase assay. In the follow-up study, we found that the expressions of miR-96-5p/-182-5p were lower/higher in PC tissues; patients with lower/higher levels of miR-96-5p/-182-5p suffered poorer characteristics and decreased survival time. In the in vitro study, the expressions of miR-96-5p/-182-5p were different in cells. Proliferation of cells transfected with miR-96-5p mimics/inhibitors was lower/higher in Panc-1/BxPC-3; when transfected with miR-182-5p mimics/inhibitors, proliferation of cells were higher/lower in AsPC-1/Panc-1. In a cell cycle study, panc-1 cells transfected with miR-96-5p mimics was arrested at G0/G1; BxPC-3 cells transfected with miR-96-5p inhibitors showed a significantly decrease at G0/G1; AsPC-1 cells transfected with miR-182-5p mimics was arrested at S; Panc-1 cells transfected with miR-182-5p inhibitors showed a decrease at S. MiR-96-5p mimics increased the apoptosis rate in Panc-1 cells, and its inhibitors decreased the apoptosis rate in BxPC-3. Dual luciferase assay revealed that GPC1 was regulated by miR-96-5p, not -182-5p. We found that miR-96-5p/-182-5p as good markers for PC; miR-96-5p, rather than -182-5p, inhibits GPC1 to suppress proliferation of PC cells.
Energy Technology Data Exchange (ETDEWEB)
Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)
2011-07-15
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering
S182 and STM2 gene missense mutations in sporadic alzheimer disease
Energy Technology Data Exchange (ETDEWEB)
Higuchi, Susumu; Matsushita, Sachio; Hasegawa, Yoshio; Muramatsu, Taro [Kurihama National Hospital, Yokosuka (Japan)] [and others
1996-07-26
The linkage of genes S182 and STM2 to early-onset or late-onset sporadic Alzheimer disease (AD) was not found in a group of 97 clinically-diagnosed AD patients and 46 autopsy-confirmed AD cases, using PCR-RFLP methods. 7 refs.
PWSCC Mitigation of alloy 182: Testing of various mitigation processes
International Nuclear Information System (INIS)
Curieres, I. de; Calonne, O.; Crooker, P.
2011-01-01
Since the mid nineties, Primary Water Stress Corrosion Cracking (PWSCC) of Alloy 182 welds has occurred. This affects different components, even ones that are considered to have 'low-susceptibility' due to a low operating temperature such as the 'low operating temperature' reactor pressure vessel (RPV) heads in the global PWR fleet and bottom-mounted instrumentation nozzles, a location where currently there is no ready-to-deploy repair or replacement solution. Hence, there is an incentive to identify effective remedial measures to delay or prevent PWSCC initiation, even at 'low temperature' RPV heads in order to avoid wholesale replacement in the future. Working with EPRI, Areva has assessed the efficiency of various technological processes including brushing, polishing or compressive stress methods to mitigate PWSCC in Alloy 182. A first phase of the program is completed and the results will be presented. The emphasis will be put on the program's different testing phases and the different mitigation processes that were tested. Efficiency of 'chemical' surface treatments is not yet proved. EPRI stabilized chromium had a deleterious effect on crack initiation that should be reproduced and understood before drawing a definitive conclusion. The electropolishing process considered does not seem to be sufficiently reliable on Alloy 182 surfaces but longer exposures are required for a more definitive evaluation of this treatment. All tested 'mechanical' surface treatments i.e. -) GE-RENEW brushing, -) Fiber laser peening (Toshiba), -) Water Jet Peening (Mitsubishi), -) Water Jet Peening (Hitachi), -) Combination of GE-RENEW and Hitachi WJP have successfully inhibited crack initiation even though the surface compressive stresses induced on U-ends are lower than those expected on massive components. Past experience shows that crack initiation occurs in less than 250 h on U-bends with 'heavily ground' reference surfaces. Thus, it can be deduced that the present results show
MELCOR 1.8.2 Analyses in Support of ITER's RPrS
International Nuclear Information System (INIS)
Brad J Merrill
2008-01-01
The International Thermonuclear Experimental Reactor (ITER) Program is performing accident analyses for ITER's 'Rapport Preliminaire de Surete' (Report Preliminary on Safety - RPrS) with a modified version of the MELCOR 1.8.2 code. The RPrS is an ITER safety document required in the ITER licensing process to obtain a 'Decret Autorisation de Construction' (a Decree Authorizing Construction - DAC) for the ITER device. This report documents the accident analyses performed by the US with the MELCOR 1.8.2 code in support of the ITER RPrS effort. This work was funded through an ITER Task Agreement for MELCOR Quality Assurance and Safety Analyses. Under this agreement, the US was tasked with performing analyses for three accident scenarios in the ITER facility. Contained within the text of this report are discussions that identify the cause of these accidents, descriptions of how these accidents are likely to proceed, the method used to analyze the consequences of these accidents, and discussions of the transient thermal hydraulic and radiological release results for these accidents
National Ignition Facility subsystem design requirements target positioning subsystem SSDR 1.8.2
International Nuclear Information System (INIS)
Pittenger, L.
1996-01-01
This Subsystem Design Requirement document is a development specification that establishes the performance, design, development and test requirements for the target positioner subsystem (WBS 1.8.2) of the NIF Target Experimental System (WBS 1.8)
46 CFR 182.445 - Fill and sounding pipes for fuel tanks.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Fill and sounding pipes for fuel tanks. 182.445 Section... pipes for fuel tanks. (a) Fill pipes for fuel tanks must be not less than 40 millimeters (1.5 inches) nominal pipe size. (b) There must be a means of accurately determining the amount of fuel in each fuel...
International Nuclear Information System (INIS)
Carlson, R.A.
2005-01-01
The 182-F Reservoir was a rectangular-shaped concrete basin consisting of two sections divided by a concrete wall. The reservoir provided reserve water from the Columbia River for reactor cooling water and raw water for the 100 Area and had a storage capacity of 94.6 million liters (25 million gallons). The 182-F Reservoir was later used as a landfill for decontaminated rubble from buildings that were decommissioned in the 100-F Area. The results of the 182-F Reservoir evaluation showed that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River
The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta
International Nuclear Information System (INIS)
Turner, J.H.
2007-01-01
-limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at
Comparison of laboratory and field experience of PWSCC in Alloy 182 weld metal
Energy Technology Data Exchange (ETDEWEB)
Scott, P.; Meunier, M.-C.; Steltzlen, F. [AREVA NP, Tour AREVA, Paris La Defense (France); Calonne, O.; Foucault, M. [AREVA NP, Centre Technique, Le Creusot Cedex (France); Combrade, P. [ACXCOR, Saint Etienne (France); Amzallag, C. [EDF, SEPTEN, Villeurbanne (France)
2007-07-01
Laboratory studies of stress corrosion cracking of the nickel base weld metal, Alloy 182, in simulated PWR primary water suggest similar resistance to crack initiation and somewhat enhanced propagation rates relative to wrought Alloy 600. By contrast, field experience of cracking in the primary circuits of PWRs shows in general much better performance for Alloy 182 relative to Alloy 600 than would be anticipated from laboratory studies. This paper endeavours to resolve this apparent conundrum. It draws on the conclusions of recent research that has focussed on the role of surface finish, particularly cold work and residual stresses resulting from different fabrication processes, on the risk of initiating IGSCC in nickel base alloys in PWR primary water. It also draws on field experience of stress corrosion cracking that highlights the important role of surface finish for crack initiation. (author)
International Nuclear Information System (INIS)
Lavigne, Olivier; Shoji, Tetsuo; Takeda, Yoichi
2014-01-01
Graphical abstract: - Highlights: • Stable pitting events in function of the temperature are monitored by electrochemical impedance spectroscopy. • The pitting temperature for the nickel based alloy A182 in solution containing 450 ppm Cl − is defined as above 160 °C. • The presented method can be applied for others passive alloys as stainless steel in solution containing aggressive anions. - Abstract: A method based on electrochemical impedance spectroscopy (EIS) measurements to monitor the pitting temperature of passive alloys in a given media is developed in this communication. The pitting corrosion behavior of the nickel based alloy 182 in water containing 450 ppm by weight of chloride is presented in this study. The analysis of the EIS fit parameters from the proposed equivalent electrical circuit allows to determine the temperature from which stable pitting event occurs at open circuit potential. For the A182 sample this temperature is measured above 160 °C
2 CFR 182.110 - What do subparts A through F of this part do?
2010-01-01
... FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.110 What do subparts A through F of this part do? Subparts A through F...
Directory of Open Access Journals (Sweden)
Sarah E. Riad
2018-03-01
Full Text Available HCV entry involves a complex interplay between viral and host molecules. During post-binding interactions, the viral E2 complexes with CD81 receptor for delivery to the tight junction proteins CLDN1 and OCLN, which aid in viral internalization. Targeting HCV entry receptors represents an appealing approach to inhibit viral infectivity. This study aimed at investigating the impact of targeting CLDN1 by microRNAs on HCV infectivity. miR-155 was previously shown to target the 3′UTR of CLDN1 mRNA. Therefore, miR-155 was used as a control in this study. In-silico analysis and luciferase reporter assay were utilized to identify potential targeting miRNAs. The impact of the identified miRNAs on CLDN1 mRNA and protein expression was examined by qRT-PCR, indirect immunofluorescence and western blotting, respectively. The role of the selected miRNAs on HCV infectivity was assessed by measuring the viral load following the ectopic expression of the selected miRNAs. miR-182 was identified in-silico and by experimental validation to target CLDN1. Both miR-155 and miR-182 inhibited CLDN1 mRNA and protein expression in infected Huh7 cells. Ectopic expression of miR-155 increased, while miR-182 reduced the viral load. In conclusion, despite repressing CLDN1, the impact of miR-155 and miR-182 on HCV infectivity is contradictory. Ectopic miR-182 expression is suggested as an upstream regulator of the entry factor CLDN1, harnessing HCV infection.
International Nuclear Information System (INIS)
Fernandez R, E.
2008-01-01
The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
Tang, Xiaoli; Zheng, Dong; Hu, Ping; Zeng, Zongyue; Li, Ming; Tucker, Lynne; Monahan, Renee; Resnick, Murray B; Liu, Manran; Ramratnam, Bharat
2014-03-01
Glycogen synthase kinase 3 beta (GSK3β) is a critical protein kinase that phosphorylates numerous proteins in cells and thereby impacts multiple pathways including the β-Catenin/TCF/LEF-1 pathway. MicroRNAs (miRs) are a class of noncoding small RNAs of ∼22 nucleotides in length. Both GSK3β and miR play myriad roles in cell functions including stem cell development, apoptosis, embryogenesis and tumorigenesis. Here we show that GSK3β inhibits the expression of miR-96, miR-182 and miR-183 through the β-Catenin/TCF/LEF-1 pathway. Knockout of GSK3β in mouse embryonic fibroblast cells increases expression of miR-96, miR-182 and miR-183, coinciding with increases in the protein level and nuclear translocation of β-Catenin. In addition, overexpression of β-Catenin enhances the expression of miR-96, miR-182 and miR-183 in human gastric cancer AGS cells. GSK3β protein levels are decreased in human gastric cancer tissue compared with surrounding normal gastric tissue, coinciding with increases of β-Catenin protein, miR-96, miR-182, miR-183 and primary miR-183-96-182 cluster (pri-miR-183). Furthermore, suppression of miR-183-96-182 cluster with miRCURY LNA miR inhibitors decreases the proliferation and migration of AGS cells. Knockdown of GSK3β with siRNA increases the proliferation of AGS cells. Mechanistically, we show that β-Catenin/TCF/LEF-1 binds to the promoter of miR-183-96-182 cluster gene and thereby activates the transcription of the cluster. In summary, our findings identify a novel role for GSK3β in the regulation of miR-183-96-182 biogenesis through β-Catenin/TCF/LEF-1 pathway in gastric cancer cells.
International Nuclear Information System (INIS)
Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.
2008-01-01
Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)
Directory of Open Access Journals (Sweden)
Ceme Ferreira jordy
1995-09-01
Full Text Available Resultados parciais de exame neurológico em 182 crianças normais com idades entre 6 e 14 anos são discutidos quanto ao surgimento das praxias na interação indivíduo-universo em relação com a dominância lateral. Com respeito aos presentes resultados e com referência a dados da literatura é delineada uma hipótese sobre a relação do processo consciente com o ato motor.The mechanisms and topology of the consciousness phenomenon are briefly presented. The present results and data from literature are used to point out that to localize in one certain part of the cerebrum the conscious process seems untenable. These results derive from the neurological examination on 182 normal children from 6 to 14 years old. The children's motor behaviour during the tests on 'praxia without object' shows the conscious process and attention to be attached to the motor action in the whole extension of its development. Therefore, the consciousness is considered such a process that is present at each moment and locus of the motor action. As pointed out by the present results, it seems that presence or absence of consciouness is regulated by intrapsychic mechanisms.
The g-factor of the K=25 isomer in sup 182 Os
Energy Technology Data Exchange (ETDEWEB)
Alderson, A.; Fallon, P.; Goldring, G.; Roberts, J.; Sharpey-Schafer, J.; Twin P. (Liverpool Univ. (UK). Oliver Lodge Lab.); Bentley, M.; Bruce, A. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Broude, C. (Weizmann Inst. of Science, Rehovoth (Israel). Dept. of Nuclear Physics); Dafni, E. (Rochester Univ., NY (USA). Nuclear Structure Research Lab.); Hass, M. (Argonne National Lab. (USA)); Nyberg, J.; Sletten, G. (Niels Bohr Inst., Roskilde (Denmark))
1989-09-28
The g-factor of the K=I=25 isomer in {sup 182}Os has been measured by observing the angular precession of the decay {gamma}-ray angular distribution in an external magnetic field as g=+0.425(8). This result is compared with predictions based on experimental g-factors of single-particle Nilsson orbitals in this mass region. (orig.).
Preparation, isolation and identification of non-conjugated C18:2 fatty acid isomers.
Fardin-Kia, Ali Reza
2016-12-01
Non-conjugated geometric/positional isomers of linoleic acid (c9,c12-18:2) are often present in processed foods and oils. The following work presents a simple addition/elimination reaction for preparation of non-conjugated 18:2 fatty acid isomers. A mixture containing positional and geometric isomers of C18:2 fatty acids was produced by addition of hydrobromic acid to the fatty acid double bonds, followed by its elimination with a strong sterically hindered base. Pure 8,12-, 8,13-, 9,12-, and 9,13-18:2 fatty acid methyl esters were isolated from the synthetic mixture by a combination of sub-ambient RP-HPLC and Ag + -HPLC. The determination of the double bond position was achieved by GC-MS using picolinyl esters derivatives. The determination of the fatty acid double bond geometric configuration was obtained by partial hydrogenation of the isolated isomer with hydrazine, followed by the GC-FID analysis. Published by Elsevier Ireland Ltd.
2 CFR 182.120 - Are any of my Federal assistance awards exempt from this part?
2010-01-01
... GOVERNMENTWIDE GUIDANCE FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.120 Are any of my Federal assistance awards exempt from...
25 CFR 900.182 - What other statutes and regulations apply to FTCA coverage?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to FTCA... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Federal Tort Claims Act Coverage General Provisions § 900.182 What other statutes...
International Nuclear Information System (INIS)
Mendonça, R.; Bosch, R.-W.; Van Renterghem, W.; Vankeerberghen, M.; Araújo Figueiredo, C. de
2016-01-01
Alloy 182 is a nickel-based weld metal, which is susceptible to stress corrosion cracking in PWR primary water. It shows a peak in SCC susceptibility at a certain temperature and hydrogen concentration. This peak is related to the electrochemical condition where the Ni to NiO transition takes place. One hypothesis is that the oxide layer at this condition is not properly developed and so the material is not optimally protected against SCC. Therefore the oxide layer formed on Alloy 182 is investigated as a function of the dissolved hydrogen concentration and temperature around this Ni/NiO transition. Exposure tests were performed with Alloy 182 and Ni coupons in a PWR environment at temperatures between 300 °C and 345 °C and dissolved hydrogen concentration between 5 and 35 cc (STP)H 2 /kg. Post-test analysis of the formed oxide layers were carried out by SEM, EDS and XPS. The exposure tests with Ni coupons showed that the Ni/NiO transition curve is at a higher temperature than the curve based on thermodynamic calculations. The exposure tests with Alloy 182 showed that oxide layers were present at all temperatures, but that the morphology changed from spinel crystals to needle like oxides when the Ni/NiO transition curve was approached. Oxide layers were present below the Ni/NiO transition curve i.e. when the Ni coupon was still free of oxides. In addition an evolved slip dissolution model was proposed that could explain the observed experimental results and the peak in SCC susceptibility for Ni-based alloys around the Ni/NiO transition. - Highlights: • Exposure tests with Ni-coupons showed that the Ni/NiO transition curve shifted to more oxidizing conditions. • The Ni specimens tested in PWR water were free of oxides at all temperatures. • The exposure tests with Alloy 182 showed that oxide layers were present at all temperatures. • The Alloy 182 surface morphology changed from spinel crystals to needle like oxides when the Ni/NiO curve was approached
Energy Technology Data Exchange (ETDEWEB)
Mendonça, R. [CAPES Foundation, Ministry of Education, Brasilia (Brazil); Bosch, R.-W., E-mail: rbosch@sckcen.be [SCK-CEN, Boeretang 200, 2400 Mol (Belgium); Van Renterghem, W.; Vankeerberghen, M. [SCK-CEN, Boeretang 200, 2400 Mol (Belgium); Araújo Figueiredo, C. de [CDTN/CNEN, Av. Antônio Carlos 6627, 31270-901 Belo Horizonte, MG (Brazil)
2016-08-15
Alloy 182 is a nickel-based weld metal, which is susceptible to stress corrosion cracking in PWR primary water. It shows a peak in SCC susceptibility at a certain temperature and hydrogen concentration. This peak is related to the electrochemical condition where the Ni to NiO transition takes place. One hypothesis is that the oxide layer at this condition is not properly developed and so the material is not optimally protected against SCC. Therefore the oxide layer formed on Alloy 182 is investigated as a function of the dissolved hydrogen concentration and temperature around this Ni/NiO transition. Exposure tests were performed with Alloy 182 and Ni coupons in a PWR environment at temperatures between 300 °C and 345 °C and dissolved hydrogen concentration between 5 and 35 cc (STP)H{sub 2}/kg. Post-test analysis of the formed oxide layers were carried out by SEM, EDS and XPS. The exposure tests with Ni coupons showed that the Ni/NiO transition curve is at a higher temperature than the curve based on thermodynamic calculations. The exposure tests with Alloy 182 showed that oxide layers were present at all temperatures, but that the morphology changed from spinel crystals to needle like oxides when the Ni/NiO transition curve was approached. Oxide layers were present below the Ni/NiO transition curve i.e. when the Ni coupon was still free of oxides. In addition an evolved slip dissolution model was proposed that could explain the observed experimental results and the peak in SCC susceptibility for Ni-based alloys around the Ni/NiO transition. - Highlights: • Exposure tests with Ni-coupons showed that the Ni/NiO transition curve shifted to more oxidizing conditions. • The Ni specimens tested in PWR water were free of oxides at all temperatures. • The exposure tests with Alloy 182 showed that oxide layers were present at all temperatures. • The Alloy 182 surface morphology changed from spinel crystals to needle like oxides when the Ni/NiO curve was
Energy Technology Data Exchange (ETDEWEB)
Silva, Giovana Pasqualini da
2008-07-01
The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
21 CFR 182.50 - Certain other spices, seasonings, essential oils, oleoresins, and natural extracts.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Certain other spices, seasonings, essential oils... GENERALLY RECOGNIZED AS SAFE General Provisions § 182.50 Certain other spices, seasonings, essential oils, oleoresins, and natural extracts. Certain other spices, seasonings, essential oils, oleoresins, and natural...
Energy Technology Data Exchange (ETDEWEB)
Barloutaud, R; Leveque, A; Lehmann, P; Quidort, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1959-07-01
The reduced probabilities of deexcitation of the first two 2 + levels of {sup 184}W, {sup 186}W, {sup 188}Os, {sup 190}Os, {sup 192}Os and {sup 194}Pt have been deduced from coulombic excitation experiments on these nuclei.The results are included in a chart of the properties of the first two 2 + levels of even-even nuclei situated between masses 182 and 206. The variation of these properties as a function of nuclear distortion is compared with the various theoretical predictions concerning vibration levels. (author) [French] Les probabilites reduites de desexcitation des deux premiers niveaux 2 + de {sup 184}W, {sup 186}W, {sup 188}Os, {sup 190}Os, {sup 192}Os and {sup 194}Pt ont ete deduites des experiences d'excitation coulombienne de ces noyaux. Les resultats sont inseres dans une systematique des proprietes des deux premiers niveaux 2 + des noyaux pairs-pairs situes entre les masses 182 et 206. La variation de ces proprietes en fonction de la deformation nucleaire est comparee aux diverses predictions theoriques concernant les niveaux de vibration. (auteur)
International Nuclear Information System (INIS)
Mulac-Jericevic, B.; Atassi, M.Z.
1986-01-01
A peptide, corresponding to the region 182-198 (peptide αT182-198) of the α chain of Torpedo californica acetylcholine (AChR) was synthesized, purified and characterized. The binding activities of this peptide to α-bungarotoxin and to cobratoxin were studied and compared to the activities of the previously reported synthetic peptide αT125-147 of Torpedo α chain. Binding studies were performed by quantitative radiometric titrations by studying the binding of 125 I-labelled peptides to toxin adsorbents and the binding of 125 I labelled toxins to peptide adsorbents. The specificity of the binding was confirmed by appropriate inhibition experiments. The results showed unequivocally that the α chain of AChR contains a second toxin binding region which resides within, but may not comprise all of, the residues 182-198. The binding of toxins to one synthetic region is inhibited by the other. Thus, the α chain of AChR contains at least two toxin binding regions which may either be two faces of a larger single binding site or, alternatively, two binding sites that are spatially very close and thus the binding of one synthetic region to the toxin site could sterically obstruct the binding of the second synthetic region
Cieplak-Rotowska, Maja K.; Tarnowski, Krzysztof; Rubin, Marcin; Fabian, Marc R.; Sonenberg, Nahum; Dadlez, Michal; Niedzwiecka, Anna
2018-01-01
The human GW182 protein plays an essential role in micro(mi)RNA-dependent gene silencing. miRNA silencing is mediated, in part, by a GW182 C-terminal region called the silencing domain, which interacts with the poly(A) binding protein and the CCR4-NOT deadenylase complex to repress protein synthesis. Structural studies of this GW182 fragment are challenging due to its predicted intrinsically disordered character, except for its RRM domain. However, detailed insights into the properties of proteins containing disordered regions can be provided by hydrogen-deuterium exchange mass spectrometry (HDX/MS). In this work, we applied HDX/MS to define the structural state of the GW182 silencing domain. HDX/MS analysis revealed that this domain is clearly divided into a natively unstructured part, including the CCR4-NOT interacting motif 1, and a distinct RRM domain. The GW182 RRM has a very dynamic structure, since water molecules can penetrate the whole domain in 2 h. The finding of this high structural dynamics sheds new light on the RRM structure. Though this domain is one of the most frequently occurring canonical protein domains in eukaryotes, these results are - to our knowledge - the first HDX/MS characteristics of an RRM. The HDX/MS studies show also that the α2 helix of the RRM can display EX1 behavior after a freezing-thawing cycle. This means that the RRM structure is sensitive to environmental conditions and can change its conformation, which suggests that the state of the RRM containing proteins should be checked by HDX/MS in regard of the conformational uniformity. [Figure not available: see fulltext.
Effect of surface machining on corrosion behavior of SA182-304 in simulated
International Nuclear Information System (INIS)
Zhang Zhiming; Wang Jianqiu; Han Enhou; Ke Wei
2015-01-01
Different machining processes of mechanical parts can cause surface damage layers with different levels. The surface deformed layer can affect the corrosion behavior and service life of these mechanical parts a lot during the following service process. As a result, it is a key issue for the fabrication of the mechanical parts with long life that the selection of proper machining parameters and the removal of surface damage. The purpose of this study is to study the influence of different turning parameters on the corrosion behavior of nuclear grade SA182-304 stainless steel widely used in the advanced pressured water reactors (PWRs). 6 kinds of samples with different surface state are prepared by a lathe with different machining parameters, such as the feed, cutting speed and back engagement of the cutting edge. The high temperature and high pressure immersion test of these samples in the simulated PWR primary watershows that machining processes can affect the microstructure and chemical composition of the formed surface oxide scales a lot. According to the experimental results, the proper machining parameters for the studied SA182-304 are suggested. (authors)
Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert
2015-02-01
Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.
Javadi, Hamidreza; Lotfi, Abbas Sahebghadam; Hosseinkhani, Saman; Mehrani, Hossein; Amani, Jafar; Soheili, Zahra Soheila; Hojati, Zahra; Kamali, Mehdi
2018-06-06
In the present research, we assumed that reducing the amounts of E6 and E7 oncoproteins by a specific siRNA sequence and recovering p53 and RB proteins, along with the recovery of the FOXO1 protein by applying anti-miR-182, would increase apoptosis and reduce proliferation rate in cancer cells. The HPV16-positive CaSki cervical cancer cell line was used. 48 hours after transfection of siRNA for targeting E6 and E7 oncoproteins and anti-miR-182, expression of its cellular targets p53, p21 and FOXO1 was assessed by real-time PCR, western blot analysis and immunocytofluorescence staining. In all treatments, apoptosis rate and viability were evaluated using Annexin-V-FITC apoptosis detection kits and MTT assays, respectively. Among the designed siRNAs, E6-1 and E7-2 proved the most effective in reducing E6 and E7 expressions by increasing the apoptotic rates to 12.4% and 16%, respectively, after 48 hours. Also, using anti-miR-182 increased apoptotic rate to 12.7% 48 hours after transfection of cervical cancer cells. The combinational use of either E6-1 or E7-2 siRNAs with anti-miR-182 resulted in a rise in apoptosis to 19.3% and 26%, respectively, higher than those obtained from the individual application of either without anti-miR-182. The simultaneous use of siRNA E6-1 and siRNA E7-2 with cisplatin increased sensitivity to cisplatin and reduced the viability of the cancer cells as compared to the use of cisplatin alone. The simultaneous use of cisplatin and anti-miR-182 had no considerable effect on viability or apoptosis rate compared to cisplatin alone.
Ceme Ferreira jordy
1995-01-01
Resultados parciais de exame neurológico em 182 crianças normais com idades entre 6 e 14 anos são discutidos quanto ao surgimento das praxias na interação indivíduo-universo em relação com a dominância lateral. Com respeito aos presentes resultados e com referência a dados da literatura é delineada uma hipótese sobre a relação do processo consciente com o ato motor.The mechanisms and topology of the consciousness phenomenon are briefly presented. The present results and data from literature a...
DEFF Research Database (Denmark)
Meyer, Anna Sina P; Meyer, Martin A S; Sørensen, Anne Marie
2014-01-01
BACKGROUND: Viscoelastic hemostatic assays may provide means for earlier detection of trauma-induced coagulopathy (TIC). METHODS: This is a prospective observational study of 182 trauma patients admitted to a Level 1 trauma center. Clinical data, thrombelastography (TEG), and rotational thromboel...
2013-06-25
...; Electronic Engine Control System Installation AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... feature(s) associated with the installation of an electronic engine control. The applicable airworthiness...) fuel. The J182T incorporates an engine controlled by an electronic engine [[Page 37959
Tank Farm WM-182 and WM-183 Heel Slurry Samples PSD Results
International Nuclear Information System (INIS)
Batcheller, T.A.; Huestis, G.M.
2000-01-01
Particle size distribution (PSD) analysis of INTEC Tank Farm WM-182 and WM-183 heel slurry samples were performed using a modified Horiba LA-300 PSD analyzer at the RAL facility. There were two types of testing performed: typical PSD analysis, and setting rate testing. Although the heel slurry samples were obtained from two separate vessels, the particle size distribution results were quite similar. The slurry solids were from approximately a minimum particle size of 0.5 mm to a maximum of 230 mm with about 90% of the material between 2-to-133 mm, and the cumulative 50% value at approximately 20 mm. This testing also revealed that high frequency sonication with an ultrasonic element may break-up larger particles in the WM-182 and WM-183 tank from heel slurries. This finding represents useful information regarding ultimate tank heel waste processing. Settling rate testing results were also fairly consistent with material from both vessels in that it appears that most of the mass of solids settle to an agglomerated, yet easily redispersed layer at the bottom. A dispersed and suspended material remained in the ''clear'' layer above the settled layer after about one-half an hour of settling time. This material had a statistical mode of approximately 5 mm and a maximum particle size of 30 mm
Search for extremely deformed systems in {sub 182}Os
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Chasman, R.R.; Janssens, R.V.F. [and others
1995-08-01
We performed an experiment at Gammasphere to search for elongated shapes in the nucleus {sup 182}Os. Recent calculations by R. R. Chasman show that this nucleus is the most promising for finding structures with major to minor axis ratios of 2.2:1 or greater. These calculations include a necking degree of freedom which is thought to be an improvement over past cranked Strutinsky calculations where predictions for extended shapes in Yb and Er nuclei were made. In order to populate {sup 182}Os at spins > 60 h, we utilized the {sup 139}Ba({sup 48}Ca,4n) reaction. The target was made by evaporating {sup 138}Ba onto a 500-{mu}g/cm{sup 2} Au foil, followed by the evaporation of {approximately}250-{mu}g/cm{sup 2} Au onto the exposed side of the Ba. Such a target was necessary since Ba is highly reactive with oxygen. Even after taking this precaution, the target suffered oxidation which adversely effected the quality of our data. The experiment was performed at Gammasphere using the predetermined energy of 220 MeV. A single target was used and the {sup 138}Ba had a thickness of 750 {mu}g/cm{sup 2}. The run lasted four days and {approximately}440 x 10{sup 6} 3-fold and higher Compton-suppressed Ge events were collected. No strong evidence for highly deformed structures was found in this data set. However, it is our belief that the oxygen contamination in our target greatly compromised the outcome of the experiment. Much of the background in our total projection is due to fusion reactions of {sup 48}Ca on oxygen isotopes. The resulting {gamma} rays are highly Doppler broadened and experience larger Doppler shifts relative to the Os residues. Thus, these {gamma} rays are spread out over the entire energy spectrum almost uniformly adding to the background. Our conclusion is that due to target problems, only 150-200 million of the coincidence events can be associated with Os-like residues.
Benchmarking MELCOR 1.8.2 for ITER Against Recent EVITA Results
International Nuclear Information System (INIS)
Merrill, Brad J.
2007-01-01
A version of MELCOR 1.8.2 modified for use in ITER Preliminary Safety Report analyses was validated against recent data from the EVITA facility located in Cadarache, France. EVITA Test Series 7 was used for this study to verify MELCOR's ability to predict the pressures, temperatures, cryoplate ice mass, and vacuum vessel (VV) condensate mass for test conditions in EVITA that include injections of steam, nitrogen, and water in to the EVITA VV after the walls had been heated to 165 C and the cryoplate had been cooled to -193 C. In general, the ability of MELCOR to predict the VV pressure and wall temperatures for the steam only and water only injection tests was very good. Predicted ice layer masses where larger than reported for the EVITA cryoplate, in particular for the steam only injection tests (∼40% too high), and the predicted condensate masses were less that measured in EVITA. Both of these discrepancies can be explained by ice porosity. The modified MELCOR 1.8.2 over predicts the EVITA VV pressure for the co-injection tests (e.g., steam plus nitrogen, or water plus nitrogen injections) by almost a factor of two. Based on parametric runs that where made by increasing the predicted cryoplate condensation rate, it is believed that this pressure over prediction is a result of an under predicted cryoplate condensation rate. The particulars of this study are documented in this report as well as conclusions about the impact this study has regarding the use of this version of MELCOR for consequence analyses for ITER safety reports
Gain measurements at 182 /angstrom/ in C VI generated by a Nd/glass laser
International Nuclear Information System (INIS)
Kim, D.; Skinner, C.H.; Umesh, G.; Suckewer, S.
1988-11-01
We present recent gain measurements in C VI at 182 A for a soft x-ray amplifier produced by a line-focused glass laser(1.053 μm) on a solid carbon target. The maximum gain measured was 8 +- 1 cm/sup /minus/1/ in the recombining plasma column with additional radiation cooling by iron impurities. 10 refs., 3 figs
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de
2008-01-01
Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)
Davari, Maliheh; Soheili, Zahra-Soheila; Samiei, Shahram; Sharifi, Zohreh; Pirmardan, Ehsan Ranaei
2017-01-29
miR-183 cluster, composed of miR-183/-96/-182 genes, is highly expressed in the adult retina, particularly in photoreceptors. It involves in development, maturation and normal function of neuroretina. Ectopic overexpression of miR-183/-96/-182 genes was performed to assess reprogramming of hRPE cells. They were amplified from genomic DNA and cloned independently or in tandem configuration into pAAV.MCS vector. hRPE cells were then transfected with the recombinant constructs. Real-Time PCR was performed to measure the expression levels of miR-183/-96/-182 and that of several retina-specific neuronal genes such as OTX2, NRL, PDC and DCT. The transfected cells also were immunocytochemically examined for retina-specific neuronal markers, including Rhodopsin, red opsin, CRX, Thy1, CD73, recoverin and PKCα, to determine the cellular fate of the transfected hRPE cells. Data showed that upon miR-183/-96/-182 overexpression in hRPE cultures, the expression of neuronal genes including OTX2, NRL, PDC and DCT was also upregulated. Moreover, miR-183 cluster-treated hRPE cells were immunoreactive for neuronal markers such as Rhodopsin, red opsin, CRX and Thy1. Both transcriptional and translational upregulation of neuronal genes in miR-183 cluster-treated hRPE cells suggests that in vitro overexpression of miR-183 cluster could trigger reprogramming of hRPE cells to retinal neuron fate. Copyright © 2016 Elsevier Inc. All rights reserved.
182nd Symposium of the International Astronomical Union
Bertout, Claude
1997-01-01
Herbig-Haro objects were discovered 50 years ago, and during this half century they have developed from being mysterious small nebulae to be coming an important phenomenon in star formation. Indeed, HH flows are now recognized not only as fascinating astrophysical laboratories involving shock physics and chemistry, hydrodynamics and radiation processes, but it has gradually been realized that HH flows hold essential clues to the birth and early evolution of low mass stars. IAU Symposium No. 182 on Herbig-Haro Flows and the Birth of Low Mass Stars were held from January 20 to 24, 1997 in Chamonix in the french alps. A total of 178 researchers from 26 countries met to discuss our present level of understanding of Herbig-Haro flows and their relation to disk accretion events and T Tauri winds and other outflow phenomena like molecular outflows, embedded molecular hydrogen flows and radio jets. The present book contains the manuscripts from the oral contributions of the symposium. The poster papers were printed...
Measurement of high energy neutrons via Lu(n,xn) reactions
International Nuclear Information System (INIS)
Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.
1997-07-01
High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab
Ham, Byung-Joo; Choi, Myoung-Jin; Lee, Heon-Jeong; Kang, Rhee-Hun; Lee, Min-Soo
2005-06-01
It is well established that approximately 50% of the variance in personality traits is genetic. The goal of this study was to investigate a relationship between personality traits and the T-182C polymorphism in the norepinephrine transporter gene. The participants included 115 healthy adults with no history of psychiatric disorders and other physical illness during the past 6 months. All participants were tested with the Temperament and Character Inventory and genotyped norepinephrine transporter gene polymorphism. Differences on the Temperament and Character Inventory dimensions among three groups were examined with one-way analysis of variance. Our study suggests that the norepinephrine transporter T-182C gene polymorphism is associated with reward dependence in Koreans, but the small number of study participants and their sex and age heterogeneity limits generalization of our results. Further studies are necessary with a larger number of homogeneous participants to confirm whether the norepinephrine transporter gene is related to personality traits.
Bree, N; Wrzosek-Lipska, K; Petts, A; Andreyev, A; Bastin, B; Bender, M; Blazhev, A; Bruyneel, B; Butler, P A; Butterworth, J; Carpenter, M P; Cederkäll, J; Clément, E; Cocolios, T E; Deacon, A; Diriken, J; Ekström, A; Fitzpatrick, C; Fraile, L M; Fransen, Ch; Freeman, S J; Gaffney, L P; García-Ramos, J E; Geibel, K; Gernhäuser, R; Grahn, T; Guttormsen, M; Hadinia, B; Hadyńska-Kle K, K; Hass, M; Heenen, P-H; Herzberg, R-D; Hess, H; Heyde, K; Huyse, M; Ivanov, O; Jenkins, D G; Julin, R; Kesteloot, N; Kröll, Th; Krücken, R; Larsen, A C; Lutter, R; Marley, P; Napiorkowski, P J; Orlandi, R; Page, R D; Pakarinen, J; Patronis, N; Peura, P J; Piselli, E; Rahkila, P; Rapisarda, E; Reiter, P; Robinson, A P; Scheck, M; Siem, S; Singh Chakkal, K; Smith, J F; Srebrny, J; Stefanescu, I; Tveten, G M; Van Duppen, P; Van de Walle, J; Voulot, D; Warr, N; Wenander, F; Wiens, A; Wood, J L; Zielińska, M
2014-04-25
Coulomb-excitation experiments to study electromagnetic properties of radioactive even-even Hg isotopes were performed with 2.85 MeV/nucleon mercury beams from REX-ISOLDE. Magnitudes and relative signs of the reduced E2 matrix elements that couple the ground state and low-lying excited states in Hg182-188 were extracted. Information on the deformation of the ground and the first excited 0+ states was deduced using the quadrupole sum rules approach. Results show that the ground state is slightly deformed and of oblate nature, while a larger deformation for the excited 0+ state was noted in Hg182,184. The results are compared to beyond mean field and interacting-boson based models and interpreted within a two-state mixing model. Partial agreement with the model calculations was obtained. The presence of two different structures in the light even-mass mercury isotopes that coexist at low excitation energy is firmly established.
Stress corrosion cracking of alloy 182 weld in a PWR water environment
International Nuclear Information System (INIS)
Lima, Luciana Iglesias Lourenco; Schvartzman, Monica Maria de Abreu Mendonca; Quinan, Marco Antonio Dutra; Soares, Antonio Edicleto Gomes; Piva, Stephano P.T.
2011-01-01
The weld used to connect two different metals is known as dissimilar metal welds (DMW). In the nuclear power plant, this weld is used to join stainless steel nipples to low alloy carbon steel components on the nuclear pressurized water reactor (PWR). In most cases, nickel alloys are used to joint these materials. These alloys are known to accommodate the differences in composition and thermal expansion of the two materials. The stress corrosion cracking (SCC) is a phenomenon that occurs in nuclear power plants metallic components where susceptibility materials are subjected to the simultaneously effect of mechanical stress and an aggressive media with different compositions. SCC is one of degradation process that gradually introduces damage of components, change their characteristics with the operation time. The nickel alloy 600, and their weld metals (nickel alloys 82 and 182), originally selected due to its high corrosion resistance, it exhibit after long operation period (20 years), susceptibility to the SCC. This study presents a comparative work between the SCC in the Alloy 182 filler metal weld in two different temperatures (303 deg C and 325 deg C) in primary water. The susceptibility to stress corrosion cracking was assessed using the slow strain rate tensile (SSRT) test. The results of the SSRT tests indicated that SCC is a thermally-activated mechanism and that brittle fracture caused by the corrosion process was observed at 325 deg C. (author)
Naji, Mohammad; Nekoonam, Saeid; Aleyasin, Ashraf; Arefian, Ehsan; Mahdian, Reza; Azizi, Elham; Shabani Nashtaei, Maryam; Amidi, Fardin
2018-01-01
Polycystic ovary syndrome (PCOS) is one of the most common endocrinopathies that affects women in reproductive age. MicroRNAs (miRNAs) play crucial roles in normal function of female reproductive system and folliculogenesis. Deregulated expression of miRNAs in PCOS condition may be significantly implicated in the pathogenesis of PCOS. We determined relative expression of miR-15a, miR-145, and miR-182 in granulosa-lutein cells (GLCs), follicular fluid (FF), and serum of PCOS patients. Human subjects were divided into PCOS (n = 20) and control (n = 21) groups. GLCs, FF, and serum were isolated and stored. RNA isolation was performed and cDNA was reversely transcribed using specific stem-loop RT primers. Relative expression of miRNAs was calculated after normalization against U6 expression. Correlation of miRNAs' expression level with basic clinical features and predictive value of miRNAs in FF and serum were appraised. Relative expression of miR-145 and miR-182 in GLCs was significantly decreased in PCOS, but miR-182 in FF of PCOS patients revealed up-regulated levels. Significant correlations between level of miRNAs in FF and serum and hormonal profile of subjects were observed. MiR-182 in FF showed a significant predictive value with AUC of 0.73, 76.4% sensitivity, and 70.5% specificity which was improved after combination of miR-182 and miR-145. A significant dysregulation of miR-145 and miR-182 in GLCs of PCOS may indicate their involvement in pathogenesis of PCOS. Differential up-regulation of miR-182 in FF of PCOS patients with its promising predictive values for discrimination of PCOS reinforced the importance of studying miRNAs' profile in FF.
30 CFR 250.182 - When may the Secretary cancel a lease at the exploration stage?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When may the Secretary cancel a lease at the... Requirements, Lease Term Extensions, and Lease Cancellations § 250.182 When may the Secretary cancel a lease at... be modified to avoid the condition(s). The Secretary may cancel the lease if: (a) The primary lease...
Benchmarking MELCOR 1.8.2 for ITER Against Recent EVITA Results
Energy Technology Data Exchange (ETDEWEB)
Merrill, Brad J
2007-11-01
A version of MELCOR 1.8.2 modified for use in ITER Preliminary Safety Report analyses was validated against recent data from the EVITA facility located in Cadarache, France. EVITA Test Series 7 was used for this study to verify MELCOR’s ability to predict the pressures, temperatures, cryoplate ice mass, and vaccum vessel (VV) condensate mass for test conditions in EVITA that include injections of steam, nitrogen, and water in to the EVITA VV after the walls had been heated to 165 ºC and the cryoplate had been cooled to -193 ºC. In general, the ability of MELCOR to predict the VV pressure and wall temperatures for the steam only and water only injection tests was very good. Predicted ice layer masses where larger than reported for the EVITA cryoplate, in particular for the steam only injection tests (~40% too high), and the predicted condensate masses were less that measured in EVITA. Both of these descrpancies can be explained by ice porosity. The modified MELCOR 1.8.2 over predicts the EVITA VV pressure for the co-injection tests (e.g., steam plus nitrogen, or water plus nitrogen injections) by almost a factor of two. Based on parametric runs that where made by increasing the predicted cryoplate condensation rate, it is believed that this pressure over prediction is a result of an under predicted cryoplate condensation rate. The particulars of this study are documented in this report as well as conclusions about the impact this study has regarding the use of this verions of MELCOR for consequence analyses for ITER safety reports.
Measurements of shape co-existence in $^{182,184}$Hg using Coulomb excitation
Voulot, D; Paul, E S; Siem, S; Czosnyka, T; Napiorkowski, P J; Iwanicki, J S
2007-01-01
We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{182,184}$Hg ions from the REX facility to enable the lowest states of these nuclei to be Coulomb excited. By measuring the $\\gamma$-ray yields using the MINIBALL array we can measure the transition and diagonal E2 matrix elements for these states. This will give quantitative information about the nature of the shape coexistence in these nuclei and allow the sign of the quadrupole deformation be determined for the first time. We require 24 shifts to fulfill the aims of the experiment.
Štúdium oneskoreného štiepenia po $\\beta$-rozpade v izotopoch $^{178-182}$Tl
Andel, Boris
Topic of the thesis is $\\beta$-delayed fission. We describe nuclear fission, more specifically $\\beta$-delayed fission and its importance in the theoretical part of the thesis. We look briefly to four models of fission barriers (FRLDM, Thomas-Fermi, LSD and ETFSI model) and to $\\alpha$- and $\\beta$-decay of the nucleus. In the beginning of the experimental part of the thesis we describe ISOLDE facility at CERN and the detection setup of our experiment. In result part of the thesis, we are comparing models of fission barriers and analyzing data from the experiment IS466 –(2), which was undertook at ISOLDE. Four separate measurements were performed with the direct production of isotopes $^{178}$Tl, $^{180}$Tl, $^{182}$Tl and $^{202}$Fr. We evaluated delayed fission probabilities of produced isotopes $P_{βDF}\\,$($^{178}$Tl) = (2,8 ± 1,1)$\\times$10$^{-3}$, $P_{βDF}\\,$($^{180}$Tl) = (3,9 ± 1,1)$\\times$10$^{-5}$, $P_{βDF}\\,$($^{182}$Tl) < 1,4$\\times$10$^{-8}$ and $P_{βDF}\\,$($^{202}$Fr) = (2,1 ± 0,4)...
Energy Technology Data Exchange (ETDEWEB)
Ham, Jun Hyuk; Choi, Kyoung Joon; Kim, Ji Hyun [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)
2015-10-15
To prevent such critical matters above mentioned, investigation about degradation mechanism of materials by thermal aging should be conducted. However, there are no sufficient studies on this field. Therefore, the final goal of this study is to investigate microstructure along the DMW undergone thermal aging process. Firstly, in order to get a reference data for further comparison analysis which is expected to show degradation mechanism of the weld joint, un-heated weld joint was investigated with several instruments, Vickers hardness tester, scanning electron microscope (SEM), and an energy-dispersive X-ray spectrometer (EDS). Detail instrumental analysis in Alloy 600 - Alloy 182 - A508 Gr. 3 DMW joint were performed in order to investigate microstructure and mechanical properties of material. Following conclusions can be drawn from this study. Alloy 182 has austenitic dendrite structure which is formed by heat flow during welding process. Type-II boundaries were observed at the interface between Alloy 182 and A508 Gr. 3. Chemical composition shows rapid transition at the interface which makes 3000 µm of chromium dilution zone. Microstructure of A508 Gr. 3 was investigated from the interface between Alloy 182 to base metal.
Iida, Yuichiro; Fujiwara, Kazuki; Someya, Nobutaka; Shinohara, Makoto
2017-03-16
Rhizobium sp. strain TBD182, isolated from a novel hydroponics system, is an antagonistic bacterium that inhibits the mycelial growth of Fusarium oxysporum but does not eliminate the pathogen. We report the draft genome sequence of TBD182, which may contribute to elucidation of the molecular mechanisms of its fungistatic activity. Copyright © 2017 Iida et al.
Energy Technology Data Exchange (ETDEWEB)
Calonne, O.; Foucault, M.; Steltzlen, F. [AREVA (France); Amzallag, C. [EDF SEPTEN (France)
2011-07-01
Nickel-base alloys 182 and 82 have been used extensively for dissimilar metal welds. Typical applications are the J-groove welds of alloy 600 vessel head penetrations, pressurizer penetrations, heater sleeves and bottom mounted instrumented nozzles as well as some safe end butt welds. While the overall performance of these weld metals has been good, during the last decade, an increasing number of cases of stress corrosion cracking of Alloy 182 weld metal have been reported in PWRs. In this context, the role of weld defects has to be examined. Their contribution in the crack initiation mechanism requires laboratory investigations with small scale characterizations. In this study, the influence of both alloy composition and weld defects on PWSCC (Stress Corrosion Cracking in Primary Water) initiation was investigated using U-bend specimens in simulated primary water at 320 C. The main results are the following: -) the chemical compositions of the weld deposits leading to a large propensity to hot cracking are not the most susceptible to PWSCC initiation, -) macroscopically, superficial defects did not evolve during successive exposures. They can be included in large corrosion cracks but their role as 'precursors' is not yet established. (authors)
Measurement of $R_b$ in $e^+ e^-$ Collisions at 182 - 209 GeV
Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Asai, S.; Axen, D.; Bailey, I.; Barberio, E.; Barillari, T.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brown, Robert M.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, D.G.; Ciocca, C.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Fanfani, A.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Gagnon, P.; Gary, John William; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harel, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Horvath, D.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanzaki, J.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kramer, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, A.; Ludwig, J.; Mader, W.; Marcellini, S.; Martin, A.J.; Masetti, G.; Mashimo, T.; Mattig, Peter; McKenna, J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Meyer, Niels T.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schorner-Sadenius, T.; Schroder, Matthias; Schumacher, M.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija
2005-01-01
Measurements of Rb, the ratio of the bbbar cross-section to the qqbar cross- section in e+e- collisions, are presented. The data were collected by the OPAL experiment at LEP at centre-of-mass energies between 182 GeV and 209 GeV. Lepton, lifetime and event shape information is used to tag events containing b quarks with high efficiency. The data are compatible with the Standard Model expectation. The mean ratio of the eight measurements reported here to the Standard Model prediction is 1.055+-0.031+-0.037, where the first error is statistical and the second systematic.
2012-12-31
... special attention. Section 182 contains a special rule regarding actions of Canada affecting U.S. cultural... that affects cultural industries, is adopted or expanded after December 17, 1992, and is actionable... practices. Any comments that include quantitative loss claims should be accompanied by the methodology used...
International Nuclear Information System (INIS)
Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping
2016-01-01
Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.
The unusual high-spin isomer in 182Os and the proton-neutron interaction in high-j orbitals
International Nuclear Information System (INIS)
Tajima, Naoki; Onishi, Naoki
1986-01-01
An intermediate-coupling model of particle-plus-γ-soft-rotor is applied to a qualitative interpretation of the recently observed isomer of 182 Os and the characteristic decay pattern. In the model h 11/2 protons and i 13/2 neutrons are incorporated at the same time. The isomer is realized as the bandhead of a two-proton - two-neutron-aligned band from the present calculation. (orig.)
Application of the ultrasonic phased array technique to alloy 182 weld inspection in PWR
International Nuclear Information System (INIS)
Hsiao, Chu Chung; Shie, Namg Chian; Chu, Shyr Liang; Lee, Sou See; Toung, Jean Chung; Su, Liang Chun; Yang, Hai Ming
2006-01-01
Cracks were found in nickel-based welds frequently in some nuclear power plants. The development of inspection technique capability of finding these cracks is thus in great demand. The difficulties of inspection and evaluation for nickel-based welds include ultrasonic reflection of interface of dissimilar materials, ultrasonic distortion of anisotropic microstructure, and signal-to-noise ratio reduction of coarse grain. In this study, an Alloy 182 mock-up with the same size and material properties as in the field is designed and fabricated. The Alloy 182 mock-up specimen contains various cracks and notches for calibration. Phased array UT and other ultrasonic inspection techniques are used in this study. Based on the experiment results, the phased array probe with 2D dual crystals and low frequency (1.5MHz) longitudinal wave is found to perform well. Finally, phased array ultrasonic testing technique has been approved to be an effectively nondestructive test method for DMW with real size testing block involved. Typically, phased array probe can generate sharp tip diffraction signal and thus reliable and accurate result can be obtained for sizing the defect. Furthermore, phased array probe can also generate various angles and focal lengths and thus combinatorial effect can be achieved for several traditional probes. With a full understanding of the beam behavior and an optimized delay laws, the phased away ultrasonic technique integrated with an automatic scanner will achieve not only to save scanning time but also to reduce the amount of radiation exposure on field inspection.
Directory of Open Access Journals (Sweden)
Gil, F. X.
1995-08-01
Full Text Available Mechanical properties -tensile, compression and fatigue stresses- of poli-, bi- and single-crystals of Cu-18.2 Zn-7.0 Al have been studied. The relationship between mechanical behaviour and microstructure has been determined.
Se estudian las propiedades mecánicas de tracción, compresión y resistencia a la fatiga de monocristales, bicristales y policristales de la aleación Cu 18,2 % Zn-7,0 % Al. Se relaciona su comportamiento mecánico con la microestructura del material ensayado.
Evaluated 182,183,184,186W Neutron Cross Sections and Covariances in the Resolved Resonance Region
International Nuclear Information System (INIS)
Pigni, Marco T; Leal, Luiz C
2015-01-01
Oak Ridge National Laboratory (ORNL) has recently completed the resonance parameter evaluation of four tungsten isotopes, i.e., 182,183,184,186 W, in the neutron energy range of thermal up to several keV. This nuclear data work was performed with support from the US Nuclear Criticality Safety Program (NCSP) in an effort to provide improved tungsten cross section and covariance data for criticality safety analyses. The evaluation methodology uses the Reich-Moore approximation of the R-matrix formalism of the code SAMMY to fit high-resolution measurements performed in 2010 and 2012 at the Geel linear accelerator facility (GELINA), as well as other experimental data sets on natural tungsten available in the EXFOR library. In the analyzed energy range, this work nearly doubles the resolved resonance region (RRR) present in the latest US nuclear data library ENDF/B-VII.1. In view of the interest in tungsten for distinct types of nuclear applications and the relatively homogeneous distribution of the isotopic tungsten - namely, 182 W(26.5%), 183 W(14.31%), 184 W(30.64%), and 186 W(28.43%) - the completion of these four evaluations represents a significant contribution to the improvement of the ENDF library. This paper presents an overview of the evaluated resonance parameters and related covariances for total and capture cross sections on the four tungsten isotopes.
Energy Technology Data Exchange (ETDEWEB)
Aly, Omar F.; Mattar Neto, Miguel, E-mail: ofaly@ipen.br, E-mail: mmattar@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Schvartzman, Monica M.A.M., E-mail: monicas@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2013-07-01
Dissimilar welds (DW) are normally used in many components junctions in structural project of PWR (Pressurized Water Reactors) in Nuclear Plants. One had been departed of a DW of a nozzle located at a Reactor Pressure Vessel (RPV) of a PWR reactor, that joins the structural vessel material with an A316 stainless steel safe end. This weld is basically done with Alloy 182 with a weld buttering of Alloy 82. It had been prepared some axial cylindrical specimens retired from the Alloy 182/A316 weld end to be tested in the slow strain rate test machine located at CDTN laboratory. Based in these stress corrosion susceptibility results, it was done a preliminary semi-empirical modeling application to study the failure initiation time evolution of these specimens. The used model is composed by a deterministic part, and a probabilistic part according to the Weibull distribution. It had been constructed a specific Microsoft Excel worksheet to do the model application of input data. The obtained results had been discussed according with literature and also the model application limits. (author)
Total conversion coefficient of the 185 keV (10--7+) transition in sup(182m)Ta
International Nuclear Information System (INIS)
Suryanarayana, Ch.; Venkateswara Rao, N.; Raghavaiah, C.V.; Bhuloka Reddy, S.; Satyanarayana, G.; Sastry, D.L.
1988-01-01
The total conversion coefficient of the 185 keV (E3) isomeric transition in 182 Ta was measured for the first time using gamma intensity balance method. The experimental αsub(T) was obtained as 3.4 ± 0.2 consistent with the theoretical value (3.272) due to Rosel et al. The E3 transition probability was found to be hindered by a factor of 5.07x10 4 when compared to the single particle estimate. (author). 13 refs
International Nuclear Information System (INIS)
Wehbi, Mickael
2014-01-01
Nickel base welds are widely used to assemble components of the primary circuit of Pressurized Water Reactors (PWR) plants. International experience shows an increasing number of Stress Corrosion Cracks (SCC) in nickel base welds 182 and 82 which motivates the development of models predicting the time to SCC initiation for these materials. SCC involves several parameters such as materials, mechanics or environment interacting together. The goal of this study is to have a better understanding of the physical mechanisms occurring at grains boundaries involved in SCC. In-situ tensile test carried out on oxidized alloy 182 evidenced dispersion in the susceptibility to corrosion of grain boundaries. Moreover, the correlation between oxidation and cracking coupled with micro-mechanical simulations on synthetic polycrystalline aggregate, allowed to propose a cracking criterion of oxidized grain boundaries which is defined by both critical oxidation depth and local stress level. Due to the key role of intergranular oxidation in SCC and since significant dispersion is observed between grain boundaries, oxidation tests were performed on alloys 182 and 82 in order to model the intergranular oxidation kinetics as a function of chromium carbides precipitation, temperature and dissolved hydrogen content. The model allows statistical analyses and is embedded in a local initiation model. In this model, SCC initiation is defined by the cracking of the intergranular oxide and is followed by slow and fast crack growth until the crack depth reaches a given value. Simplifying assumptions were necessary to identify laws used in the SCC model. However, these laws will be useful to determine experimental conditions of future investigations carried out to improve the calibration used parameters. (author)
Moriwaki, M; Yamakawa, T; Washino, T; Kodama, T; Igarashi, Y
1999-01-01
The activity of phenylalanine ammonia-lyase (PAL; EC 4.3.1.5) after heat shock (HS) in leaves and buds of transgenic Nicotiana plumbaginifolia containing an Arabidopsis HSP18.2 promoter-parsley phenylalanine ammonia-lyase 2 (HSP18.2-PAL2) chimera gene was examined. Immediately after HS treatment at 44 degrees C for 5 h, the PAL activity in both transgenic and normal (untransformed) plants was 35-38% lower than that before HS. At normal temperature (25-26 degrees C), the PAL activity recovered within 5 h of ending the HS treatment in normal plants, but not until 12-24 h in transgenic plants containing the HSP18.2-PAL2 gene. Reverse transcription-polymerase chain reaction (RT-PCR) analysis revealed the presence of parsley PAL2 mRNA in transgenic plants, which remained for 8-12 h following 5-h HS at 44 degrees C; the mRNA was not observed before HS. The content of chlorogenic acid (CGA; 3-caffeoylquinic acid) decreased drastically 8-12 h after HS in transgenic plants, but only slightly in normal plants. Thus, the decrease in PAL activity accompanied by expression of the parsley PAL2 gene after HS treatment corresponded to the decrease in CGA synthesis. These results might be attributed to post-transcriptional degradation of endogenous PAL mRNA triggered by transcription of the transgene.
BWR alloy 182 stress Corrosion Cracking Experience
International Nuclear Information System (INIS)
Horn, R.M.; Hickling, J.
2002-01-01
Modern Boiling Water Reactors (BWR) have successfully operated for more than three decades. Over that time frame, different materials issues have continued to arise, leading to comprehensive efforts to understand the root cause while concurrently developing different mitigation strategies to address near-term, continued operation, as well as provide long-term paths to extended plant life. These activities have led to methods to inspect components to quantify the extent of degradation, appropriate methods of analysis to quantify structural margin, repair designs (or strategies to replace the component function) and improved materials for current and future application. The primary materials issue has been the occurrence of stress corrosion cracking (SCC). While this phenomenon has been primarily associated with austenitic stainless steel, it has also been found in nickel-base weldments used to join piping and reactor internal components to the reactor pressure vessel consistent with fabrication practices throughout the nuclear industry. The objective of this paper is to focus on the history and learning gained regarding Alloy 182 weld metal. The paper will discuss the chronology of weld metal cracking in piping components as well as in reactor internal components. The BWR industry has pro-actively developed inspection processes and procedures that have been successfully used to interrogate different locations for the existence of cracking. The recognition of the potential for cracking has also led to extensive studies to understand cracking behavior. Among other things, work has been performed to characterize crack growth rates in both oxygenated and hydrogenated environments. The latter may also be relevant to PWR systems. These data, along with the understanding of stress corrosion cracking processes, have led to extensive implementation of appropriate mitigation measures. (authors)
Jordy, Ceme Ferreira
1995-01-01
182 crianças normais de 6 a 14 anos de idade foram neurologicamente examinadas. Os resultados relacionados à dominância lateral revelaram 156 (85,71%) destros, 8 (4,39%) canhotos e 18 (9,89%) com dominância indeterminada. O conceito de ambidestrismo fundamentado na equivalência de competência motora entre os antímeros foi rejeitado. A análise dos resultados leva a fundamentar na interação 'indivíduo-universo', a formação da dominância lateral. Considera-se nesta interação a aquisição de praxi...
182Hf: a new stopwatch for the early solar system
International Nuclear Information System (INIS)
Norman, E.B.; Schramm, D.N.
1983-01-01
It is now well established that live 26 Al (t/sub 1/2/ = 7.2 x 10 5 yr) and 107 Pd (t/sub 1/2/ = 6.5 x 10 6 yr) were present in the early solar system. Thus, the nucleosynthetic vent (supernova) responsible for the production of these nuclei must have occurred no more than a few million years prior to the formation of solid bodies. It is possible that this event also produced the 129 I known to be present in the early solar system. However, the last event to contribute 244 Pu to the solar system occurred approx. 10 8 yr prior to the time of solidification. This latter time scale is also consistent with the lack of evidence for a 247 Cm chronometer. In this letter, we propose that 182 Hf (t/sub 1/2/ = 9 x 10 6 yr) can resolve the question of whether heavy-element non-actinide nucleosynthesis occurred during the 26 Al-producing event. The answer to this question will help to clarify the chronology of the formation of the solar system and will help to determine the astrophysical sites of heavy-element nucleosynthesis
Recent Updates to the MELCOR 1.8.2 Code for ITER Applications
Energy Technology Data Exchange (ETDEWEB)
Merrill, Brad J
2007-05-01
This report documents recent changes made to the MELCOR 1.8.2 computer code for application to the International Thermonuclear Experimental Reactor (ITER), as required by ITER Task Agreement ITA 81-18. There are four areas of change documented by this report. The first area is the addition to this code of a model for transporting HTO. The second area is the updating of the material oxidation correlations to match those specified in the ITER Safety Analysis Data List (SADL). The third area replaces a modification to an aerosol tranpsort subroutine that specified the nominal aerosol density internally with one that now allows the user to specify this density through user input. The fourth area corrected an error that existed in an air condensation subroutine of previous versions of this modified MELCOR code. The appendices of this report contain FORTRAN listings of the coding for these modifications.
Recent Updates to the MELCOR 1.8.2 Code for ITER Applications
Energy Technology Data Exchange (ETDEWEB)
Merrill, Brad J
2007-04-01
This report documents recent changes made to the MELCOR 1.8.2 computer code for application to the International Thermonuclear Experimental Reactor (ITER), as required by ITER Task Agreement ITA 81-18. There are four areas of change documented by this report. The first area is the addition to this code of a model for transporting HTO. The second area is the updating of the material oxidation correlations to match those specified in the ITER Safety Analysis Data List (SADL). The third area replaces a modification to an aerosol tranpsort subroutine that specified the nominal aerosol density internally with one that now allows the user to specify this density through user input. The fourth area corrected an error that existed in an air condensation subroutine of previous versions of this modified MELCOR code. The appendices of this report contain FORTRAN listings of the coding for these modifications.
Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer
International Nuclear Information System (INIS)
Lima, Clarice Maria de
2011-01-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1993-01-01
The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)
Fission fragment mass distribution in the 13C+182W and 176Yb reactions
International Nuclear Information System (INIS)
Ramachandran, K.; Hinde, D.J.; Dasgupta, M.; Williams, E.; Wakhle, A.; Luong, D.H.; Evers, M.; Carter, I.P.; Das, S.
2014-01-01
Fission fragment mass distributions have been measured for many systems and found to be asymmetric in the fission of nuclei with nucleon number A in the range 228-258 and proton number Z in the range 90-100. For lighter systems, it has been observed that fission fragment mass distributions are usually symmetric. At high excitation energies the shell effects are expected to vanish and the nuclei are expected to behave like a charged liquid drop; hence, only symmetric fission is expected for all the nuclei. Even after much experimental and theoretical work in this field, the rate of damping of shell effects with excitation energy is not well known. This abstract reports our measurements with 13 C beams on 182 W and 176 Yb targets
An extinction-survival-type phase transition in the probabilistic cellular automaton p182-q200
International Nuclear Information System (INIS)
Mendonca, J R G; Oliveira, M J de
2011-01-01
We investigate the critical behaviour of a probabilistic mixture of cellular automata (CA) rules 182 and 200 (in Wolfram's enumeration scheme) by mean-field analysis and Monte Carlo simulations. We found that as we switch off one CA and switch on the other by the variation of the single parameter of the model, the probabilistic CA (PCA) goes through an extinction-survival-type phase transition, and the numerical data indicate that it belongs to the directed percolation universality class of critical behaviour. The PCA displays a characteristic stationary density profile and a slow, diffusive dynamics close to the pure CA 200 point that we discuss briefly. Remarks on an interesting related stochastic lattice gas are addressed in the conclusions.
International Nuclear Information System (INIS)
Lima, Luciana Iglesias Lourenco; Bracarense, Alexandre Queiroz; Schvartzman, Monica Maria de Abreu Mendonca; Quinan, Marco Antonio Dutra
2010-01-01
Stress corrosion crack (SCC) in a primary circuit of a nuclear pressurized water reactor consists of a degradation process in which aggressive media, stress and material susceptibility are present. Over the last thirty years, SCC has been observed in dissimilar metal welds. This study presents a comparative work between the SCC in the alloy 182 filler metal weld in two different hydrogen concentrations (25 e 50 cm 3 H 2 /kg H 2 O) in primary water. The susceptibility to stress corrosion cracking was assessed using the slow strain rate tensile (SSRT) test. The results of the SSRT test indicated that the material is more susceptible to SCC at 25 cm 3 H 2 /kg H 2 O. (author)
Radiation cooling and gain calculation for C VI 182 A line in C/Se plasma
International Nuclear Information System (INIS)
Nam, C.H.; Valeo, E.; Suckewer, S.; Feldman, U.
1986-04-01
A model is developed which is capable of describing the evolution of gain resulting from both rapid radiative and expansion cooling of a recombining, freely expanding plasma. It is demonstrated for the particular case of a carbon/selenium plasma that the cooling rate which leads to optimal gain can be achieved by adjusting the admixture of an efficiently radiating material (selenium) in the gain medium (carbon). Comparison is made to a recent observation of gain in a recent NRL/Rochester experiment with carbon/selenium plasma for the n = 3 → 2 transition in C VI occurring at 182 A. The predicted maximum gain is approx.10 cm -1 , as compared to observation of 2 to 3 cm -1
International Nuclear Information System (INIS)
DiSabatino, A.
1998-01-01
The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 18.2 metric tons (nominal) of plutonium as a ceramic in an existing facility, the Fuels and Materials Examination Facility (FMEF), at Hanford
(Vapour+liquid) equilibria of {xCH3Cl+(1-x)HCl} at temperatures (159.01 and 182.33) K
International Nuclear Information System (INIS)
Senra, A.M.P.; Fonseca, I.M.A.; Lobo, L.Q.
2005-01-01
VLE for (CH 3 Cl+HCl) has been experimentally determined at temperatures (159.01 and 182.33) K, using a static; method. The data were used to calculate the molar excess Gibbs energy at the two temperatures. The excess molar enthalpy estimated from the G m E values for the equimolar mixture is relatively large and negative: H m E =-(1011+/-318) J.mol -1 . The results have been compared with estimates from the chemical theory of solutions
Pinto, Patricia; Singh, Pratap B.; Condeça, João B.; Teodósio, H. R.; Power, Deborah; Canario, Adelino V. M.
2006-01-01
Abstract Background ICI 182,780 (ICI) belongs to a new class of antiestrogens developed to be pure estrogen antagonists and, in addition to its therapeutic use, it has been used to knock-out estrogen and estrogen receptor (ER) actions in several mammalian species. In the present study, the effects and mechanism of action of ICI were investigated in the teleost fish, sea bream (Sparus auratus). Methods Three independent in vivo experiments were performed in which mature male tilapia (Oreochrom...
182W and HSE constraints from 2.7 Ga komatiites on the heterogeneous nature of the Archean mantle
Puchtel, Igor S.; Blichert-Toft, Janne; Touboul, Mathieu; Walker, Richard J.
2018-05-01
While the isotopically heterogeneous nature of the terrestrial mantle has long been established, the origin, scale, and longevity of the heterogeneities for different elements and isotopic systems are still debated. Here, we report Nd, Hf, W, and Os isotopic and highly siderophile element (HSE) abundance data for the Boston Creek komatiitic basalt lava flow (BCF) in the 2.7 Ga Abitibi greenstone belt, Canada. This lava flow is characterized by strong depletions in Al and heavy rare earth elements (REE), enrichments in light REE, and initial ε143Nd = +2.5 ± 0.2 and intial ε176Hf = +4.2 ± 0.9 indicative of derivation from a deep mantle source with time-integrated suprachondritic Sm/Nd and Lu/Hf ratios. The data plot on the terrestrial Nd-Hf array suggesting minimal involvement of early magma ocean processes in the fractionation of lithophile trace elements in the mantle source. This conclusion is supported by a mean μ142Nd = -3.8 ± 2.8 that is unresolvable from terrestrial standards. By contrast, the BCF exhibits a positive 182W anomaly (μ182W = +11.7 ± 4.5), yet is characterized by chondritic initial γ187Os = +0.1 ± 0.3 and low inferred source HSE abundances (35 ± 5% of those estimated for the present-day Bulk Silicate Earth, BSE). Collectively, these characteristics are unique among Archean komatiite systems studied so far. The deficit in the HSE, coupled with the chondritic Os isotopic composition, but a positive 182W anomaly, are best explained by derivation of the parental BCF magma from a mantle domain characterized by a predominance of HSE-deficient, differentiated late accreted material. According to the model presented here, the mantle domain that gave rise to the BCF received only ∼35% of the present-day HSE complement in the BSE before becoming isolated from the rest of the convecting mantle until the time of komatiite emplacement at 2.72 Ga. These new data provide strong evidence for a highly heterogeneous Archean mantle in terms of absolute
An extinction-survival-type phase transition in the probabilistic cellular automaton p182-q200
Energy Technology Data Exchange (ETDEWEB)
Mendonca, J R G; Oliveira, M J de, E-mail: jricardo@usp.br, E-mail: oliveira@if.usp.br [Instituto de Fisica, Universidade de Sao Paulo, Rua do Matao, Travessa R 187, Cidade Universitaria 05508-090, Sao Paulo (Brazil)
2011-04-15
We investigate the critical behaviour of a probabilistic mixture of cellular automata (CA) rules 182 and 200 (in Wolfram's enumeration scheme) by mean-field analysis and Monte Carlo simulations. We found that as we switch off one CA and switch on the other by the variation of the single parameter of the model, the probabilistic CA (PCA) goes through an extinction-survival-type phase transition, and the numerical data indicate that it belongs to the directed percolation universality class of critical behaviour. The PCA displays a characteristic stationary density profile and a slow, diffusive dynamics close to the pure CA 200 point that we discuss briefly. Remarks on an interesting related stochastic lattice gas are addressed in the conclusions.
Shape effects in the vicinity of the Z=82 line: study of the $\\beta$-decay of $^{182,184,186}$Hg
This proposal is aimed at the study of the $\\beta$-decay of the neutron-deficient $^{182,184,186}$Hg nuclei using the total absorption technique. Recent theoretical results show that, from measurements of the Gamow-Teller strength distribution, the shapes of the ground states of the decaying Hg nuclei can be inferred. This study offers an independent way to study the phenomenon of shape coexistence in a region of particular interest.
MELCOR 1.8.2 Assessment: IET direct containment heating tests
Energy Technology Data Exchange (ETDEWEB)
Kmetyk, L.N.
1993-10-01
MELCOR is a fully integrated, engineering-level computer code, being developed at Sandia National Laboratories for the USNRC, that models the entire spectrum of severe accident phenomena in a unified framework for both BWRs and PWRS. As part of an ongoing assessment program, the MELCOR computer code has been used to analyze several of the IET direct containment heating experiments done at 1:10 linear scale in the Surtsey test facility at Sandia and at 1:40 linear scale in the corium-water thermal interactions (CWTI) COREXIT test facility at Argonne National Laboratory. These MELCOR calculations were done as an open post-test study, with both the experimental data and CONTAIN results available to guide the selection of code input. Basecase MELCOR results are compared to test data in order to evaluate the new HPME DCH model recently added in MELCOR version 1.8.2. The effect of various user-input parameters in the HPME model, which define both the initial debris source and the subsequent debris interaction, were investigated in sensitivity studies. In addition, several other non-default input modelling changes involving other MELCOR code packages were required in our IET assessment analyses in order to reproduce the observed experiment behavior. Several calculations were done to identify whether any numeric effects exist in our DCH IET assessment analyses.
2016-07-01
The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium
In-Beam Studies of High Spin States in Mercury -182 and MERCURY-184
Bindra, Kanwarjit Singh
The high spin states in ^{182 }Hg were studied by using the reaction ^{154}Gd(^{32}S, 4n) at the Holifield Heavy Ion Research Facility. In addition, the in-beam gamma-rays in ^{183}Hg were identified for the first time using the reaction ^{155}Gd(^{32}S, 4n) at the Argonne BGO-FMA facility. Five new bands were observed for the first time in ^{182}Hg by studying the gamma-gamma coincidence relationships. The spins and parities of the nuclear levels were assigned on the basis of the measured ratios of directional correlations for oriented nuclei (DCO ratios). Shape co-existence similar to that observed in ^{184{-}186}Hg was established. The well deformed prolate band was extended to a state with tentative spin (20^+). The 2^+ state of the prolate band was identified at an energy of 548.6 keV which is higher in energy than in ^{184}Hg. A two parameter band mixing calculation yielded an interaction strength of 87 keV between the prolate 2^+ and the oblate 2^+ states. Four of the five new bands were found to be similar in behavior to ones seen in ^{184}Hg. An attempt was made to study the behavior of some of these bands at high spins by analyzing their kinematic and dynamic moments of inertia. The gamma-ray transitions in ^{183}Hg were identified from fragment-gamma and gamma-gamma coincidence measurements. A total of five bands of levels were identified and the spins and parities of the levels were assigned by comparing the level scheme of ^{138 }Hg obtained with that of ^ {185}Hg established previously. The interpretation of these bands in terms of associated quasi-particle configurations also relies on noted similarities with the structure of ^{185}Hg. Shape co-existence was established in ^{183}Hg as a result of this study. Two of the bands associated with the (624) 9/2^+ orbital were found to exhibit signature splitting, as expected for i _{13/2} excitations built on the prolate shape with moderate deformation. Two other bands which do not show signature splitting
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli
2009-01-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the
Human GW182 Paralogs Are the Central Organizers for RNA-Mediated Control of Transcription.
Hicks, Jessica A; Li, Liande; Matsui, Masayuki; Chu, Yongjun; Volkov, Oleg; Johnson, Krystal C; Corey, David R
2017-08-15
In the cytoplasm, small RNAs can control mammalian translation by regulating the stability of mRNA. In the nucleus, small RNAs can also control transcription and splicing. The mechanisms for RNA-mediated nuclear regulation are not understood and remain controversial, hindering the effective application of nuclear RNAi and investigation of its natural regulatory roles. Here, we reveal that the human GW182 paralogs TNRC6A/B/C are central organizing factors critical to RNA-mediated transcriptional activation. Mass spectrometry of purified nuclear lysates followed by experimental validation demonstrates that TNRC6A interacts with proteins involved in protein degradation, RNAi, the CCR4-NOT complex, the mediator complex, and histone-modifying complexes. Functional analysis implicates TNRC6A, NAT10, MED14, and WDR5 in RNA-mediated transcriptional activation. These findings describe protein complexes capable of bridging RNA-mediated sequence-specific recognition of noncoding RNA transcripts with the regulation of gene transcription. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.
Coulomb excitation of $^{182-184}$ Hg: Shape coexistence in the neutron-deficient lead region
We put forward a study of the interplay between individual nucleon behavior and collective degrees of freedom in the nucleus, as manifested in shape coexistence in the neutron-deficient lead region. As a first step of this experimental campaign, we propose to perform Coulomb excitation on light mercury isotopes to probe their excited states and determine transitional and diagonal E2 matrix elements, especially reducing the current uncertainties. The results from previous Coulomb excitation measurements in this mass region performed with 2.85 MeV/u beams from REX-ISOLDE have shown the feasibility of these experiments. Based on our past experience and the results obtained, we propose a detailed study of the $^{182-184}$Hg nuclei, that exhibit a pronounced mixing between 2 low-lying excited states of apparently different deformation character, using the higher energy beams from HIE-ISOLDE which are crucial to reach our goal. The higher beam energy should result in an increased sensitivity with respect to the qua...
Results of the radiological survey at 14 Orford Street, Colonie, New York (AL182)
International Nuclear Information System (INIS)
Espegren, M.L.; Marley, J.L.; Carrier, R.F.
1988-02-01
A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. Radiological surveys were performed at 27 properties by members of the Radiological Survey Activities (RASA) group at Oak Ridge National Laboratory (ORNL) during the period July 13--July 26, 1986. The property at 14 Orford Street in Colonie, New York (AL182) was the subject of a radiological investigation initiated July 23, 1986. The residential property consists of a two-story frame house located on a rectangular lot. An asphalt driveway connects the house to the street. A diagram of the property showing the approximate boundaries and the 5-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/15 m wide by 34 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Vaillant, F.; Moulart, P.; Boursier, J.M. [Electricite de France (EDF), 75 - Paris (France). Region d' Equipement; Amzallag, C. [Electricite de France (EDF), DIS/SEPTEN, 75 - Paris (France); Daret, J. [CEA Saclay, Dept. de Physico-Chimie DPC/SCCME, 91 - Gif sur Yvette (France)
2002-07-01
Since 1991, when a first leakage occurred on the vessel head of Bugey 3 RPV, an important investigation program was undertaken in laboratory in order to assess crack growth rates (CGRs) of vessel head penetrations (VHPs) in alloy 600 and weld metal in alloy 182 in primary environments. SCC (stress corrosion cracking) tests were performed between 290 C and 360 C on pre-cracked specimens under static loading. Alloy 600: On VHPs with YS{sub 20} ranging from 300 MPa to 468 MPa, it was found that the upper bound for CGRs were dependant on (K(T initial)-K(iscc)){sup 0.3}, in accordance with field experience. In laboratory condition, the activation energy was 130 {+-} 20 kJ/mol, the yield stress increased significantly CGRs but some coupling effects were noted with the microstructure. Cold work increased slightly CGRs on a VHP with initial YS = 468 MPa. Additional tests were performed at 290 C and 325 C on rolled bars, rolled plates and forged plates representative of the other components in alloy 600 of the primary circuit: products with low YS and high GBC had low sensitivity to SCC but it could be significantly increased with cold work raising at the level of 468 MPa, the highest YS investigated on VHPs. Stress relief treatment did not significantly modify SCC resistance. On ten products from the various components, the measured CGRs were strongly correlated to the material susceptibility index for SCC initiation. Alloy 182: Some comparisons were performed in laboratory, with different orientations. Similar trends to alloy 600 were found for the influences of K and temperature on CGRs. 10% cold work increased and stress relief treatment decreased CGRs by a factor 2. CGRs of cracks propagating in the direction of dendrites were 2 to 5 times higher than for cracks propagating in the perpendicular direction. For both alloys 600 and 182, a model is proposed to account for the effects of the main parameters on CGRs and the relevance to field experience is discussed
International Nuclear Information System (INIS)
Vaillant, F.; Moulart, P.; Boursier, J.M.; Daret, J.
2002-01-01
Since 1991, when a first leakage occurred on the vessel head of Bugey 3 RPV, an important investigation program was undertaken in laboratory in order to assess crack growth rates (CGRs) of vessel head penetrations (VHPs) in alloy 600 and weld metal in alloy 182 in primary environments. SCC (stress corrosion cracking) tests were performed between 290 C and 360 C on pre-cracked specimens under static loading. Alloy 600: On VHPs with YS 20 ranging from 300 MPa to 468 MPa, it was found that the upper bound for CGRs were dependant on (K(T initial)-K(iscc)) 0.3 , in accordance with field experience. In laboratory condition, the activation energy was 130 ± 20 kJ/mol, the yield stress increased significantly CGRs but some coupling effects were noted with the microstructure. Cold work increased slightly CGRs on a VHP with initial YS = 468 MPa. Additional tests were performed at 290 C and 325 C on rolled bars, rolled plates and forged plates representative of the other components in alloy 600 of the primary circuit: products with low YS and high GBC had low sensitivity to SCC but it could be significantly increased with cold work raising at the level of 468 MPa, the highest YS investigated on VHPs. Stress relief treatment did not significantly modify SCC resistance. On ten products from the various components, the measured CGRs were strongly correlated to the material susceptibility index for SCC initiation. Alloy 182: Some comparisons were performed in laboratory, with different orientations. Similar trends to alloy 600 were found for the influences of K and temperature on CGRs. 10% cold work increased and stress relief treatment decreased CGRs by a factor 2. CGRs of cracks propagating in the direction of dendrites were 2 to 5 times higher than for cracks propagating in the perpendicular direction. For both alloys 600 and 182, a model is proposed to account for the effects of the main parameters on CGRs and the relevance to field experience is discussed. (authors)
EDF field experience of 182 J-Groove welds on CRDMs and SG channel head nozzles
International Nuclear Information System (INIS)
Duisabeau, L.; Deforge, D.; Thebault, Y.; Stindel, M.; Lemaire, E.
2011-01-01
The Reactor Pressure Vessel Head (RPVH) replacement program, which began after a leak occurrence in a vessel head nozzle in Alloy 600 at Bugey Unit 3, was a unique opportunity to perform an extended inspection program on the welds from the decommissioned RPV heads. This paper presents the actual results of this program. More than 800 CRDM J groove welds from 18 decommissioned RPV heads were inspected by automatic dye penetrant testing. Detected indications were characterized by viewing tools specifically developed and in some specific cases, by destructive investigations in hot lab. Some welding defects were observed but no indication corresponding to stress corrosion cracking (SCC) was detected at the welds wet surface nor propagation from welding manufacturing defects, including the weld with the longest operating time on EDF power plants (170 000 h). Very few cases of SCC propagation from Alloy 600 to Alloy 182 are reported. One case of initiation at the weld root pass was observed. From design, the weld root pass (mechanically loaded) of CRDM (Control Rod Drive Mechanism) nozzles is not in contact with primary water and the cracking observed occurred after a through wall cracking of the Alloy 600 tube, enabling primary water to wet the root pass. Concerning the steam generator (SG) drain nozzle, the alloy 182 weld root is directly in contact with primary water. In June 2008, a primary water leakage was suspected on a steam generator bowl drain while conducting a bare metal visual examination during the plant's outage. Dye penetrant testing of the weld and metallographic replica were implemented during the 2008 and 2009 refuelling outages to confirm a leakage by SCC. Manufacturing reports analyses revealed that the drain nozzle weld was repaired and had not been stress relieved during manufacturing. EDF has decided to plug this nozzle and to enforce the maintenance policy for similar components with the same manufacturing specificity. Regarding national and
International Nuclear Information System (INIS)
Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.
1997-01-01
A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs
Directory of Open Access Journals (Sweden)
Ceme Ferreira Jordy
1995-09-01
Full Text Available 182 crianças normais de 6 a 14 anos de idade foram neurologicamente examinadas. Os resultados relacionados à dominância lateral revelaram 156 (85,71% destros, 8 (4,39% canhotos e 18 (9,89% com dominância indeterminada. O conceito de ambidestrismo fundamentado na equivalência de competência motora entre os antímeros foi rejeitado. A análise dos resultados leva a fundamentar na interação 'indivíduo-universo', a formação da dominância lateral. Considera-se nesta interação a aquisição de praxias e a criação de estruturas neuronais dinâmicas, em relação e concomitância com o surgimento e o desenvolvimento da ação motora.182 normal children from 6 to 14 years old presenting learning difficulties were neurologically examined. A 149 items questionaire covering the intrauterine, peri and post partum life were answered by parents and afterwards detailed in interview consultation. Special procedures on motor skill were added to the usual neurological examination, to text motor performance differences between antimeres. Dextrallity appeared in 156 cases (85.71%, sinistrality in 8 (4.39% and in 18 cases (9.89% the lateral dominance could not be determined. The concept of ambidextrallity was rejected for the bilateral equivalence in motor competence was not found in the subjects. The results lead to interpret the lateral dominance as a proportional distribution of motor performances in the right and left halves of the body in a process of constant improvement of motor skills which takes place in and belongs to the development of interdependence between the individuals and their environment. It is by way of such interrelationships that the significant motor activity (praxias is acquired. Lateral dominance is considered a dynamic mechanism resulting from this interactive process which aim is directed together with other mechanisms to provide and improve the human being survival.
Method of isolation of traces of americium by using the +6 oxidation state properties
International Nuclear Information System (INIS)
Kwinta, Jean; Michel, Jean-Jacques
1969-05-01
The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr
Jordy, C F
1995-09-01
182 normal children from 6 to 14 years old presenting learning difficulties were neurologically examined. A 149 items questionnaire covering the intrauterine, peri and post partum life were answered by parents and afterwards detailed in interview consultation. Special procedures on motor skill were added to the usual neurological examination, to text motor performance differences between antimeros. Dextrallity appeared in 156 cases (85.71%), sinistrallity in 8 (4.39%) and in 18 cases (9.89%) the lateral dominance could not be determined. The concept of ambidextrallity was rejected for the bilateral equivalence in motor competence was not found in the subjects. The results lead to interpret the lateral dominance as a proportional distribution of motor performances in the right and left halves of the body in a process of constant improvement of motor skills which takes place in and belongs to the development of interdependence between the individuals and their environment. It is by way of such interrelationships that the significant motor activity (praxias) is acquired. Lateral dominance is considered a dynamic mechanism resulting from this interactive process which aim is directed together with other mechanisms to provide and improve the human being survival.
International Nuclear Information System (INIS)
Lee, Tae Hyun; Hwang, Il Soon; Kim, Hong Deok; Kim, Ji Hyun
2015-01-01
A technique developed to produce artificial intergranular stress corrosion cracks in structural components was applied to thick, forged alloy 600 base and alloy 182 weld metals for use in the qualification of nondestructive examination techniques for welded components in nuclear power plants. An externally controlled procedure was demonstrated to produce intergranular stress corrosion cracks that are comparable to service-induced cracks in both the base and weld metals. During the process of crack generation, an online direct current potential drop method using array probes was used to measure and monitor the sizes and shapes of the cracks. A microstructural characterization of the produced cracks revealed realistic conformation of the crack faces unlike those in machined notches produced by an electrodischarge machine or simple fatigue loading using a universal testing machine. A comparison with a destructive metallographic examination showed that the characteristics, orientations, and sizes of the intergranular cracks produced in this study are highly reproducible.
Simple synthesis of multi-halogen pyrazino [1,2-a]indole-1,8(2H,5aH)-dione
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui Xia; Zhao, Yu Cheng; Kong, Ling Bin; Yan, Sheng Jiao; Lin, Jun [Key Laboratory of Medicinal Chemistry for Natural Resource (Yunnan University), Ministry Education, School of Chemical Science and Technology, Yunnan University, Kunming (China)
2016-10-15
A concise and efficient one-pot synthesis of multi-halogen pyrazino[1,2-a]indole-1,8(2H,5aH)-dione (MHPID) derivatives by the reaction of an enamino ester with multi-halogen benzoquinone derivatives is described. MHPIDs 3a–3d were obtained with good yields (78–83%) by refluxing enamino esters 1a and 1b and tetrahalogen-1,4-benzoquinones 2a and 2b for 24 h without the use of catalysts. Compounds 3e–3p were also obtained with excellent yields (69–92%) via the reaction of the phenyl-substituted enamino esters 1c–1h with tetrahalogen-1,4-benzoquinones 2a and 2b in CH3CN catalyzed by Cs2CO3. These two protocols are efficient and effective for the synthesis of MHPIDs.
Crack growth rate in the HAZ of alloy 600/182
Energy Technology Data Exchange (ETDEWEB)
Gomez-Briceno, D.; Lapena, J.; Garcia-Redondo, M.; Castro, L.; Perosanz, F.J. [CIEMAT (Spain); Ahluwalia, K. [EPRI, (United States); Hickling, J. [EPRI Consultant (Cyprus)
2011-07-01
CGR (Crack Growth Rate) experiments to obtain data for the HAZ (Heat Affected Zone) of nickel base alloys using fracture mechanics specimens are a challenge, primarily due to the difficulties of positioning the tip of the notch (or pre-crack) in the desired location within the complex region adjacent to the fusion line. This paper presents some results obtained in an experimental program carried out to the CGR in the HAZ of several welded Alloy 600 plates. Compact tension (CT) specimens have been tested in simulated PWR primary water at temperatures of 340 and 360 C degrees under cyclic and constant loading (both with and without periodic partial unloading). Satisfactory CGR data were obtained for the HAZ in an Alloy 600 plate (mill annealed at high temperature) welded with Alloy 182 under both environmentally assisted fatigue test conditions (cyclic loading at different frequencies) and during stress corrosion testing (i.e. at predominantly constant load). The CGR values were generally similar to those obtained for the corresponding base metal (with tentative evidence for slightly faster growth in the HAZ under pure constant load). The HAZ specimens showed a higher tendency to crack inter-granularly under cyclic loading. CGR values under predominantly SCC conditions corresponded well (after temperature correction) with the MRP - 55 75. percentile disposition curve for PWSCC in Alloy 600 materials. This contrasts with the behavior observed by other investigators, where the HAZ material was found to exhibit markedly higher CGRs. A possible explanation for this discrepancy is the higher PWSCC susceptibility of the Alloy 600 base metal used to prepare the HAZ specimens in this program. It appears that the strong increase in the HAZ CGR observed elsewhere may take place if the base metal is a heat with inherently low PWSCC susceptibility (i.e. with good microstructure, adequate carbide distribution, etc.). However, if the Alloy 600 base metal already has a susceptible
Crack growth rate in the HAZ of alloy 600/182
International Nuclear Information System (INIS)
Gomez-Briceno, D.; Lapena, J.; Garcia-Redondo, M.; Castro, L.; Perosanz, F.J.; Ahluwalia, K.; Hickling, J.
2011-01-01
CGR (Crack Growth Rate) experiments to obtain data for the HAZ (Heat Affected Zone) of nickel base alloys using fracture mechanics specimens are a challenge, primarily due to the difficulties of positioning the tip of the notch (or pre-crack) in the desired location within the complex region adjacent to the fusion line. This paper presents some results obtained in an experimental program carried out to the CGR in the HAZ of several welded Alloy 600 plates. Compact tension (CT) specimens have been tested in simulated PWR primary water at temperatures of 340 and 360 C degrees under cyclic and constant loading (both with and without periodic partial unloading). Satisfactory CGR data were obtained for the HAZ in an Alloy 600 plate (mill annealed at high temperature) welded with Alloy 182 under both environmentally assisted fatigue test conditions (cyclic loading at different frequencies) and during stress corrosion testing (i.e. at predominantly constant load). The CGR values were generally similar to those obtained for the corresponding base metal (with tentative evidence for slightly faster growth in the HAZ under pure constant load). The HAZ specimens showed a higher tendency to crack inter-granularly under cyclic loading. CGR values under predominantly SCC conditions corresponded well (after temperature correction) with the MRP - 55 75. percentile disposition curve for PWSCC in Alloy 600 materials. This contrasts with the behavior observed by other investigators, where the HAZ material was found to exhibit markedly higher CGRs. A possible explanation for this discrepancy is the higher PWSCC susceptibility of the Alloy 600 base metal used to prepare the HAZ specimens in this program. It appears that the strong increase in the HAZ CGR observed elsewhere may take place if the base metal is a heat with inherently low PWSCC susceptibility (i.e. with good microstructure, adequate carbide distribution, etc.). However, if the Alloy 600 base metal already has a susceptible
International Nuclear Information System (INIS)
DiSabatino, A.
1998-01-01
The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 18.2 metric tons (nominal) of plutonium as a ceramic in an existing facility at Hanford, the Fuels and Materials Examination Facility (FMEF). The MOX Fuel Fabrication Facility (MFFF), which is being costed in a separate report, will also be located in the FMEF in this co-location option
International Nuclear Information System (INIS)
Lopez G, H.D.
2005-01-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
International Nuclear Information System (INIS)
DiSabatino, A.
1998-01-01
The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 18.2 metric tons (nominal) of plutonium using ceramic in a new facility at Savannah River Site (SRS)
Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006
International Nuclear Information System (INIS)
DiSabatino, A.
1998-01-01
The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 18.2 metric tons (nominal) of plutonium using ceramic in an existing facility (221-F) at Savannah River Site (SRS)
Bi, Lei
2013-10-07
Ba3Ca1.18Nb1.82O9-δ (BCN18), regarded as a promising proton-conducting electrolyte material for solid oxide fuel cells, is usually synthesized by a solid-state reaction because of the limited choice of Nb precursors. This study presents a wet chemical route for preparing BCN18 powders that were then sintered into pellets. Electrochemical impedance spectroscopy studies indicated that BCN18 pellets show proton conductivity, since their total conductivity in wet air was significantly larger than that in dry air. However, a detailed analysis showed that only the BCN18 bulk behaves as a proton conductor, while its grain boundary conductivity did not increase in wet air.
International Nuclear Information System (INIS)
Friedland, R.P.; Budinger, T.F.; Prusiner, S.B.; Jagust, W.J.
1984-01-01
It is well established that Creutzfeldt-Jakob Disease (CJD) is caused by a slow infectious agent similar to the scrapie prion. However, the pathogenesis of this infection is poorly understood. Positron emission tomography (PET) was performed on a 54 year old male subject with autopsy confirmed CJD using (F-18)2-fluorodeoxyglucose (FDG) and the Donner 280-crystal tomograph. An x-ray computed tomographic study of the brain performed 4 days prior to PET was normal. In the PET study the frontal to temporal cortex difference of activity densities was 30% on the left and 12% on the right, reflecting temporal hypometabolism. The left-right temporal cortex difference of activity density was 25%, documenting marked hemispheric asymmetry. These findings are similar to those previously obtained in PET-FDG studies of patients with clinically defined Alzheimer's Disease (AD) and are distinctly different from PET-FDG finding in patients with other dementing illnesses or in healthy aged subjects. Recent work has demonstrated extensive biological similarities between CJD, scrapie and AD. The similarities in the regional metabolic alterations between CJD and AD provide additional evidence for the hypothesis that AD is caused by a slow infectious (prion-like) pathogen
Energy Technology Data Exchange (ETDEWEB)
Friedland, R.P.; Budinger, T.F.; Prusiner, S.B.; Jagust, W.J.
1984-01-01
It is well established that Creutzfeldt-Jakob Disease (CJD) is caused by a slow infectious agent similar to the scrapie prion. However, the pathogenesis of this infection is poorly understood. Positron emission tomography (PET) was performed on a 54 year old male subject with autopsy confirmed CJD using (F-18)2-fluorodeoxyglucose (FDG) and the Donner 280-crystal tomograph. An x-ray computed tomographic study of the brain performed 4 days prior to PET was normal. In the PET study the frontal to temporal cortex difference of activity densities was 30% on the left and 12% on the right, reflecting temporal hypometabolism. The left-right temporal cortex difference of activity density was 25%, documenting marked hemispheric asymmetry. These findings are similar to those previously obtained in PET-FDG studies of patients with clinically defined Alzheimer's Disease (AD) and are distinctly different from PET-FDG finding in patients with other dementing illnesses or in healthy aged subjects. Recent work has demonstrated extensive biological similarities between CJD, scrapie and AD. The similarities in the regional metabolic alterations between CJD and AD provide additional evidence for the hypothesis that AD is caused by a slow infectious (prion-like) pathogen.
Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid
Energy Technology Data Exchange (ETDEWEB)
Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii
1978-01-01
To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.
International Nuclear Information System (INIS)
Calzada, V.
2011-01-01
This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium
International Nuclear Information System (INIS)
Fujiwara, Satoru
2001-03-01
182nd advanced science seminar (the workshop on neutron structural biology) was held in February 9-10, 2000 at Tokai. Thirty-six participants from universities, research institutes, and private companies took part in the workshop, and total of 24 lectures were given. This proceedings collects abstracts, the figures and tables, which the speakers used in their lectures. The proceedings contains two reviews from the point of view of x-ray and neutron scatterings, and six subjects (21 papers) including neutron and x-ray scattering in the era of structure genomics, structural changes detected with solution scattering, a new way in structural biology opened by neutron crystallography and neutron scattering, x-ray sources and detectors, simulation and solution scattering, and neutron sources and detectors. (Kazumata, Y.)
The joint PNC-ORNL tank calibration experiment of 1991
International Nuclear Information System (INIS)
Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.
1991-11-01
A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs
Czech Academy of Sciences Publication Activity Database
Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.
2014-01-01
Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2008-07-01
The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.
2015-01-01
Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015
Single crystal growth and characterization of the intermetallic cubic cage system YCo1.82Mn0.18Zn20
Cabrera-Baez, M.; Finatti, B. F.; Rettori, C.; Avila, M. A.
2018-05-01
We report on the growth of YCo2-xMnxZn20 cubic single crystals (0 ≤ x ≤ 0.18) and their characterization through elemental analysis, x-ray diffraction, magnetization and heat capacity. Mn intermediate and/or mixed-valence-like behavior was observed in the magnetic response of YCo1.82Mn0.18Zn20 (and all other samples) at temperatures between 100 K and 200 K, and a spin-glass state is established at low temperatures. Specific heat results for x = 0.18 show an increased Sommerfeld coefficient of γ ≈ 100 mJ / mol .K2 compared to that of the undoped compound (18 mJ / mol .K2) suggesting an enhancement of the quasiparticle effective mass ignoring spin-glass effects at very low temperatures. The combination of different experimental data provides a better understanding of the Mn2+ effects in the weakly correlated electron compound of YCo2Zn20, the first case in this family of compounds where local magnetic moments come exclusively from the transition metal.
Chen, Shih-Cheng; Liu, Hui-Wen; Lee, Kung-Ta; Yamakawa, Takashi
2007-01-01
The chimerical gene, Arabidopsis thaliana sHSP18.2 promoter fused to E. coli gusA gene, was Agrobacterium rhizogenes-mediated transformed into Nicotiana tabacum as a heat-regulatable model, and the thermo-inducible expression of GUS activity in N. tabacum transgenic hairy roots was profiled. An activation of A. rhizogenes with acetosyringone (AS) before cocultured with tobacco's leaf disc strongly promoted transgenic hairy roots formation. Transgenic hairy roots formation efficiency of A. rhizogenes precultured with 200 microM AS supplementation was 3.1-fold and 7.5-fold, respectively, compared to the formation efficiency obtained with and without AS supplementation in coculture. Transgenic hairy roots transformed with different AS concentration exhibited a similar pattern of thermo-inducibility after 10 min to 3 h heat treatments detected by GUS expression. The peak of expressed GUS specific activity, 399,530 pmol MUG per mg total protein per min, of the transgenic hairy roots was observed at 48 h after 3 h of 42 degrees C heat treatment, and the expressed GUS specific activity was 7-26 times more than that reported in A. thaliana, tobacco BY-2 cells and Nicotiana plumbaginifolia. Interference caused by AS supplementation on the growth of transgenic hairy roots, time-course of GUS expression and its expression level were not observed.
Energy Technology Data Exchange (ETDEWEB)
Ruedig, Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Whicker, Jeffrey Jay [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-08-07
In 2017, soil sampling for radiological materials was conducted within Tract A-18-2 specifically for land conveyance decisions. Measurements of radionuclides in soil samples were evaluated against a recreational use scenario, and all measurements were below screening action levels for each radionuclide. The total estimated dose was less than 1 mrem/y (< 10 μSv/y) for a hypothetical recreational user (compared to a dose limit of 25 mrem/y (250 μSv/y)). Dose estimates were based on the 95% upper confidence limits for radionuclide concentrations within the Tract. Additionally, dose estimates less than 3 mrem/y are considered to be As Low As Reasonably Achievable, so no follow-up analysis was conducted. Release of this property is consistent with the requirements of DOE Order 458.1 and Policy 412.
Effective atomic number, electron density and kerma of gamma ...
Indian Academy of Sciences (India)
rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.
Failli, P; Tesco, G; Ruocco, C; Ginestroni, A; Amaducci, L; Giotti, A; Sorbi, S
1996-04-26
It has been proposed that the lack of intracellular calcium concentration ([Ca2+]i) increase induced by the potassium channel blocker tetraethylammonium (TEA) in skin fibroblast cell lines identifies patients with both sporadic and familial Alzheimer's disease (AD). In order to verify this hypothesis, the effect of TEA on [Ca2+]i was studied in single fura-2-loaded skin fibroblast cell lines available in the Tissue Bank of the Italian Research Council. Four out of eight familial AD patients (one patient with S182 mutation, one patient with E5-1 mutation and two patients with 717 Val-->Ile APP mutation) and two out of five sporadic AD patients showed a positive response to TEA, whereas five out of 11 control lines were unresponsive. Our data suggest that the absence of the TEA-induced increase in [Ca2+]i in skin fibroblast cell lines does not identify all AD patients.
Energy Technology Data Exchange (ETDEWEB)
Ruedig, Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Whicker, Jeffrey Jay [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2018-01-26
In 2017, soil sampling for radiological materials was conducted within Tract A-18-2 at Los Alamos National Laboratory (LANL) for land conveyance decisions. Measurements of radionuclides in soil samples were evaluated against a recreational use scenario, and all measurements were below screening action levels for each radionuclide. The total estimated dose was less than 1 mrem/yr (<10 μSv/yr) for a hypothetical recreational user (compared with a dose limit of 25 mrem/yr [250 μSv/yr]). Dose estimates were based on the 95% upper confidence levels for radionuclide concentrations within the Tract. Dose estimates less than 3 mrem/yr are considered to be as low as reasonably achievable (ALARA), therefore no follow-up analysis was conducted. Release of this property is consistent with the requirements of DOE Order 458.1 (DOE 2013) and Policy 412 (LANL 2014).
Energy Technology Data Exchange (ETDEWEB)
Fujiwara, Satoru (ed.) [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2001-03-01
182nd advanced science seminar (the workshop on neutron structural biology) was held in February 9-10, 2000 at Tokai. Thirty-six participants from universities, research institutes, and private companies took part in the workshop, and total of 24 lectures were given. This proceedings collects abstracts, the figures and tables, which the speakers used in their lectures. The proceedings contains two reviews from the point of view of x-ray and neutron scatterings, and six subjects (21 papers) including neutron and x-ray scattering in the era of structure genomics, structural changes detected with solution scattering, a new way in structural biology opened by neutron crystallography and neutron scattering, x-ray sources and detectors, simulation and solution scattering, and neutron sources and detectors. (Kazumata, Y.)
International Nuclear Information System (INIS)
Lobo, L.Q.; Ferreira, A.G.M.; Fonseca, I.M.A.; Senra, A.M.P.
2006-01-01
The vapour pressure of binary mixtures of hydrogen sulphide with ethane, propane, and n-butane was measured at T=182.33K covering most of the composition range. The excess Gibbs free energy of these mixtures has been derived from the measurements made. For the equimolar mixtures G m E (x 1 =0.5)=(835.5+/-5.8)J.mol -1 for (H 2 S+C 2 H 6 ) (820.1+/-2.4)J.mol -1 for (H 2 S+C 3 H 8 ), and (818.6+/-0.9)J.mol -1 for (H 2 S+n-C 4 H 10 ). The binary mixtures of H 2 S with ethane and with propane exhibit azeotropes, but that with n-butane does not
Energy Technology Data Exchange (ETDEWEB)
L. M. Dittmer
2007-12-03
The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.
Directory of Open Access Journals (Sweden)
Mactutus Charles F
2005-06-01
Full Text Available Abstract Background HIV Associated Dementia (HAD is a common complication of human immunodeficiency virus (HIV infection that erodes the quality of life for patients and burdens health care providers. Intravenous drug use is a major route of HIV transmission, and drug use is associated with increased HAD. Specific proteins released as a consequence of HIV infection (e.g., gp120, the HIV envelope protein and Tat, the nuclear transactivating protein have been implicated in the pathogenesis of HAD. In primary cultures of human fetal brain tissue, subtoxic doses of gp120 and Tat are capable of interacting with a physiologically relevant dose of cocaine, to produce a significant synergistic neurotoxicity. Using this model system, the neuroprotective potential of gonadal steroids was investigated. Results 17β-Estradiol (17β-E2, but not 17α-estradiol (17α-E2, was protective against this combined neurotoxicity. Progesterone (PROG afforded limited neuroprotection, as did dihydrotestosterone (DHT. The efficacy of 5α-testosterone (T-mediated neuroprotection was robust, similar to that provided by 17β-E2. In the presence of the specific estrogen receptor (ER antagonist, ICI-182,780, T's neuroprotection was completely blocked. Thus, T acts through the ER to provide neuroprotection against HIV proteins and cocaine. Interestingly, cholesterol also demonstrated concentration-dependent neuroprotection, possibly attributable to cholesterol's serving as a steroid hormone precursor in neurons. Conclusion Collectively, the present data indicate that cocaine has a robust interaction with the HIV proteins gp120 and Tat that produces severe neurotoxicity, and this toxicity can be blocked through pretreatment with ER agonists.
Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype
Ziemons, K; Streun, M; Pietrzyk, U
2004-01-01
The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...
Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long
2015-01-01
The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510
Directory of Open Access Journals (Sweden)
Liangjie Pan
2015-08-01
Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.
Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy
Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E
2014-01-01
In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...
International Nuclear Information System (INIS)
Dittmer, L.M.
2007-01-01
The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River
International Nuclear Information System (INIS)
Lee, J. W.; Kang, W. J.; Kim, B. S.; Lee, D. S.; Jeong, J. K.; Lee, M. C.
2007-01-01
This study was performed to assess the accuracy of fluorodeoxyglucose - positron emission tomography/computed tomography (FDG-PET/CT) in the mediastinal lymph nodal staging of non-small cell lung cancer as compared with CT. Between March 2004 and February 2006, 182 patients (126 men and 56 women; mean age, 60.7 y) with non-small cell lung cancer underwent FDG PET/CT and enhanced chest CT. PET/CT and CT images were acquired in a prospective manner. These images were evaluated separately by 2 different physicians and nodal stages were determined by using American Joint Committee on Cancer staging systems. The maxSUV, location, size, calcification and pattern of FDG uptake of lymph nodes were considered. Surgical and histological findings served as the reference standard. A total of 182 patients with 778 mediastinal nodal stations were evaluated. Among them, metastases were found in 36 patients with 53 nodal stations. The respective values for sensitivity, specificity, positive predictive value, negative predictive value and accuracy of mediastinal lymph node staging were 36%, 80%, 30%, 84% and 71% with CT and 75%, 89%, 63%, 94% and 86% with PET/CT on per-patient basis, and 23%, 92%, 18%, 94% and 88% with CT and 66%, 96%, 54%, 98% and 94% with PET/CT on per-nodal-station basis. The maxSUVs of metastatic lymph nodes were significantly higher than those of benign nodes (p = 0.0008). Seventy seven percent (27/35) of the metastatic lymph nodes on FDG-PET/CT images were less than a 1cm in the short axis. Moreover, some benign lymph node patterns, such as bilateral symmetric nodes with similar FDG uptake, benign pattern of nodal calcification and small-sized lymph node with much higher maxSUV than primary tumor, were noted during the evaluation of FDG-PET/CT images. This prospective study suggests that FDG-PET/CT is more accurately stage the mediastinal lymph node staging than CT, and that it provides high specificity and a negative predictive value
Czech Academy of Sciences Publication Activity Database
Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.
2015-01-01
Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015
Zhang, Chengwei; Zhao, Xiaozhi; Guo, Suhan; Ji, Changwei; Wang, Wei; Guo, Hongqian
2018-05-15
To evaluate the perioperative outcomes of zero ischemia radiofrequency ablation-assisted tumor enucleation. Patients undergoing zero ischemia radiofrequency ablation-assisted tumor enucleation were retrospectively identified from July 2008 to March 2013. The tumor was enucleated after RFA treatment. R.E.N.A.L., PADUA and centrality index (C-index) score systems were used to assess each tumor case. We analyzed the correlation of perioperative outcomes with these scores. Postoperative complications were graded with Clavien-Dindo system. Multivariate logistic regression analyses were used to assess risk of complications. Among 182 patients assessed, median tumor size, estimated blood loss, hospital stay and operative time were 3.2 cm (IQR 2.8-3.4), 80 ml (IQR 50-120), 7 days (IQR 6-8) and 100 min (IQR 90-120), respectively. All three scoring systems were strongly correlated with estimated blood loss, hospital stay and operative time. We found 3 (1.6%) intraoperative and 23 (12.6%, 13 [7.1%] Grade 1 and 10 [5.5%] Grade 2 & 3a) postoperative complications. The median follow-up was 55.5 months (IQR 45-70). Additionally, the complexities of R.E.N.A.L., PADUA and C-index scores were significantly correlated with complication grades (P radiofrequency ablation-assisted tumor enucleation is considered an effective nephron-sparing treatment. Scoring systems could be useful for predicting perioperative outcomes of radiofrequency ablation-assisted tumor enucleation.
International Nuclear Information System (INIS)
Wijns, W.; Melin, J.A.; Leners, N.
1988-01-01
Polymorphonuclear leukocytes may participate in reperfusion injury. Whether leukocytes affect viable or only irreversibly injured tissue is not known. Therefore, we assessed the accumulation of 111In-labeled leukocytes in tissue samples characterized as either ischemic but viable or necrotic by metabolic, histochemical, and ultrastructural criteria. Six open-chest dogs received left anterior descending coronary occlusion for 2 hr followed by 4 hr reperfusion. Myocardial blood flow was determined by microspheres and autologous 111In-labeled leukocytes were injected intravenously. Fluorine-18-2-deoxyglucose, a tracer of exogenous glucose utilization, was injected 3 hr after reperfusion. The dogs were killed 4 hr after reperfusion. The risk and the necrotic regions were assessed following in vivo dye injection and postmortem tetrazolium staining. Myocardial samples were obtained in the ischemic but viable, necrotic and normal zones, and counted for 111In and 18F activity. Compared to normal, leukocytes were entrapped in necrotic regions (111In activity: 207 +/- 73%) where glucose uptake was decreased (26 +/- 15%). A persistent glucose uptake, marker of viability, was mainly seen in risk region (135 +/- 85%) where leukocytes accumulation was moderate in comparison to normal zone (146 +/- 44%). Thus, the glucose uptake observed in viable tissue is mainly related to myocytes metabolism and not to leukocytes metabolism
International Nuclear Information System (INIS)
Hou, Juan; Peng, Qunjia; Takeda, Yoichi; Kuniya, Jiro; Shoji, Tetsuo
2010-01-01
Research highlights: → High-angle misorientation at FB, type-II and type-I boundaries. → Highest residual strain and hardness in the zone between FB and type-II boundary. → Type-II and type-I boundaries had lower resistance to SCC growth than the FB. → Crack growth blunted by pitting at the FB. → Reactivation of crack growth from the pitting by oxidation along the grain boundary. - Abstract: Stress corrosion cracking (SCC) in the fusion boundary (FB) region of an Alloy 182-A533B low alloy steel (LAS) dissimilar weld joint in high temperature water doped with sulfate was studied following a microstructure characterization of the FB region. The microstructure characterization suggested the type-II and type-I boundaries in the dilution zone (DZ) adjacent to the FB had lower resistance to SCC growth than the FB. Crack propagating perpendicular to the FB in the DZ was observed to be blunted by pitting at the FB, followed by the reactivation from the pitting by localized oxidation along the grain boundary in LAS.
Czech Academy of Sciences Publication Activity Database
Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.
2014-01-01
Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014
Magnetic structures of holmium-lutetium alloys and superlattices
DEFF Research Database (Denmark)
Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.
1996-01-01
Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....
Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver
International Nuclear Information System (INIS)
Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.
2001-01-01
A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.
2016-01-01
Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Lima, Clarice Maria de
2011-07-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu
Directory of Open Access Journals (Sweden)
Tiago Nunes da Silva
2018-04-01
Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.
Measurement of lifetimes of high spin states in the N = 106 nuclei {sup 183}Ir and {sup 182}Os
Energy Technology Data Exchange (ETDEWEB)
Ahmad, I.; Blumenthal, D.; Carpenter, M.P. [and others
1995-08-01
Lifetimes of high spin states in the isotones {sup 183}Ir and {sup 182}Os were measured using the Notre Dame plunger device in conjunction with the Argonne Notre Dame {gamma}-ray facility. The aim of these measurements was to determine the deformation-driving properties of the h{sub 9/2} proton intruder orbital by comparing the values of the intrinsic quadrupole moments in the ground state bands in the odd-mass Ir nucleus and the even-even Os core. Levels in these nuclei were populated by the {sup 150}Nd ({sup 37}Cl,4n) and {sup 150}Nd ({sup 36}S,4n) reactions using a {sup 37}Cl beam of 169 MeV and 164-Mev {sup 36}S beam. The {sup 150}Nd target was 0.9-g/cm{sup 2} thick and was prepared by evaporating enriched {sup 150}Nd onto a stretched 1.5-mg/cm{sup 2} gold foil. The target was covered with a layer of a 60-{mu}g/cm{sup 2} Au to prevent its oxidation. Gamma-ray spectra were accumulated for approximately 4 hours for each target-stopper distance. Data were collected for 20 target-stopper distances ranging from 16 {mu}m to 10.4 mm. Preliminary analysis indicates that it will be possible to extract the lifetimes of the levels in the yrast bands up to and including part of the backbending region with sufficient accuracy. Detailed analysis of the data is in progress.
International Nuclear Information System (INIS)
Zhukova, T.B.; Parfen'eva, L.S.; Popov, V.V.; Melekh, B.T.; Smirnov, I.A.; Khalmedov, Kh.M.
1991-01-01
Phase compositions are determined and temperature dependences are measured of x-heat conductivity, ρ-electric resistance and α-thermo-emf of polycrystal, monophase, highly textured HTSC samples of BiSrCaCu 2 O x and Bi 1.82 Sr 1.73 Ca 1.25 Cu 2.2 O x produced through method of direct induction melting in the air in a cold container. Sample 'aging' after storage in the air and vacuum, leading to decrease in the number of foring phases and increase in the basic phase content as well as to change of x, ρ and α coefficients is identified
Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides
International Nuclear Information System (INIS)
Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2001-01-01
The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)
International Nuclear Information System (INIS)
Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.
2003-01-01
Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru
Energy Technology Data Exchange (ETDEWEB)
Griepink, B; Colinet, E; Wilkinson, H C
1986-01-01
The report first describes the preparation of three coal reference materials: Gas coal (BCR No. 180), Coking coal (BCR No. 181) and Steam coal (BCR No. 182). It deals further with the homogeneity and stability tests for major, minor and trace components. The contents (mass fractions) of the elements: C, H, N, Cl, As, Cd, Mn, Hg, Pb, Se, V and Zn are certified. The analytical techniques used in the certification are summarised. All the individual results are given and recommendations for analysis are made.
Czech Academy of Sciences Publication Activity Database
Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin
2016-01-01
Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016
International Nuclear Information System (INIS)
Rabatin, J.G.
1984-01-01
Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)
Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav
2009-01-01
Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena
2012-01-01
Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012
An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3
International Nuclear Information System (INIS)
Osborn, R.
1998-01-01
We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence
Directory of Open Access Journals (Sweden)
Peter D. Olcott
2009-03-01
Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Olcott, Peter D; Peng, Hao; Levin, Craig S
2009-01-01
A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Energy Technology Data Exchange (ETDEWEB)
Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)
2016-07-07
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.
2016-07-01
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Energy Technology Data Exchange (ETDEWEB)
Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)
2009-05-15
Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.
Energy Technology Data Exchange (ETDEWEB)
Ruedig, Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-08-30
Public Law 105-119 directs the U.S. Department of Energy (DOE) to convey or transfer parcels of land to the Incorporated County of Los Alamos or their designees and to the Department of Interior, Bureau of Indian Affairs, in trust for the Pueblo de San Ildefonso. Los Alamos National Security is tasked to support DOE in conveyance and/or transfer of identified land parcels no later than September 2022. Under DOE Order 458.1, Radiation Protection of the Public and the Environment (O458.1, 2013) and Los Alamos National Laboratory (LANL or the Laboratory) implementing Policy 412 (P412, 2014), real property with the potential to contain residual radioactive material must meet the criteria for clearance and release to the public. This Sampling and Analysis Plan (SAP) is a second investigation of Tract A-18-2 for the purpose of verifying the previous sampling results (LANL 2017). This sample plan requires 18 projectspecific soil samples for use in radiological clearance decisions consistent with LANL Procedure ENV-ES-TP-238 (2015a) and guidance in the Multi-Agency Radiation Survey and Site Investigation Manual (MARSSIM, 2000). The sampling work will be conducted by LANL, and samples will be evaluated by a LANL-contracted independent lab. However, there will be federal review (verification) of all steps of the sampling process.
Kao, Ting-Hsien; Wu, Chen-Hao; Chou, Yu-Ching; Chen, Hsien-Te; Chen, Wen-Hsien; Tsou, Hsi-Kai
2014-10-01
To determine risk factors for subsidence in patients treated with anterior cervical discectomy and fusion (ACDF) and stand-alone polyetheretherketone (PEEK) cages. Records of patients with degenerative spondylosis or traumatic disc herniation resulting in radiculopathy or myelopathy between C2 and C7 who underwent ACDF with stand-alone PEEK cages were retrospectively reviewed. Cages were filled with autogenous cancellous bone harvested from iliac crest or hydroxyapatite. Subsidence was defined as a decrease of 3 mm or more of anterior or posterior disc height from that measured on the postoperative radiograph. Eighty-two patients (32 males, 50 females; 182 treatment levels) were included in the analysis. Most patients had 1-2 treatment levels (62.2 %), and 37.8 % had 3-4 treatment levels. Treatment levels were from C2-7. Of the 82 patients, cage subsidence occurred in 31 patients, and at 39 treatment levels. Multivariable analysis showed that subsidence was more likely to occur in patients with more than two treatment levels, and more likely to occur at treatment levels C5-7 than at levels C2-5. Subsidence was not associated with postoperative alignment change but associated with more disc height change (relatively oversized cage). Subsidence is associated with a greater number of treatment levels, treatment at C5-7 and relatively oversized cage use.
Long, Nathan; Long, Bertha; Mana, Asma; Le, Dream; Nguyen, Lam; Chokr, Sima; Sinchak, Kevin
2017-03-01
In the female rat, sexual receptivity (lordosis) can be facilitated by sequential activation of estrogen receptor (ER) α and G protein-coupled estrogen receptor 1 (GPER) by estradiol. In the estradiol benzoate (EB) primed ovariectomized (OVX) rat, EB initially binds to ERα in the plasma membrane that complexes with and transactivates metabotropic glutamate receptor 1a to activate β-endorphin neurons in the arcuate nucleus of the hypothalamus (ARH) that project to the medial preoptic nucleus (MPN). This activates MPN μ-opioid receptors (MOP), inhibiting lordosis. Infusion of non-esterified 17β-estradiol into the ARH rapidly reduces MPN MOP activation and facilitates lordosis via GPER. Tamoxifen (TAM) and ICI 182,780 (ICI) are selective estrogen receptor modulators that activate GPER. Therefore, we tested the hypothesis that TAM and ICI rapidly facilitate lordosis via activation of GPER in the ARH. Our first experiment demonstrated that injection of TAM intraperitoneal, or ICI into the lateral ventricle, deactivated MPN MOP and facilitated lordosis in EB-primed rats. We then tested whether TAM and ICI were acting rapidly through a GPER dependent pathway in the ARH. In EB-primed rats, ARH infusion of either TAM or ICI facilitated lordosis and reduced MPN MOP activation within 30min compared to controls. These effects were blocked by pretreatment with the GPER antagonist, G15. Our findings demonstrate that TAM and ICI deactivate MPN MOP and facilitate lordosis in a GPER dependent manner. Thus, TAM and ICI may activate GPER in the CNS to produce estrogenic actions in neural circuits that modulate physiology and behavior. Published by Elsevier Inc.
Seymour, Lisa M; Jenkins, Cheryl; Deutscher, Ania T; Raymond, Benjamin B A; Padula, Matthew P; Tacchi, Jessica L; Bogema, Daniel R; Eamens, Graeme J; Woolley, Lauren K; Dixon, Nicholas E; Walker, Mark J; Djordjevic, Steven P
2012-01-01
Mycoplasma hyopneumoniae is a major, economically damaging respiratory pathogen. Although M. hyopneumoniae cells bind plasminogen, the identification of plasminogen-binding surface proteins and the biological ramifications of acquiring plasminogen requires further investigation. mhp182 encodes a highly expressed 102 kDa protein (P102) that undergoes proteolytic processing to generate surface-located N-terminal 60 kDa (P60) and C-terminal 42 kDa (P42) proteins of unknown function. We show that recombinant P102 (rP102) binds plasminogen at physiologically relevant concentrations (K(D) ~ 76 nM) increasing the susceptibility of plasmin(ogen) to activation by tissue-specific plasminogen activator (tPA). Recombinant proteins constructed to mimic P60 (rP60) and P42 (rP42) also bound plasminogen at physiologically significant levels. M. hyopneumoniae surface-bound plasminogen was activated by tPA and is able to degrade fibrinogen, demonstrating the biological functionality of M. hyopneumoniae-bound plasmin(ogen) upon activation. Plasmin(ogen) was readily detected in porcine ciliated airways and plasmin levels were consistently higher in bronchoalveolar lavage fluid from M. hyopneumoniae-infected animals. Additionally, rP102 and rP42 bind fibronectin with K(D) s of 26 and 33 nM respectively and recombinant P102 proteins promote adherence to porcine kidney epithelial-like cells. The multifunctional binding ability of P102 and activation of M. hyopneumoniae-sequestered plasmin(ogen) by an exogenous activator suggests P102 plays an important role in virulence. © 2011 Blackwell Publishing Ltd.
Low-temperature thermal properties of yttrium and lutetium dodecaborides
International Nuclear Information System (INIS)
Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y
2005-01-01
The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K
Lutetium-177-EDTMP for pain palliation in bone metastases
International Nuclear Information System (INIS)
Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.
1999-01-01
Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)
Pedro Alves Barbosa Neto
2013-01-01
Este trabalho investiga os fluxos informacionais desenvolvidos no âmbito do monitoramento da implementação da Convenção 182, Sobre as Piores Formas do Trabalho Infantil, da Organização Internacional do Trabalho (OIT), comparando os contextos brasileiro e canadense. A Convenção tem como objetivo principal a erradicação do trabalho infantil manifestado em suas piores formas das práticas cotidianas vigentes e as qualifica em um grupo de quatro categorias principais, quais sejam: a) trabalho forç...
Czech Academy of Sciences Publication Activity Database
Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.
2016-01-01
Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016
Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.
2014-01-01
Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014
Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin
2016-01-01
Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016
Yttrium and rare earths separation by ion exchange resin
International Nuclear Information System (INIS)
Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.
1988-01-01
The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt
International Nuclear Information System (INIS)
Bellis, V.M. de.
1984-01-01
The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt
International Nuclear Information System (INIS)
1996-01-01
The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented
Lager, Anton; Seblova, Dominika; Falkstedt, Daniel; Lövdén, Martin
2017-02-01
Cognitive and socio-emotional abilities are powerful predictors of death and disease as well as of social and economic outcomes. Education is societies' main way of promoting these abilities, ideally so that inequalities by socioeconomic background are reduced. However, the extent to which education serves these cognitive, social-emotional and equality objectives is relatively unknown and intensively debated. Drawing on a Swedish school reform that was explicitly designed as a massive quasi-experiment, we assessed differential impact of education on intelligence and emotional control across childhood socioeconomic position. We also assessed initial differences in abilities by childhood socioeconomic position and how well childhood socioeconomic position and abilities predict all-cause mortality. The Swedish comprehensive school reform, rolled out during the 1950s, extended compulsory education from 8 to 9 years in some municipalities whereas others were kept as controls for the sake of evaluation. We followed eight full cohorts of Swedish boys born between 1951 and 1958, who lived in 1017 municipalities with known experimental status (344 336 boys) and whose childhood socioeconomic position was known (320 182 boys). At conscription, intelligence was measured by four subtests and emotional control (calm and efficient responses in various situations) was rated by a military psychologist. Both measures were standardized to have a mean of 100 and standard deviation of 15. All-cause mortality was recorded until 49-56 years of age. The reform had an average positive impact on intelligence of 0.75 IQ units (95% confidence interval (CI): 0.54, 0.97; P emotional control was negative; -0.50 units (95% CI: -0.72, -0.28; P emotional control was reduced from 6.50 to 5.63 units. All-cause mortality was predicted by low childhood socioeconomic position [hazard ratio (HR) = 1.15 [95% CI: 1.11, 1.20], P emotional control [HR = 1.61 (95% CI: 1.55, 1.67), P education promoted
1971-01-01
Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11
Greenhalgh, Janette; Bagust, Adrian; Boland, Angela; Dwan, Kerry; Beale, Sophie; Fleeman, Nigel; McEntee, Joanne; Dundar, Yenal; Richardson, Marty; Fisher, Michael
2015-04-01
Acute coronary syndromes (ACSs) are life-threatening conditions associated with acute myocardial ischaemia. There are three main types of ACS: ST segment elevation myocardial infarction (STEMI), non-ST segment elevation myocardial infarction (NSTEMI) and unstable angina (UA). One treatment for ACS is percutaneous coronary intervention (PCI) plus adjunctive treatment with antiplatelet drugs. Dual therapy antiplatelet treatment [aspirin plus either prasugrel (Efient(®), Daiichi Sankyo Company Ltd UK/Eli Lilly and Company Ltd), clopidogrel or ticagrelor (Brilique(®), AstraZeneca)] is standard in UK clinical practice. Prasugrel is the focus of this review. The remit is to appraise the clinical effectiveness and cost-effectiveness of prasugrel within its licensed indication for the treatment of ACS with PCI and is a review of National Institute for Health and Care Excellence technology appraisal TA182. Four electronic databases (MEDLINE, EMBASE, The Cochrane Library, PubMed) were searched from database inception to June 2013 for randomised controlled trials (RCTs) and to August 2013 for economic evaluations comparing prasugrel with clopidogrel or ticagrelor in ACS patients undergoing PCI. Clinical outcomes included non-fatal and fatal cardiovascular (CV) events, adverse effects of treatment and health-related quality of life (HRQoL). Cost-effectiveness outcomes included incremental cost per life-year gained and incremental cost per quality-adjusted life-year (QALY) gained. An independent economic model assessed four mutually exclusive subgroups: ACS patients treated with PCI for STEMI and with and without diabetes mellitus and ACS patients treated with PCI for UA or NSTEMI and with and without diabetes mellitus. No new RCTs were identified beyond that reported in TA182. TRITON-TIMI 38 (Trial to Assess Improvement in Therapeutic Outcomes by Optimizing Platelet Inhibition with Prasugrel Thrombolysis in Myocardial Infarction 38) compared prasugrel with clopidogrel in ACS
Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates
International Nuclear Information System (INIS)
Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.
1975-01-01
Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out
Kramer, John K G; Hernandez, Marta; Cruz-Hernandez, Cristina; Kraft, Jana; Dugan, Michael E R
2008-03-01
Milk fat is a complex mixture of geometric and positional isomers of monounsaturated and polyunsaturated, including short-, long- and branch-chain fatty acids (FAs). There has been partial success to resolve this mixture of FAs using different GC temperature programs, or a combination of GC isothermal and temperature programs. To overcome the problem associated with overlapping isomers prior silver-ion separation was recommended. However, this procedure is time consuming and not practical for routine analysis. In addition, previous methods focused mainly on the trans and cis isomers of 18:1. The present method takes advantage of differences in the relative elution times between different types of FAs. The method involved analyzing each milk fat using the same highly polar 100-m capillary column and GC instrument, and conducting two separations using temperature programs that plateau at 175 and 150 degrees C. The relative shift among the geometric and positional isomers at these two temperature settings was enough to permit identification of most of the trans and cis 16:1, 18:1 and 20:1, the c/t-18:2 and the c/c/t-18:3 isomers found in milk fat. The identity of these FAs was confirmed by prior separation of the total fatty acid methyl esters (FAMEs) of milk fat using Ag(+)-SPE columns, and comparing the fractions to the total milk fat. The Ag(+)-SPE technique was modified to obtain pure saturated, trans- and cis-monounsaturated and diunsaturated FAMEs. By combining the results from these two separate GC analyses, knowing the elution order, it was possible to determine most of the geometric and positional isomers of 16:1, 18:1, 20:1, 18:2 and 18:3 without a prior silver-ion separation. Only few minor FAs could not be resolved, notable the conjugated linoleic acid isomers that still required the complimentary Ag(+)-HPLC separation. The two GC temperature programs have been successfully used to routinely analyze most FA isomers in total milk and beef fats in about 200
International Nuclear Information System (INIS)
Yamada, Kiyoshi; Brink, I.; Engelhardt, R.
2005-01-01
In order to specify the influence of multidrug-resistance (MDR) on the accumulation of the PET tracer, F-18 FDG ([Fluorine-18]2-fluoro-2-deoxy-D-glucose, in melanoma cells, both the MDR function and expression of two human melanoma cell lines SK-MEL 23 and 24, were evaluated. The effects of MDR modulators on FDG accumulation and efflux were also investigated. A functional analysis using representative MDR fluorescent substrates and inhibitors clarified the following characteristics: SK-MEL 23 possesses a highly active function of multidrug resistance-associated protein (MRP), but not P-gp. SK-MEL 24 possesses weak functions of both MRP and P-gp. Western blot analysis using monoclonal antibodies for MDR expression demonstrated an exceedingly high MRP expression of SK-MEL 23 and only slight P-gp and MRP expression of SK-MEL 24, corresponding to the functional data. The efflux inhibition assay using F-18 FDG revealed a considerable retention of FDG in SK-MEL 23 in the presence of the MRP inhibitor probenecid. It was also found that the P-gp inhibitor verapamil depressed the FDG efflux of SK-MEL 24. Our present in vitro study suggests that FDG may be a substrate of MDR in some melanoma cells and further MDR may be one of the important factors affecting FDG-PET melanoma imaging. (author)
International Nuclear Information System (INIS)
Zhai, Ziqing; Miyahara, Yuichi; Abe, Hiroshi; Watanabe, Yutaka
2014-01-01
Highlights: • Impacts of aging on P segregation in actual heat-affected zone were examined by 3D-APT. • Non-equilibrium segregation of P dominated in subsequent cooling after welding. • Equilibrium segregation of P prevailed in step-cooling heat treatment. • High enrichment of P at grain/packet boundaries occurred in CGHAZ and ICCGHAZ. • Level of P enrichment at precipitate/matrix interface seemed species-dependent. - Abstract: The segregation behavior of phosphorus (P) in the heat-affected zone (HAZ) of an A533B/A182 dissimilar weld joint before and after step cooling was investigated with atom probe tomography. At grain/packet boundaries, the final P segregation level consisted of non-equilibrium segregation that occurred during cooling after welding and post-weld heat treatment (PWHT) and equilibrium segregation that occurred during step cooling. In both processes, higher P coverage was observed in the coarse-grained and intercritically reheated coarse-grained HAZ than in the fine-grained HAZ and base material. The cooling after welding and PWHT seemed to have a pronounced impact on P segregation in the subsequent aging process. In addition, P segregation also occurred at the precipitate/matrix interfaces of cementite, Mo 2 C and Al–Si rich precipitates. The evolution of P coverage at these two types of sites suggested increasing risks of embrittlement with an increase in aging time
Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems
1991-03-15
Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State
USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.
1978-11-02
magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the
International Nuclear Information System (INIS)
Hirakawa, Tomoko; Okumura, Yoshihiro; Kato, Jun
2012-01-01
The purpose of this study was to analyze the detectability of colorectal neoplasia with fluorine-18-2-fluoro-2-deoxy-D-glucose positron emission tomography/computed tomography (FDG-PET/CT). Data for a total of 492 patients who had undergone both PET/CT and colonoscopy were analyzed. After the findings of PET/CT and colonoscopy were determined independently, the results were compared in each of the six colonic sites examined in all patients. The efficacy of PET/CT was determined using colonoscopic examination as the gold standard. In all, 270 colorectal lesions 5 mm or more in size, including 70 pathologically confirmed malignant lesions, were found in 172 patients by colonoscopy. The sensitivity and specificity of PET/CT for detecting any of the colorectal lesions were 36 and 98%, respectively. For detecting lesions 11 mm or larger, the sensitivity was increased to 85%, with the specificity remaining consistent (97%). Moreover, the sensitivity for tumors 21 mm or larger was 96% (48/50). Tumors with malignant or high-grade pathology were likely to be positive with PET/CT. A size of 10 mm or smaller [odds ratio (OR) 44.14, 95% confidence interval (95% CI) 11.44-221.67] and flat morphology (OR 7.78, 95% CI 1.79-36.25) were significant factors that were associated with false-negative cases on PET/CT. The sensitivity of PET/CT for detecting colorectal lesions is acceptable, showing size- and pathology-dependence, suggesting, for the most part, that clinically relevant lesions are detectable with PET/CT. However, when considering PET/CT for screening purposes caution must be exercised because there are cases of false-negative results. (author)
Energy Technology Data Exchange (ETDEWEB)
McGowan, F K; Milner, W T; Sayer, R O; Robinson, R L; Stelson, P H [Oak Ridge National Lab., Tenn. (USA)
1977-10-10
The Coulomb excitation reaction induced by /sup 4/He ions selectively excites 2/sup +/ and 3/sup -/ states by direct E2 and E3 Coulomb excitation. In this paper, new results are presented from ..gamma..-ray spectroscopy with 15 MeV /sup 4/He ions on a natural abundance target of W. In particular, a 3/sup -/ state in each isotope, /sup 182/ /sup 184/ /sup 186/W, was observed by direct E3 excitation. In addition to obtaining B(Elambda, 0 ..-->.. J = lambda for excitation of each state, information on the reduced transition probabilities for the different decay modes of these states is given. The Coulomb excitation probabilities of the 2'/sup +/ states at 786 keV in /sup 166/Er and at 737 keV in /sup 186/W were measured with /sup 16/O and /sup 4/He ions by the backscattered particle-gamma coincidence method in order to determine the static electric quadrupole moment Qsub(2'). For /sup 166/Er, Qsub(2')=2.11+-0.37 e.b which is in agreement with (Qsub(2'))sub(rot) and for /sup 186/W, Qsub(2')=1.17+-0.30 e.b which is in agreement with Kumar-Baranger model calculations and is significantly smaller than (Qsub(2'))sub(rot). This deviation of the measured Qsub(2') from (Qsub(2'))sub(rot) implies in the framework of the Kumar-Baranger calculations a strong coupling between ..beta..- and ..gamma..-vibrational bands. On the other hand, the observed upper limit for B(E2, 2'' ..-->.. 2') does not confirm this implication.
Neutron temperature measurements in a cryogenic hydrogenous moderator
International Nuclear Information System (INIS)
Ball, R.M.; Hoovler, G.S.; Lewis, R.H.
1995-01-01
Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations
Espinosa-Raya, Judith; Cruz-Raya, Ulises; López-Martínez, Margarita; Picazo, Ofir
2018-01-09
Treatment with 17-β estradiol and progesterone improves the performance of ovariectomized rats in an autoshaping learning task, representing cognitive improvement. To test whether this is attributable to genomic mechanisms, the antiestrogen ICI 182 780 or antiprogesterone RU486 was injected into ovariectomized animals primed previously with estrogen or progesterone, respectively. Compared with the vehicle control, each hormone administered alone produced an elevated expression of choline acetyltransferase and TrkA, along with an improvement in performance on the behavioral test. E2+ICI reverted the increase in these two proteins. However, RU alone elicited higher ChAT expression. With this exception, there was a clear linear regression between the number of conditioned responses and the level of ChAT and TrkA in the basal forebrain. The results suggest that TrkA may be more important than ChAT for regulating autoshaping learning tasks, and that genomic mechanisms in the basal forebrain could possibly underlie hormonal improvement of cognition.
Measurement of the half-life of sup 1 sup 7 sup 6 Lu
Nir-El, Y
1998-01-01
The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-01-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...
First principle calculation of structure and lattice dynamics of Lu2Si2O7
Directory of Open Access Journals (Sweden)
Nazipov D.V.
2017-01-01
Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.
International Nuclear Information System (INIS)
Ino, Sento; Shimada, Takayuki; Kanagawa, Masaru; Suzuki, Noriaki; Kondo, Susumu; Shirakami, Yoshifumi; Ito, Osamu; Kato-Azuma, Makoto
1999-01-01
Fluorine-18-2-fluoro-2-deoxy-D-glucose ( 18 F-FDG) injection was prepared by a modification of a method originally developed by Hamacher et al. The dosage form is the injectable solution (2 ml) containing 185 MBq of 18 F-FDG at a calibration time. Preclinical studies of the agent were performed. Its radiochemical purity is more than 95% and expiration time is 4 hours after the calibration time at ambient temperature. No toxicity was observed with up to 200 mg/kg and 100 mg/kg of non-radioactive FDG intravenously injected to rats and dogs in single dose toxicity tests, respectively. Biodistribution studies demonstrated that the radioactivity was mainly distributed into brain (3.0 to 3.3% I.D./Organ at 30 minutes) and heart (4.2 to 5.8% I.D./Organ at 1 to 3 hours) after intravenous injection of the agent to normal rats. In a tumor transplanted mouse model (colon 26), tumor uptake was 10.9±3.5% I.D./g at 1 hr after intravenous injection of the agent, the radioactivity was retained until 3 hours. The radiation absorbed dose was estimated according to the MIRD Pamphlet based on the biodistribution data both in humans reported by Mejia et al. and rats described in this report. The radiation absorbed dose was not higher than those of commercially available radiopharmaceuticals. In conclusion, the 18 F-FDG injection is expected to be useful for further clinical application. (author)
Directory of Open Access Journals (Sweden)
Power Deborah M
2006-12-01
Full Text Available Abstract Background ICI 182,780 (ICI belongs to a new class of antiestrogens developed to be pure estrogen antagonists and, in addition to its therapeutic use, it has been used to knock-out estrogen and estrogen receptor (ER actions in several mammalian species. In the present study, the effects and mechanism of action of ICI were investigated in the teleost fish, sea bream (Sparus auratus. Methods Three independent in vivo experiments were performed in which mature male tilapia (Oreochromis mossambicus or sea bream received intra-peritoneal implants containing estradiol-17 beta (E2, ICI or a combination of both compounds. The effects of E2 and ICI on plasma calcium levels were measured and hepatic and testicular gene expression of the three ER subtypes, ER alpha, ER beta a and ER beta b, and the estrogen-responsive genes, vitellogenin II and choriogenin L, were analyzed by semi-quantitative RT-PCR in sea bream. Results E2 treatment caused an increase in calcium levels in tilapia, while ICI alone had no noticeable effect, as expected. However, pretreatment with ICI synergistically potentiated the effect of E2 on plasma calcium in both species. ICI mimicked some E2 actions in gene expression in sea bream liver upregulating ER alpha, vitellogenin II and choriogenin L, although, unlike E2, it did not downregulate ER beta a and ER beta b. In contrast, no effects of E2 or ICI alone were detected in the expression of ERs in testis, while vitellogenin II and choriogenin L were upregulated by E2 but not ICI. Finally, pretreatment with ICI had a synergistic effect on the hepatic E2 down-regulation of ER beta b, but apparently blocked the ER alpha up-regulation by E2. Conclusion These results demonstrate that ICI has agonistic effects on several typical estrogenic responses in fish, but its actions are tissue-specific. The mechanisms for the ICI agonistic activity are still unknown; although the ICI induced up-regulation of ER alpha mRNA could be one of
Energy Technology Data Exchange (ETDEWEB)
Gelfand, Michael J.; Sharp, Susan E. [Cincinnati Children' s Hospital Medical Center, Department of Radiology, Nuclear Medicine Division, Cincinnati, OH (United States)
2015-08-15
Metal endoprostheses and internal fixation devices cause significant artifacts on CT after limb salvage surgery; positron emission tomography (PET) images should be evaluated for artifacts. (1) To describe [F-18]2-fluoro-2-deoxyglucose (FDG) PET uptake patterns after limb salvage surgery. (2) To determine whether metal endoprostheses and fixation hardware cause significant artifacts on CT attenuation-corrected PET that interfere with diagnostic use of PET/CT after limb salvage surgery. We reviewed 92 studies from 18 patients ages 5-21 years. Diagnoses were osteogenic sarcoma in 14, Ewing sarcoma in 3, and malignant peripheral nerve sheath tumor originating in bone in 1. Nine patients had distal femur/knee endoprostheses, five had lower-extremity bone allografts secured by large metal plates and four had upper-extremity limb salvage procedures. Maximum standardized uptake value was calculated at lower-extremity soft-tissue-endoprosthesis interfaces. In 15 patients with PET/CT imaging, the first PET/CT scan after limb salvage surgery was reviewed for metal artifacts on CT images and for artifacts at locations on PET corresponding to the CT metal artifacts. Increased FDG uptake was consistently present at soft-tissue interfaces with endoprostheses, allografts and internal fixation devices, with little or no FDG uptake at cemented endoprosthesis-bone interfaces. Maximum standardized uptake value at margins of femur/knee endoprostheses ranged from 1.4 to 5.7. In four patients with distal femur/knee endoprostheses, minimal artifact was noted on attenuation-corrected PET images, but image interpretation was not affected. In the other 11 patients who had CT attenuation correction, we detected no artifacts caused by the attenuation correction. CT attenuation correction did not cause artifacts that affected interpretation of attenuation-corrected PET images. (orig.)
International Nuclear Information System (INIS)
Gelfand, Michael J.; Sharp, Susan E.
2015-01-01
Metal endoprostheses and internal fixation devices cause significant artifacts on CT after limb salvage surgery; positron emission tomography (PET) images should be evaluated for artifacts. (1) To describe [F-18]2-fluoro-2-deoxyglucose (FDG) PET uptake patterns after limb salvage surgery. (2) To determine whether metal endoprostheses and fixation hardware cause significant artifacts on CT attenuation-corrected PET that interfere with diagnostic use of PET/CT after limb salvage surgery. We reviewed 92 studies from 18 patients ages 5-21 years. Diagnoses were osteogenic sarcoma in 14, Ewing sarcoma in 3, and malignant peripheral nerve sheath tumor originating in bone in 1. Nine patients had distal femur/knee endoprostheses, five had lower-extremity bone allografts secured by large metal plates and four had upper-extremity limb salvage procedures. Maximum standardized uptake value was calculated at lower-extremity soft-tissue-endoprosthesis interfaces. In 15 patients with PET/CT imaging, the first PET/CT scan after limb salvage surgery was reviewed for metal artifacts on CT images and for artifacts at locations on PET corresponding to the CT metal artifacts. Increased FDG uptake was consistently present at soft-tissue interfaces with endoprostheses, allografts and internal fixation devices, with little or no FDG uptake at cemented endoprosthesis-bone interfaces. Maximum standardized uptake value at margins of femur/knee endoprostheses ranged from 1.4 to 5.7. In four patients with distal femur/knee endoprostheses, minimal artifact was noted on attenuation-corrected PET images, but image interpretation was not affected. In the other 11 patients who had CT attenuation correction, we detected no artifacts caused by the attenuation correction. CT attenuation correction did not cause artifacts that affected interpretation of attenuation-corrected PET images. (orig.)
International Nuclear Information System (INIS)
Ford, F.P.; Andresen, P.L.
1988-01-01
Environmentally assisted cracking (i.e., stress corrosion cracking and corrosion fatigue) continues to present a potential safety and economic problem to both the nuclear and non-nuclear power generation industries. Efforts to develop adequate mitigation actions have been vigorous in the former industry but, of necessity, these have been based primarily on accelerated tests covering a limited fraction of the wide combination of material, environment and stressing conditions that are pertinent to the operation of light water reactors. Previous articles have stressed the potential value of combining these phenomenologically oriented studies of stress corrosion and corrosion fatigue with a mechanistically based model of environmentally assisted cracking. Quite apart from conferring some scientific assurance of the validity of the empirically derived data vis a vis plant performance, the mechanistic knowledge offers the potential of interpreting the isolated experimental data and forming a methodology for making decisions regarding life prediction and life extension. This article briefly reviews the mechanistic basis for predicting the cracking behavior of 304/316 stainless steel, A508/A533B low alloy steels and Inconel 600/182 nickel-base alloys in high temperature water, and then develops the argument for the practical use of this mechanistic knowledge in conjunction with crack monitoring and environmental sensing capabilities
International Nuclear Information System (INIS)
Akanji, Akinkunmi Ganiyu
2012-01-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different
Energy Technology Data Exchange (ETDEWEB)
Akanji, Akinkunmi Ganiyu
2012-07-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated
International Nuclear Information System (INIS)
Papathanassopoulos, K.; Wenzl, H.; Schober, T.
1997-01-01
Dimensional changes of the high-temperature proton conductor Ba 3 Ca 1.18 Nb 1.82 O 9-δ , when exposed to D 2 O vapor, were investigated using length-change and precision density measurements. Such information is essential for possible applications of proton conductors in solid oxide fuel cells and humidity and hydrogen sensors. A linear increase of the sample lengths with increases in the deuterium content was observed. Comparison of the present D 2 O data with those that were previously obtained for H 2 O showed that there was a small isotope effect in the lattice expansion. The fact that the length-change-versus-hydrogen-isotope-concentration curves were almost isotope independent supported the validity of the take-up reaction H 2 O(g) + V sm-bulletsm-bullet O + O x O right-reversible 2OH sm-bullet O , where V O is the vacancies in the oxygen sublattice and OH sm-bullet O is the proton that are embedded in the electron cloud of an oxygen atom. In regard to the latter equation, it was found that small islands of silver, palladium, nickel, and platinum act as catalytic promoters of the reaction and lead, for given heavy-water-steam exposure conditions, to an increase of water absorption of up to 100%, when compared with samples without the catalytic surface layers
International Nuclear Information System (INIS)
Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh
2017-01-01
Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story
The migrant 152Eu as europium humate
International Nuclear Information System (INIS)
Klotz, D.
2001-01-01
Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de
Development of Scintillators in Nuclear Medicine
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...
Energy Technology Data Exchange (ETDEWEB)
Ino, Sento; Shimada, Takayuki; Kanagawa, Masaru; Suzuki, Noriaki; Kondo, Susumu; Shirakami, Yoshifumi; Ito, Osamu; Kato-Azuma, Makoto [Nihon Medi-Physics Co., Ltd., Sodegaura, Chiba (Japan). Research Center
1999-07-01
Fluorine-18-2-fluoro-2-deoxy-D-glucose ({sup 18}F-FDG) injection was prepared by a modification of a method originally developed by Hamacher et al. The dosage form is the injectable solution (2 ml) containing 185 MBq of {sup 18}F-FDG at a calibration time. Preclinical studies of the agent were performed. Its radiochemical purity is more than 95% and expiration time is 4 hours after the calibration time at ambient temperature. No toxicity was observed with up to 200 mg/kg and 100 mg/kg of non-radioactive FDG intravenously injected to rats and dogs in single dose toxicity tests, respectively. Biodistribution studies demonstrated that the radioactivity was mainly distributed into brain (3.0 to 3.3% I.D./Organ at 30 minutes) and heart (4.2 to 5.8% I.D./Organ at 1 to 3 hours) after intravenous injection of the agent to normal rats. In a tumor transplanted mouse model (colon 26), tumor uptake was 10.9{+-}3.5% I.D./g at 1 hr after intravenous injection of the agent, the radioactivity was retained until 3 hours. The radiation absorbed dose was estimated according to the MIRD Pamphlet based on the biodistribution data both in humans reported by Mejia et al. and rats described in this report. The radiation absorbed dose was not higher than those of commercially available radiopharmaceuticals. In conclusion, the {sup 18}F-FDG injection is expected to be useful for further clinical application. (author)
Analysis of the spectrum of four-times-ionized lutetium (Lu V)
International Nuclear Information System (INIS)
Kaufman, V.; Sugar, J.
1978-01-01
Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given
The isolation of lutetium from gadolinium contained in Purex process solutions
International Nuclear Information System (INIS)
Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.
1992-09-01
A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference
Energy Technology Data Exchange (ETDEWEB)
Pujatti, Priscilla Brunelli
2009-07-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of
2010-01-01
... AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE OCEAN AND COASTAL RESOURCE MANAGEMENT NATIONAL... space for individual and population growth and normal behavior of humpback whales, and include sites...
2010-04-01
... testing of explosives detection equipment; or (3) Forensic science purposes; or (b) Was plastic explosive..., projectiles, mines, missiles, rockets, shaped charges, grenades, perforators, and similar devices lawfully...
African Journals Online (AJOL)
Fr. Ikenga
Key words: Arbitration and ADR, Nexus and disparities, Mediation, Juridical nature of ... Settlement of dispute is a universal phenomenon and plays a vital role in ..... Under this theory, the state recognizes that some disputes can be resolved by ...
African Journals Online (AJOL)
shanker
in the media and discussed in social circles in Nigeria, but such reports are rare in the medical literature. ... that the police had succeeded in arresting one of the assailants, who ... and met a group of four young men who offered to take him to a.
African Journals Online (AJOL)
shanker
Although the effect of PNI on long-term outcome in patients with PC has been ... RP or external beam radiotherapy (RT) for localized and low risk. PC [2,3]. ... dle on the side of biopsy detected PNI may decrease the positive surgical margin rate ...
2010-04-01
... EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND CERTAIN... revenue laws: Provided, however, That the disposition of forfeited firearms shall be in conformance with..., shall be subject to seizure and forfeiture under the Customs laws, as provided by the act of August 9...
2010-01-01
... Federal Government procurement contracts and covered nonprocurement transactions. A recipient so prohibited is debarred, in accordance with the Federal Acquisition Regulation for procurement contracts (48...
Energy Technology Data Exchange (ETDEWEB)
Lopez G, H.D
2005-07-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Neutron activation analysis of the rare earth elements in Nasu hot springs
International Nuclear Information System (INIS)
Ikeda, Nagao; Takahashi, Naruto.
1978-01-01
Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.
1995-01-01
The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab
Abe, Kensuke; Ohno, Yusuke; Sassa, Takayuki; Taguchi, Ryo; Çalışkan, Minal; Ober, Carole; Kihara, Akio
2013-12-20
Very long-chain fatty acids (VLCFAs, chain length >C20) exist in tissues throughout the body and are synthesized by repetition of the fatty acid (FA) elongation cycle composed of four successive enzymatic reactions. In mammals, the TER gene is the only gene encoding trans-2-enoyl-CoA reductase, which catalyzes the fourth reaction in the FA elongation cycle. The TER P182L mutation is the pathogenic mutation for nonsyndromic mental retardation. This mutation substitutes a leucine for a proline residue at amino acid 182 in the TER enzyme. Currently, the mechanism by which the TER P182L mutation causes nonsyndromic mental retardation is unknown. To understand the effect of this mutation on the TER enzyme and VLCFA synthesis, we have biochemically characterized the TER P182L mutant enzyme using yeast and mammalian cells transfected with the TER P182L mutant gene and analyzed the FA elongation cycle in the B-lymphoblastoid cell line with the homozygous TER P182L mutation (TER(P182L/P182L) B-lymphoblastoid cell line). We have found that TER P182L mutant enzyme exhibits reduced trans-2-enoyl-CoA reductase activity and protein stability, thereby impairing VLCFA synthesis and, in turn, altering the sphingolipid profile (i.e. decreased level of C24 sphingomyelin and C24 ceramide) in the TER(P182L/P182L) B-lymphoblastoid cell line. We have also found that in addition to the TER enzyme-catalyzed fourth reaction, the third reaction in the FA elongation cycle is affected by the TER P182L mutation. These findings provide new insight into the biochemical defects associated with this genetic mutation.
Growth of large detector crystals. CRADA final report
International Nuclear Information System (INIS)
Boatner, L.A.; Samuelson, S.
1997-01-01
In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications
International Nuclear Information System (INIS)
Seimbille, Yann; Benard, Francois; Rousseau, Jacques; Pepin, Emilie; Aliaga, Antonio; Tessier, Guillaume; Lier, Johan E. van
2004-01-01
Fulvestrant (Faslodex; ICI 182,780) is a pure estrogen receptor (ER) antagonist recently approved for the treatment of hormone-sensitive breast cancer in post-menopausal women with disease progression following antiestrogen therapy. Fulvestrant strongly binds to the ER and its mode of action consists of inhibition of ER dimerization leading to a down regulation of ER protein cellular levels. With the aim to develop a probe for positron emission tomography (PET) imaging capable of predicting the potential therapeutic efficacy of selective ER modulators (SERM), we prepared three new 16α-[ 18 F]fluoro-fulvestrant derivatives. These new radiopharmaceuticals were evaluated for their binding affinity to the human ERα and for their target tissue uptake in immature female rats. Substitution of one of the side-chain F-atoms of fulvestrant for 18 F would have led to a product of low specific activity; instead we selected the 16α-position for 18 F-labeling, which at least in the case of estradiol (ES) is well tolerated by the ER. Radiochemical synthesis proceeds by stereoselective introduction of the [ 18 F]fluoride at the 16- 18 F-position of fulvestrant via opening of an intermediate O-cyclic sulfate followed by hydrolysis of the protecting methoxymethyl (MOM) ether and sulfate groups. Three analogs with different oxidation states of the side chain sulfur, i.e. sulfide, sulfone or sulfoxide (fulvestrant) were prepared. Introduction of the 16 18 F-fluorine led to a dramatic decrease of the apparent binding affinity for ER, as reported by Wakeling et al. (Cancer Res. 1991;51:3867-73). Likewise, in vivo ER-mediated uterus uptake values in immature female rats were disappointing. Overall, our findings suggest that these new PET radiopharmaceuticals are not suitable as tracers to predict ER(+) breast cancer response to hormonal therapy with selective ER modulators
International Nuclear Information System (INIS)
Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.
1991-01-01
Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates
Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent
International Nuclear Information System (INIS)
Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.
2012-01-01
Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.
High pressure and temperature induced structural and elastic properties of lutetium chalcogenides
Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh
2018-04-01
The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.
Kinetic properties of solid yttrium at high temperatures
International Nuclear Information System (INIS)
Ivliev, A.D.
1993-01-01
Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature
International Nuclear Information System (INIS)
Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.
2007-01-01
Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru
Scintillator Evaluation for High-Energy X-Ray Diagnostics
International Nuclear Information System (INIS)
Lutz, S. S.; Baker, S. A.
2001-01-01
This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1
Progress report for the Office of Safeguards and Security for FY 1982
International Nuclear Information System (INIS)
Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.
1982-12-01
Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples
International Nuclear Information System (INIS)
Yamada, Kiyoshi; Brink, I.; Bisse, E.; Epting, T.; Engelhardt, R.
2005-01-01
Using human (SK-MEL 23, SK-MEL 24 and G361) and murine (B16) melanoma cell lines, the coregulatory potential of the uptake of the positron emission tomography (PET) tracer, [Fluorine-18]2-fluoro-2-deoxy-D-glucose (F-18 FDG) has been investigated in relationship to tumor characteristics. Comparative studies among the four melanoma cell lines demonstrated that the lowest FDG uptake in SK-MEL 24 corresponded strongly to the data for DT (population doubling time) and MTT (tetrazolium salt) cell viability as well as hexokinase (HK) activity, but was not related to the glucose transporter 1 (GLUT 1) expression level. Furthermore, the FDG uptake in each melanoma cell line measured by cell cycle kinetics was significantly positively correlated to both the proliferation index (PI=S/G 2 M phase fractions) and the cell viability, though with one exception relating to the proliferation index (PI) of the lowest FDG uptake cell line, SK-MEL 24. No positive correlation was found between the expression of GLUT 1 and FDG uptake in any individual cell line. However, the HK activities in SK-MEL 23 and 24 showed considerable positive relationships with FDG uptake. Our present study suggests that both the proliferation rate and the cell viability of melanoma cells may be key factors for FDG uptake and that HK activity, rather than GLUT 1 expression, seems to be a major factor. (author)
International Nuclear Information System (INIS)
Emken, E.A.; Rohwedder, W.K.; Adlof, R.O.; Rakoff, H.; Gulley, R.M.
1987-01-01
Mixtures of triglycerides containing deuterium-labeled hexadecanoic acid (16:0), octadecanoic acid (18:0), cis-9-octadecenoic acid (9c-18:1), cis-9,cis-12-octadecadienoic acid (9c, 12c-18:2) and cis-12,trans-15-octadecadienoic acid (12c,15t-18:2) were fed to two young-adult males. Plasma lipid classes were isolated from samples collected periodically over 48 hr. Incorporation and turnover of the deuterium-labeled fats in plasma lipids were followed by gas chromatography-mass spectrometry (GC-MS) analysis of the methyl ester derivatives. Absorption of the deuterated fats was followed by GC-MS analysis of chylomicron triglycerides isolated by ultracentrifugation. Results were the following: (i) endogenous fat contributed about 40% of the total fat incorporated into chylomicron triglycerides; (ii) elongation, desaturation and chain-shortened products from the deuterated fats were not detected; (iii) the polyunsaturated isomer 12c,15t-18:2 was metabolically more similar to saturated and 9c-18:1 fatty acids than to 9c,12c-18:2; (iv) relative incorporation of 9c,12c-18:2 into phospholipids did not increase proportionally with an increase of 9c,12c-18:2 in the mixture of deuterated fats fed; (v) absorption of 16:0, 18:0, 9c-18:1, 9c,12c-18:2 and 12c,15t-18:2 were similar; and (vi) data for the 1- and 2-acyl positions of phosphatidylcholine and for cholesteryl ester fractions reflected the known high specificity of phosphatidylcholine acyltransferase and lecithin:cholesteryl acyltransferase for 9c,12c-18:2. These results illustrate that incorporation of dietary fatty acids into human plasma lipid classes is selectively controlled and that incorporation of dietary 9c,12c-18:2 is limited
International Nuclear Information System (INIS)
Mendonca, Renato de
2011-05-01
In. this work a study of the oxidation/corrosion process of three systems of metallic materials by Photoemission Spectroscopy is presented. In the first system, it was investigated the corrosion of Ineonel 182 at simulated Pressurized Water Reactor (PWR) environment. Samples with and without surface chemical treatment were exposed to the simulated environment for until 18 weeks. The oxide layer formed on the surfaces of the samples at different conditions was characterized by Scanning Electron Microscopy and XPS coupled with argon ion sputtering. The comparison between the oxide films grown on the samples showed that the oxide layer formed on the chemically treated sample is thinner and relatively Cr-rich. In second system it was studied the initial oxidation at room temperature of epitaxial films of Fe evapored on Cu (100). The films were deposited with two different thicknesses in order to get tbe fcc Fe (100) and bcc Fe (110) surfaces. The results, obtained by photoemission spectroscopy at the TEMPO beamline of the Synchrotron Soleil, showed the formation of distinct oxides films. The surfaces also presented different kinetics of oxidation and the (110) Fe-bcc showed highest reactivity. The analysis of the data indicated the Fe 1-x O formation on fcc Fe (100) and suggested the Fe 1-x O and FC 3 0 4 formation on (110) Fe-bcc surface. In the last system, it was investigated the initial oxidation of U-Zr-Nb alloys at room temperature. For this experiment, the alloys were exposed to oxygen in ultra high vacuum. The analysis of the U 4f peak showed the fast formation of U) 2 on the surfaces and similar kinetics of oxidation between the U and the U-Zr-Nb alloy. The alloying elements showed slower oxidation. The Zr 3d peak suggested the zr0 2 formation while the Nb 3d peak showed a remarkable enlargement that became necessary a deconvolution which indicated the formation ofNhO , Nb0 2 and N 2 0 5 . (author)
Energy Technology Data Exchange (ETDEWEB)
Seimbille, Yann; Benard, Francois E-mail: francois.benard@USherbrooke.ca; Rousseau, Jacques; Pepin, Emilie; Aliaga, Antonio; Tessier, Guillaume; Lier, Johan E. van
2004-08-01
Fulvestrant (Faslodex; ICI 182,780) is a pure estrogen receptor (ER) antagonist recently approved for the treatment of hormone-sensitive breast cancer in post-menopausal women with disease progression following antiestrogen therapy. Fulvestrant strongly binds to the ER and its mode of action consists of inhibition of ER dimerization leading to a down regulation of ER protein cellular levels. With the aim to develop a probe for positron emission tomography (PET) imaging capable of predicting the potential therapeutic efficacy of selective ER modulators (SERM), we prepared three new 16{alpha}-[{sup 18}F]fluoro-fulvestrant derivatives. These new radiopharmaceuticals were evaluated for their binding affinity to the human ER{alpha} and for their target tissue uptake in immature female rats. Substitution of one of the side-chain F-atoms of fulvestrant for {sup 18}F would have led to a product of low specific activity; instead we selected the 16{alpha}-position for {sup 18}F-labeling, which at least in the case of estradiol (ES) is well tolerated by the ER. Radiochemical synthesis proceeds by stereoselective introduction of the [{sup 18}F]fluoride at the 16-{sup 18}F-position of fulvestrant via opening of an intermediate O-cyclic sulfate followed by hydrolysis of the protecting methoxymethyl (MOM) ether and sulfate groups. Three analogs with different oxidation states of the side chain sulfur, i.e. sulfide, sulfone or sulfoxide (fulvestrant) were prepared. Introduction of the 16{sup 18}F-fluorine led to a dramatic decrease of the apparent binding affinity for ER, as reported by Wakeling et al. (Cancer Res. 1991;51:3867-73). Likewise, in vivo ER-mediated uterus uptake values in immature female rats were disappointing. Overall, our findings suggest that these new PET radiopharmaceuticals are not suitable as tracers to predict ER(+) breast cancer response to hormonal therapy with selective ER modulators.
Translations on Environmental Quality, Number 182
1978-10-17
directors ^ **Zy^™’a r-t^^ SSt°Dl^B d^ CSr : T der^-directors ** ^e Peking general petro-chemical works’ eight plants are graduates of colleges of...ference is attended by delegations from Spain, Morocco , Mauritania, Senegal and Guinea-Bissau, in addition to Portugal. The zone of influence of the...and on the east by the coasts of Portugal, Spain, Morocco , Mauritania, Senegal and Guinea-Bissau. This region also incorpo- rates the Azores
Publications | Page 182 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The World Health Organization (WHO) has recommended that antiretroviral ... of the opposite sex (serodiscordant couples) to reduce the risk of transmission. ... tools to comprehend mobility and are based on Shorrock''s (1978) measures.
46 CFR 201.182 - Improper pressures.
2010-10-01
... to sway the judgment of the Administration by undertaking to bring pressure or influence to bear upon... presiding officer directly or indirectly give statements to the press or radio, by paid advertisements or otherwise, designed to influence the Administration's judgment in the matter. In addition, it is further...
2010-10-01
...) Highly resistant to salt water, petroleum oil, heat, and vibration. (g) If a fixed hand pump is used to... GPM). (b) A portable hand bilge pump must be: (1) Capable of pumping water, but not necessarily..., including wiring, and size and number of batteries, is designed to allow all bilge pumps to be operated...
2010-04-01
... the capital account and constitute additions to the taxpayer's basis in the land. (2) Definition of... or incurred in connection with the production or raising of crops, fruits, or other agricultural products, including fish, or livestock. However, the deduction under section 1202 (relating to the capital...
Fact-Challenged Policy. Policy Memorandum #182
Rothstein, Richard
2011-01-01
This paper is a response on the topic of school reform efforts being promoted by Bill Gates and other prominent education policy advocates. Last week, Microsoft Chairman Bill Gates published an op-ed in the Washington Post, "How Teacher Development could Revolutionize our Schools," proposing that American public schools should do a…
Coho Abundance - Point Features [ds182
California Natural Resource Agency — The CalFish Abundance Database contains a comprehensive collection of anadromous fisheries abundance information. Beginning in 1998, the Pacific States Marine...
Publications | Page 182 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Energy-water nexus in the context of climate change in developing countries : experiences from Latin America, East and Southern Africa; synthesis report (open access). Decentralized renewable energy technologies can help address vulnerability, food security, health, education, and rural-urban migration and resettlement.
Directory of Open Access Journals (Sweden)
F. Dohme-Meier
2012-01-01
Full Text Available An experiment was conducted to compare the effect of the same amount of 18:2 offered either as 18:2n-6 or as a mixture of unprotected 18:2c9t11 and 18:2t10c12 on feed intake, milk components as well as plasma and milk fatty acid profile. Fifteen cows were blocked by milk yield and milk fat percentage and within block assigned randomly to 1 of 3 treatments (n = 5. Each cow passed a 12-d adjustment period (AP on a basal diet. After the AP cows received 1 of 3 supplements during an 18-d experimental period (EP. The supplements contained either 1.0 kg ground sunflower seeds (S, 0.5 kg conjugated linoleic acid (CLA-oil (C or 0.75 kg of a mixture of ground sunflower seeds and CLA-oil (2:1; SC. All 3 supplements contained the same amount of 18:2 either as CLA (∑18:2c9t11+18:2t10c12, 1:1 or as 18:2c9c12. During the last 2 d of AP and the last 4 d of EP feed intake and milk yield were recorded daily and milk samples were collected at each milking. Blood samples were collected from the jugular vein on d 11 of AP and d 15 and 18 of EP. The 18:2 intake increased in all treatments from AP to EP. Regardless of the amount of supplemented CLA, the milk fat percentage decreased by 2.35 and 2.10%-units in treatment C and SC, respectively, whereas in the treatment S the decrease was with 0.99%-unit less pronounced. Thus, C and SC cows excreted daily a lower amount of milk fat than S cows. The concentration of trans 18:1 in the plasma and the milk increased from AP to EP and increased with increasing dietary CLA supply. While the concentration of 18:2c9t11 and 18:2t10c12 in the plasma and that of 18:2t10c12 in the milk paralleled dietary supply, the level of 18:2c9t11 in the milk was similar in C and CS but still lower in S. Although the dietary concentration of CLA was highest in treatment C, the partial replacement of CLA by sunflower seeds had a similar inhibitory effect on milk fat synthesis. Comparable 18:2c9t11 levels in the milk in both CLA treatments
177Lu-DOTA-Bevacizumab: Radioimmunotherapy Agent for Melanoma.
Camacho, Ximena; Calzada, Victoria; Fernandez, Marcelo; Alonso, Omar; Chammas, Roger; Riva, Eloisa; Gambini, Juan Pablo; Cabral, Pablo
2017-01-01
Vascular endothelial growth factor (VEGF) is one of the classic factors to tumor-induced angiogenesis in several types, including melanoma. Bevacizumab is a humanized monoclonal antibody directed against VEGF. To radiolabel Bevacizumab with 177-Lutetium as a potential radioimmunotherapy agent for melanoma. Bevacizumab was derivatized with DOTA-NHS-ester at 4 ºC for 18 h. DOTABevacizumab was radiolabeled with 177LuCl3 (15 MBq/mg) at 37 ºC for 1 h. The studies were performed in healthy and B16F1 tumor-bearing C57BL/6J mice at 24 and 48 h (n = 5). Scinthigraphic imaging studies were performed at 24 h to determine the radiochemical stability, targeting specificity and pharmacokinetics of the 177Lutetium-labeled antibody. DOTA-Bevacizumab was efficiently labeled with 177LuCl3 at 37 °C. The in-vitro stability of labeled product was optimal over 72 h. In-vivo biodistribution studies showed a high liver and tumor uptake of 177Lu-DOTA-Bevacizumab, with tumor-to-muscle ratios of 11.58 and 6.37 at 24 and 48 h p.i. Scintigraphic imaging of melanoma tumor-bearing C57BL/6J mice showed liver and a high tumor selective uptake of 177Lu-DOTA-Bevacizumab at 24 h. Our results support the potential role of 177Lu-DOTA-Bevacizumab as a novel radioimmunotherapy agent for melanoma. We hope that these novel molecular imaging agents will open the path to new diagnostic and therapeutic strategies for Melanoma disease. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Development of Scintillators in Nuclear Medicine
International Nuclear Information System (INIS)
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality
Development of Scintillators in Nuclear Medicine.
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.
Detector for positronium temperature measurements by two-photon angular correlation
Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.
2018-05-01
We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.
4d--4f emission resonances in laser-produced plasmas
International Nuclear Information System (INIS)
O'Sullivan, G.; Carroll, P.K.
1981-01-01
Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element
High spin K isomeric target of 177mLu
International Nuclear Information System (INIS)
Roig, O.; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D.
2004-01-01
The techniques used to produce a 177m Lu (J π =23/2 - ,T 1/2 =160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of 176 Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the 177m Lu isomer by the 176 Lu(n,γ) reaction. Finally, a chemical separation was performed to extract 10 13 nuclei of 177m Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the 177m Lu
Schilling, Kathy; Narayanan, Deepa; Kalinyak, Judith E; The, Juliette; Velasquez, Maria Victoria; Kahn, Simone; Saady, Matthew; Mahal, Ravinder; Chrystal, Larraine
2011-01-01
The objective of this study was to compare the performance characteristics of (18)F-fluorodeoxyglucose (FDG) positron emission mammography (PEM) with breast magnetic resonance imaging (MRI) as a presurgical imaging and planning option for index and ipsilateral lesions in patients with newly diagnosed, biopsy-proven breast cancer. Two hundred and eight women >25 years of age (median age = 59.7 ± 14.1 years) with biopsy-proven primary breast cancer enrolled in this prospective, single-site study. MRI, PEM, and whole-body positron emission tomography (WBPET) were conducted on each patient within 7 business days. PEM and WBPET images were acquired on the same day after intravenous administration of 370 MBq of FDG (median = 432.9 MBq). PEM and MRI images were blindly evaluated, compared with final surgical histopathology, and the sensitivity determined. Substudy analysis compared the sensitivity of PEM versus MRI in patients with different menopausal status, breast density, and use of hormone replacement therapy (HRT) as well as determination of performance characteristics for additional ipsilateral lesion detection. Two hundred and eight patients enrolled in the study of which 87% (182/208) were analyzable. Of these analyzable patients, 26.4% (48/182), 7.1% (13/182), and 64.2% (120/182) were pre-, peri-, and postmenopausal, respectively, and 48.4% (88/182) had extremely or heterogeneously dense breast tissue, while 33.5% (61/182) had a history of HRT use. Ninety-two percent (167/182) underwent core biopsy for index lesion diagnosis. Invasive cancer was found in 77.5% (141/182), while ductal carcinoma in situ (DCIS) and/or Paget's disease were found in 22.5% (41/182) of patients. Both PEM and MRI had index lesion depiction sensitivity of 92.8% and both were significantly better than WBPET (67.9%, p performance characteristics are not affected by patient menopausal/hormonal status or breast density.
Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals
International Nuclear Information System (INIS)
Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki
2013-01-01
177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)
Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride
Czech Academy of Sciences Publication Activity Database
Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.
2012-01-01
Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012
Leya, Ingo; Wieler, Rainer; Halliday, Alex N.
2000-01-01
Excesses and deficiencies in 182W in meteorites and lunar samples relative to the terrestrial 182W atomic abundance have been assigned to the decay of 182Hf (t1/2=9 Ma) and have been used to date metal-silicate fractionation events in the early solar system. Because the effects are very small, production and burn-out of tungsten isotopes by cosmic ray interactions are a concern in such studies. Masarik [J. Masarik, Contribution of neutron-capture reactions to observed tungsten isotopic ratios, Earth Planet. Sci. Lett. 152 (1997) 181-185] showed that neutron-capture reactions on tungsten isotopes can account at best for a minor part of the observed deficit of 182W in Toluca and other iron meteorites. On the other hand, in lunar samples and stony meteorites the production of 182W from 181Ta may become crucial. Here, we calculate this contribution as well as production and consumption of 182-186W by other neutron-induced reactions. The neutron fluence of each sample is estimated by its nominal cosmic-ray exposure age deduced from noble gas data. This approach overestimates the true cosmogenic W isotopic shifts for samples that might have been irradiated very close to the regolith surface. A quantitative estimate is often also hampered by a lack of Ta data. Despite these reservations, it appears that in many lunar samples neutron-capture on Ta has caused a large part of the observed 182W excess. On the other hand, in some samples, especially those with very low exposure ages, clearly only a minor or even negligible fraction of the 182W excess can be cosmogenic. Therefore, the conclusion, based on Hf-W model ages, that the Moon formed 50 Myr after the start of the solar system remains valid. Martian meteorites have lower Ta/W ratios and cosmic ray exposure ages than most lunar samples. Therefore, cosmogenic production has not significantly altered the W isotopic composition in Martian meteorites. Observed 182W excesses in Martian meteorites as well as the very large
Shibamoto, Shigeaki; Gooley, Andrew; Yamamoto, Kouhei
2015-01-01
Using a strongly polar cyanopropyl capillary column we have investigated the gas chromatography (GC) separation behaviors of 24 octadecadienoic acid methyl ester (18:2ME) isomers compared against saturated methyl stearate (18:0ME) and arachidic acid methyl ester (20:0ME), and the dependency on the GC column temperature. The 24 isomers were obtained by performing cis-to trans-isomerization of six regioisomers: five of the 18:2ME isomers were prepared by the partial reduction of methyl α-linolenate and methyl γ-linolenate C18 trienoic acids with different double bond positions, whereas the sixth isomer, 18:2ME (c5, c9), was obtained from a raw constituent fatty acid methyl ester (FAME) sample extracted from Japanese yew seeds. There are no reference standards commercially available for 18:2ME isomers, and in elucidating the elution order of these isomers this study should help the future identification of cis- and trans-type of 18:2ME. We also report the identification method of cis- and trans-type of FAME using equivalent chain lengths and attempt the identification of cis- and trans-type of 18:2ME isomers from partially hydrogenated canola oil.
In Vivo Measurement and Characterization of a Novel Formulation of [177Lu]-DOTA-Octreotate
Directory of Open Access Journals (Sweden)
Dale Bailey
2016-01-01
Full Text Available Objective(s:Lutetium-177 can be made with high specific activity and with no other isotopes of lutetium present, referred to as “No Carrier Added” (NCA 177Lu. We have radiolabelled DOTA-conjugated peptide DOTA‐(Tyr3‐octreotate with NCA 177Lu (“NCA-LuTATE” and used it in nearly 40 therapeutic administrations for subjects with neuroendocrine tumours or meningiomas. In this paper, we report on our initial studies on aspects of the biodistribution and dosimetry of NCA-LuTATE from gamma camera 2D whole body (WB and quantitative 3D SPECT (qSPECT 177Lu imaging. Methods: Thirteen patients received 39 NCA-LuTATE injections. Extensive WB planar and qSPECT imaging was acquired at approximately 0.5, 4, 24 and 96 h to permit estimates of clearance and radiation dose estimation using MIRD-based methodology (OLINDA-EXM. Results:The average amount of NCA-Lutate administered per cycle was 7839±520 MBq. Bi-exponential modelling of whole body clearance showed half lives for the fast & slow components of t½=2.1±0.6 h and t½=58.1±6.6 h respectively. The average effective dose to kidneys was 3.1±1.0 Gy per cycle. In eight patients completing all treatment cycles the average total dose to kidneys was 11.7±3.6 Gy. Conclusions: We have shown that NCA-LuTATE has an acceptable radiation safety profile and is a suitable alternative to Carrier-Added 177Lu formulations. The fast component of the radiopharmaceutical clearance was closely correlated with baseline renal glomerular filtration rate, and this had an impact on radiation dose to the kidneys. In addition, it has less radioactive waste issues and requires less peptide per treatment.
Energy Technology Data Exchange (ETDEWEB)
Rogalev, A. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Goulon, J. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France)], E-mail: goulon@esrf.fr; Wilhelm, F. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Brouder, Ch. [Institut de Mineralogie et de Physique des Milieux Condenses, UMR-CNRS 7590, Universite Paris VI-VII, 4 place Jussieu, F-75252 Paris Cedex 05 (France); Yaresko, A. [Max Planck Institute for Solid State Research, Heisenbergstrasse 1, 70569 Stuttgart (Germany); Ben Youssef, J.; Indenbom, M.V. [Laboratoire de Magnetisme de Bretagne, CNRS FRE 2697, UFR Sciences et Techniques, F-29328 Brest Cedex (France)
2009-12-15
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M{sub 1}-edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {l_brace}Y, Bi{r_brace}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
International Nuclear Information System (INIS)
Rogalev, A.; Goulon, J.; Wilhelm, F.; Brouder, Ch.; Yaresko, A.; Ben Youssef, J.; Indenbom, M.V.
2009-01-01
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M 1 -edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {Y, Bi}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
Resilience of small intestinal beneficial bacteria to the toxicity of soybean oil fatty acids
Di Rienzi, Sara C; Jacobson, Juliet; Kennedy, Elizabeth A; Bell, Mary E; Shi, Qiaojuan; Waters, Jillian L; Lawrence, Peter; Brenna, J Thomas; Britton, Robert A; Walter, Jens
2018-01-01
Over the past century, soybean oil (SBO) consumption in the United States increased dramatically. The main SBO fatty acid, linoleic acid (18:2), inhibits in vitro the growth of lactobacilli, beneficial members of the small intestinal microbiota. Human-associated lactobacilli have declined in prevalence in Western microbiomes, but how dietary changes may have impacted their ecology is unclear. Here, we compared the in vitro and in vivo effects of 18:2 on Lactobacillus reuteri and L. johnsonii. Directed evolution in vitro in both species led to strong 18:2 resistance with mutations in genes for lipid biosynthesis, acid stress, and the cell membrane or wall. Small-intestinal Lactobacillus populations in mice were unaffected by chronic and acute 18:2 exposure, yet harbored both 18:2- sensitive and resistant strains. This work shows that extant small intestinal lactobacilli are protected from toxic dietary components via the gut environment as well as their own capacity to evolve resistance. PMID:29580380
Measurement of multilayer mirror reflectivity and stimulated emission in the XUV spectral region
International Nuclear Information System (INIS)
Keane, C.; Nam, C.H.; Meixler, L.; Milchberg, H.; Skinner, C.H.; Suckewer, S.; Voorhees, D.; Barbee, T.
1986-03-01
We present measurements of multilayer mirror reflectivity and stimulated emission in the XUV spectral region. A molybdenum-silicon multilayer mirror with 12% measured reflectivity at 182 A was found to produce a 120% enhancement of the C VI 182 A line (3 → 2 transition) in a strongly recombining plasma. No such enhancement of the CV 186.7 A line was seen, demonstrating amplification of stimulated emission at 182 A
Sehat, N; Rickert, R; Mossoba, M M; Kramer, J K; Yurawecz, M P; Roach, J A; Adlof, R O; Morehouse, K M; Fritsche, J; Eulitz, K D; Steinhart, H; Ku, Y
1999-04-01
Operating from one to six silver ion-high-performance liquid chromatography (Ag+-HPLC) columns in series progressively improved the resolution of the methyl esters of conjugated linoleic acid (CLA) isomeric mixtures from natural and commercial products. In natural products, the 8 trans, 10 cis-octadecadienoic (18:2) acid was resolved from the more abundant 7 trans, 9 cis-18:2, and the 10 trans, 12 cis-18:2 was separated from the major 9 cis, 11 trans-18:2 peak. In addition, both 11 trans, 13 cis-18:2 and 11 cis, 13 trans-18:2 isomers were found in natural products and were separated; the presence of the latter, 11 cis, 13 trans-18:2, was established in commercial CLA preparations. Three Ag+-HPLC columns in series appeared to be the best compromise to obtain satisfactory resolution of most CLA isomers found in natural products. A single Ag+-HPLC column in series with one of several normal-phase columns did not improve the resolution of CLA isomers as compared to that of the former alone. The 20:2 conjugated fatty acid isomers 11 cis, 13 trans-20:2 and 12 trans, 14 cis-20:2, which were synthesized by alkali isomerization from 11 cis, 14 cis-20:2, eluted in the same region of the Ag+-HPLC chromatogram just before the corresponding geometric CLA isomers. Therefore, CLA isomers will require isolation based on chain length prior to Ag+-HPLC separation. The positions of conjugated double bonds in 20:2 and 18:2 isomers were established by gas chromatography-electron ionization mass spectrometry as their 4,4-dimethyloxazoline derivatives. The double-bond geometry was determined by gas chromatography-direct deposition-Fourier transform infrared spectroscopy and by the Ag+-HPLC relative elution order.
Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry
Directory of Open Access Journals (Sweden)
Jarrett A. Moyer
2014-01-01
Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.
Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R
2005-12-08
We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.
Transparent Ceramic Scintillator Fabrication, Properties and Applications
International Nuclear Information System (INIS)
Cherepy, N.J.; Kuntz, J.D.; Roberts, J.J.; Hurst, T.A.; Drury, O.B.; Sanner, R.D.; Tillotson, T.M.; Payne, S.A.
2008-01-01
Transparent ceramics offer an alternative to single crystals for scintillator applications such as gamma ray spectroscopy and radiography. We have developed a versatile, scaleable fabrication method, using Flame Spray Pyrolysis (FSP) to produce feedstock which is readily converted into phase-pure transparent ceramics. We measure integral light yields in excess of 80,000 Ph/MeV with Cerium-doped Garnets, and excellent optical quality. Avalanche photodiode readout of Garnets provides resolution near 6%. For radiography applications, Lutetium Oxide offers a high performance metric and is formable by ceramics processing. Scatter in transparent ceramics due to secondary phases is the principal limitation to optical quality, and afterglow issues that affect the scintillation performance are presently being addressed
International Nuclear Information System (INIS)
Syed Ali Raza Naqvi; Rashid Rasheed; Muhammad Tauqeer Ahmed; Ameer Fawad Zahoor
2017-01-01
Sulfadiazine acts through inhibition of bacterial dihydropteroate synthetase. The radio-labeling of sulfadiazine with lutetium-177 ( 177 Lu) is expected to serve as a theranostic agent for deep-seated bacterial infections. The radiosynthesis of 177 Lu-sulfadiazine indicated a > 95% yield under optimized reaction conditions, and promising stability was found in blood serum. Biodistribution data in the absence of infection revealed minimal accumulation in key body organs. Kidneys were the main excretory organs, showed an uptake of 1.76 ± 0.09% ID/g organ at 6-h post-injection. Biodistribution, scintigraphic data, glomerular filtration rate, and cytotoxicity results encourage clinical investigation of 177 Lu-sulfadiazine as a novel theranostic agent for deep-seated bacterial infection. (author)
High spin K isomeric target of {sup 177m}Lu
Energy Technology Data Exchange (ETDEWEB)
Roig, O. E-mail: olivier.roig@cea.fr; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D
2004-03-21
The techniques used to produce a {sup 177m}Lu (J{sup {pi}}=23/2{sup -},T{sub 1/2}=160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of {sup 176}Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the {sup 177m}Lu isomer by the {sup 176}Lu(n,{gamma}) reaction. Finally, a chemical separation was performed to extract 10{sup 13} nuclei of {sup 177m}Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the {sup 177m}Lu.
Search Results | Page 182 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
A growing number of studies indicate the potentially devastating impact of ... examine the impact of foreign direct investment (FDI) on economic efficiency, ... The globalization of the tobacco industry is a major threat to public health worldwide.
27 CFR 18.2 - Applicability of law.
2010-04-01
... concentrate is transferred to a bonded wine cellar for use in the production of natural wine; and (c) The... the production, removal, sale, transportation, and use of concentrate, and of the mash or juice from...
46 CFR 182.440 - Independent fuel tanks.
2010-10-01
... for “Manufacturer's Standard Gage” for sheet steel thickness. 2 Tanks over 1514 liters (400 gallons... meters (11.5 feet) in height attached to the tank may be filled with water to accomplish the 35 kPa (5....330. (d) Alternative procedures. A vessel of not more than 19.8 meters (65 feet) in length carrying...
Acylation and metabolism of (n-6) fatty acids in hepatocytes
International Nuclear Information System (INIS)
Voss, A.C.; Sprecher, H.
1986-01-01
Isolated hepatocytes (5 x 10 6 in 2ml) from chow fed rats were incubated from 20 to 60 min. with increasing concentrations of [1- 14 C] labeled 18:2 (n-6), 18:3 (n-6) or 20:3 (n-6) to define optimum conditions for measuring acylation and metabolism to other (n-6) acids with subsequent incorporation into lipids. The triglycerides (TG) and phospholipids (PL) contained 157 and 80 nmols of 18:2 (n-6) and 6.0 and 6.1 nmols of other (n-6) acids, respectively, when cells were incubated with 0.3mM [1- 14 C] 18:2 (n-6) for 40 min. When cells were incubated with 0.3mM [1- 14 C] 18:2 (n-6) plus 0.15 to 0.45mM 18:3 (n-6) or 20:3 (n-6), the metabolism of 18:2 (n-6) to other (n-6) acids was inhibited but not totally abolished. These results may suggest that (n-6) acid made from linoleate do not totally equilibrate with exogenous 18:3 (n-6) or 20:3
100-N Area underground storage tank closures
Energy Technology Data Exchange (ETDEWEB)
Rowley, C.A.
1993-08-01
This report describes the removal/characterization actions concerning underground storage tanks (UST) at the 100-N Area. Included are 105-N-LFT, 182-N-1-DT, 182-N-2-DT, 182-N-3-DT, 100-N-SS-27, and 100-N-SS-28. The text of this report gives a summary of remedial activities. In addition, correspondence relating to UST closures can be found in Appendix B. Appendix C contains copies of Unusual Occurrence Reports, and validated sampling data results comprise Appendix D.
100-N Area underground storage tank closures
International Nuclear Information System (INIS)
Rowley, C.A.
1993-01-01
This report describes the removal/characterization actions concerning underground storage tanks (UST) at the 100-N Area. Included are 105-N-LFT, 182-N-1-DT, 182-N-2-DT, 182-N-3-DT, 100-N-SS-27, and 100-N-SS-28. The text of this report gives a summary of remedial activities. In addition, correspondence relating to UST closures can be found in Appendix B. Appendix C contains copies of Unusual Occurrence Reports, and validated sampling data results comprise Appendix D
Alterations of serum levels of BDNF-related miRNAs in patients with depression.
Directory of Open Access Journals (Sweden)
You-Jie Li
Full Text Available Depression is a serious and potentially life-threatening mental disorder with unknown etiology. Emerging evidence shows that brain-derived neurotrophic factor (BDNF and microRNAs (miRNAs play critical roles in the etiology of depression. Here this study was aimed to identify and characterize the roles of BDNF and its putative regulatory miRNAs in depression. First, we identified that miR-182 may be a putative miRNA that regulates BDNF levels by bioinformatic studies, and characterized the effects of miR-182 on the BDNF levels using cell-based studies, side by side with miR-132 (a known miRNA that regulates BDNF expression. We showed that treatment of miR-132 and miR-182 respectively decreased the BDNF protein levels in a human neuronal cell model, supporting the regulatory roles of miR-132 and miR-182 on the BDNF expression. Furthermore, we explored the roles of miR-132 and miR-182 on the BDNF levels in depression using human subjects by assessing their serum levels. Compared with the healthy controls, patients with depression showed lower serum BDNF levels (via the enzyme-linked immunosorbent assays and higher serum miR-132 and miR-182 levels (via the real-time PCR. Finally, the Pearson's (or Spearman's correlation coefficient was calculated to study whether there was a relationship among the Self-Rating Depression Scale score, the serum BDNF levels, and serum BDNF-related miRNA levels. Our results revealed that there was a significant negative correlation between the SDS scores and the serum BDNF levels, and a positive correlation between the SDS scores and miR-132 levels. In addition, we found a reverse relationship between the serum BDNF levels and the miR-132/miR-182 levels in depression. Collectively, we provided evidence supporting that miR-182 is a putative BDNF-regulatory miRNA, and suggested that the serum BDNF and its related miRNAs may be utilized as important biomarkers in the diagnosis or as therapeutic targets of depression.
Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets
International Nuclear Information System (INIS)
Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.
2005-01-01
Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed
The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes
International Nuclear Information System (INIS)
Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.
1981-01-01
The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)
Compartmental analysis to predict biodistribution in radiopharmaceutical design studies
Energy Technology Data Exchange (ETDEWEB)
Lima, Marina F.; Pujatti, Priscilla B.; Araujo, Elaine B.; Mesquita, Carlos H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)], e-mail: mflima@ipen.br
2009-07-01
The use of compartmental analysis allows the mathematical separation of tissues and organs to determinate the concentration of activity in each fraction of interest. Although the radiochemical purity must observe Pharmacopoeia specification (values upper 95%), very lower contains of free radionuclides could contribute significantly as dose in the neighborhood organs and make tumor up take studies not viable in case of radiopharmaceutical on the basis of labeled peptides. Animal studies with a product of Lutetium-177 labeled Bombesin derivative ({sup 177}Lu-BBNP) developed in IPEN-CNEN/SP and free Lutetium-177 developed in CNEA/EZEIZA was used to show how subtract free {sup 177}Lu contribution over {sup 177}Lu-BBNP to estimate the radiopharmaceutical potential as diagnosis or therapy agent. The first approach of the studies included the knowledge of chemical kinetics and mimetism of the Lutetium and the possible targets of the diagnosis/therapy to choose the possible models to apply over the sampling standard methods used in experimental works. A model with only one physical compartment (whole body) and one chemical compartment ({sup 177}Lu-BBNP) generated with the compartmental analysis protocol ANACOMP showed high differences between experimental and theoretical values over 2.5 hours, in spite of the concentration of activity had been in a good statistics rang of measurement. The values used in this work were residence time from three different kinds of study with free {sup 177}Lu: whole body, average excretion and maximum excretion as a chemical compartment. Activity concentration values as time function in measurements of total whole body and activity measurement in samples of blood with projection to total circulating blood volume with {sup 177}Lu-BBNP. Considering the two sources of data in the same modeling a better consistence was obtained. The next step was the statistic treatment of biodistribution and dosimetry in mice (Balb C) considering three chemical
Age determination of meteorites using radioactive nuclides
International Nuclear Information System (INIS)
Tanimizu, Masaharu
2002-01-01
Recently, the precise isotope ratios of some refractory elements in meteorites have been reported using inductively coupled plasma mass spectrometry. The in situ decay of 182 Hf (T 1/2 =9 Myr), which was produced at the latest nucleosynthesis, is recognized in many meteorites as isotopic anomalies of its daughter isotope, 182 W. The degrees of relative 182 W isotopic deviation in extra-terrestrial and terrestrial silicate samples vary from +0.3% to ±0% related to the size of their parent bodies. One ready interpretation of its correlation is the difference in timing of metal-silicate separation in the parent bodies. Between the earth and meteorite parent bodies, the difference is calculated to be about four times of the half-life of 182 Hf, equivalent to 36 Myr. (author)
New insight into transcription of human endogenous retroviral elements
Czech Academy of Sciences Publication Activity Database
Pačes, Jan; Huang, Y.T.; Pačes, Václav; Rídl, Jakub; Chang, C.M.
2013-01-01
Roč. 30, č. 3 (2013), s. 314-318 ISSN 1871-6784 R&D Projects: GA ČR GCP305/10/J052 Grant - others:Chang Gung Memorial Hospital(TW) CMRPD170233; NSCNHRI Taiwan(TW) NSC 97-2314-B-182-001-MY2; NSCNHRI Taiwan(TW) NSC 99-2314-B-182-024-MY3; NSCNHRI Taiwan(TW) NSC 99-2923-B-182-001-MY3 Institutional support: RVO:68378050 Keywords : HERV * transcription * tissue-specific Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.106, year: 2013
Electro-kinetic separation of rare earth elements using a redox-active ligand
Energy Technology Data Exchange (ETDEWEB)
Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)
2017-10-16
Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Simultaneous molecular and anatomical imaging of the mouse in vivo
International Nuclear Information System (INIS)
Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R
2002-01-01
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice
Simultaneous molecular and anatomical imaging of the mouse in vivo
Energy Technology Data Exchange (ETDEWEB)
Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)
2002-12-21
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.
Single crystalline LuAG fibers for homogeneous dual-readout calorimeters
International Nuclear Information System (INIS)
Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G
2013-01-01
For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m
Design and development of 1 mm resolution PET detectors with position-sensitive PMTs
Shao, Y; Chatziioannou, A F
2002-01-01
We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.
International Nuclear Information System (INIS)
Bodryakov, V.Yu.; Povzner, A.A.
2000-01-01
The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru
Duration of a Magma Ocean and Subsequent Mantle Overturn in Mars: Evidence from Nakhlites
Debaille, V.; Brandon, A. D.; Yin, Q.-Z.; Jacobsen, B.
2008-01-01
It is now generally accepted that the heat produced by accretion, short-lived radioactive elements such as Al-26, and gravitational energy from core formation was sufficient to at least partially melt the silicate portions of terrestrial planets resulting in a global-scale magma ocean. More particularly, in Mars, the geochemical signatures displayed by shergottites, are likely inherited from the crystallization of this magma ocean. Using the short-lived chronometer Sm-146 - Nd-142 (t(sup 1/2) = 103 Myr), the duration of the Martian magma ocean (MMO) has been evaluated to being less than 40 Myr, while recent and more precise ND-142/ND-144 data were used to evaluate the longevity of the MMO to approximately 100 Myr after the solar system formation. In addition, it has been proposed that the end of the crystallization of the MMO may have triggered a mantle overturn, as a result of a density gradient in the cumulate layers crystallized at different levels. Dating the mantle overturn could hence provide additional constraint on the duration of the MMO. Among SNC meteorites, nakhlites are characterized by high epsilon W-182 of approximately +3 and an epsilon Nd-142 similar to depleted shergottites of +0.6-0.9. It has hence been proposed that the source of nakhlites was established very early in Mars history (approximately 8-10 Myr). However, the times recorded in HF-182-W-182 isotope system, i.e. when 182Hf became effectively extinct (approximately 50 Myr after solar system formation) are less than closure times recorded in the Sm-146-Nd-142 isotope system (with a full coverage of approximately 500 Myr after solar system formation). This could result in decoupling between the present-day measured epsilon W-182 and epsilon Nd-142 as the SM-146 may have recorded later differentiation events in epsilon ND-142 not observed in epsilon W-182 values. With these potential complexities in short-lived chronological data for SNC's in mind, new Hf-176/Hf-177, Nd-143/Nd-144 and Nd
Energy Technology Data Exchange (ETDEWEB)
Burkhardt, Christoph; Wieler, Rainer [Institute of Geochemistry and Petrology, Clausiusstrasse 25, ETH Zurich, CH-8092 Zurich (Switzerland); Kleine, Thorsten [Institut fuer Planetologie, Westfaelische Wilhelms-Universitaet Muenster, Wilhelm-Klemm-Strasse 10, D-48149 Muenster (Germany); Dauphas, Nicolas, E-mail: burkhardt@erdw.ethz.ch [Origins Laboratory, Department of the Geophysical Sciences and Enrico Fermi Institute, University of Chicago, 5734 South Ellis Avenue, Chicago, IL 60637 (United States)
2012-07-01
Progressive dissolution of the Murchison carbonaceous chondrite with acids of increasing strengths reveals large internal W isotope variations that reflect a heterogeneous distribution of s- and r-process W isotopes among the components of primitive chondrites. At least two distinct carriers of nucleosynthetic W isotope anomalies must be present, which were produced in different nucleosynthetic environments. The co-variation of {sup 182}W/{sup 184}W and {sup 183}W/{sup 184}W in the leachates follows a linear trend that is consistent with a mixing line between terrestrial W and a presumed s-process-enriched component. The composition of the s-enriched component agrees reasonably well with that predicted by the stellar model of s-process nucleosynthesis. The co-variation of {sup 182}W/{sup 184}W and {sup 183}W/{sup 184}W in the leachates provides a means for correcting the measured {sup 182}W/{sup 184}W and {sup 182}W/{sup 183}W of Ca-Al-rich inclusions (CAI) for nucleosynthetic anomalies using the isotopic variations in {sup 183}W/{sup 184}W. This new correction procedure is different from that used previously, and results in a downward shift of the initial {epsilon}{sup 182}W of CAI to -3.51 {+-} 0.10 (where {epsilon}{sup 182}W is the variation in 0.01% of the {sup 182}W/{sup 183}W ratio relative to Earth's mantle). This revision leads to Hf-W model ages of core formation in iron meteorite parent bodies that are {approx}2 Myr younger than previously calculated. The revised Hf-W model ages are consistent with CAI being the oldest solids formed in the solar system, and indicate that core formation in some planetesimals occurred within {approx}2 Myr of the beginning of the solar system.
Separace, detekce a identifikace mikroorganismů pomocí kapilárních elektroforetických technik
Czech Academy of Sciences Publication Activity Database
Horká, Marie; Šalplachta, Jiří; Roth, Michal
2014-01-01
Roč. 93, č. 3 (2014), s. 182-182 ISSN 0042-4544 R&D Projects: GA MV VG20102015023; GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : capillary isoelectric focusing * microorganisms * bacteria * electrophoretic techniques Subject RIV: CB - Analytical Chemistry, Separation
NCBI nr-aa BLAST: CBRC-TTRU-01-0583 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0583 ref|ZP_04742692.1| ABC transporter, permease protein [Roseburia i...ntestinalis L1-82] gb|EEV02164.1| ABC transporter, permease protein [Roseburia intestinalis L1-82] ZP_04742692.1 0.17 28% ...
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... pir||T22111 hypothetical protein F42G4.3a - ... Caenorhabditis elegans ... Length = 182 ... Query: 1 ... MNQIFHVDC...FKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACG 60 ... MNQIFHVDC...FKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACG Sbjct: 18 ... MNQIFHVDCFKCGQCSKTLAGASFYN...IDDKPTCEGCYQNSLEKCTACNRAISDKLLRACG 77 ... Query: 121 VRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTC 165 ... VRVVAMDKSFHVDC...YKCEDCGMQLSSKLEGQGCYPIDNHLLCKTC Sbjct: 138 VRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTC 182
Health Status and Psychological Distress in Patients with Non-compaction Cardiomyopathy
DEFF Research Database (Denmark)
Brouwers, Corline; Caliskan, Kadir; Bos, Sven
2015-01-01
patients and 42 DCM patients. Outcome measures were health status (Short Form Health Survey-12), anxiety (Generalized Anxiety Disorder 7-item scale) and depression (Patient Health Questionnaire 9-item scale). RESULTS: NCCM patients showed significantly worse health status (Physical Component Score F(1...... from DCM patients (Physical Component Score F(1,82) = 2,61, P = .11; Mental Component Score F(1,82) = .55, P = .46), anxiety (F(1,82) = 1.16, P = .28) and depression scores (F(1,82) = 1,95, P = .17). CONCLUSION: Cardiac symptoms are likely to play a role in the observed poor health status and elevated......BACKGROUND: Non-compaction cardiomyopathy (NCCM) is a cardiomyopathy characterized by left ventricular tribeculae and deep intertrabecular recesses. Because of its genetic underpinnings and physical disease burden, noncompaction cardiomyopathy is expected to be associated with a lower health status...
Gender wage gap and segregation in late transition
Czech Academy of Sciences Publication Activity Database
Jurajda, Štěpán
č. 182 (2001), s. 1-32 ISSN 1211-3298 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : transition * gender wage gap Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp182.pdf
NCBI nr-aa BLAST: CBRC-TTRU-01-0889 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0889 ref|ZP_04743451.1| iron compound ABC transporter, permease protein [Roseburi...a intestinalis L1-82] gb|EEV01396.1| iron compound ABC transporter, permease protein [Roseburia intestinalis L1-82] ZP_04743451.1 0.10 26% ...
International Nuclear Information System (INIS)
Schilling, Kathy; The, Juliette; Velasquez, Maria Victoria; Kahn, Simone; Saady, Matthew; Mahal, Ravinder; Chrystal, Larraine; Narayanan, Deepa; Kalinyak, Judith E.
2011-01-01
The objective of this study was to compare the performance characteristics of 18 F-fluorodeoxyglucose (FDG) positron emission mammography (PEM) with breast magnetic resonance imaging (MRI) as a presurgical imaging and planning option for index and ipsilateral lesions in patients with newly diagnosed, biopsy-proven breast cancer. Two hundred and eight women >25 years of age (median age = 59.7 ± 14.1 years) with biopsy-proven primary breast cancer enrolled in this prospective, single-site study. MRI, PEM, and whole-body positron emission tomography (WBPET) were conducted on each patient within 7 business days. PEM and WBPET images were acquired on the same day after intravenous administration of 370 MBq of FDG (median = 432.9 MBq). PEM and MRI images were blindly evaluated, compared with final surgical histopathology, and the sensitivity determined. Substudy analysis compared the sensitivity of PEM versus MRI in patients with different menopausal status, breast density, and use of hormone replacement therapy (HRT) as well as determination of performance characteristics for additional ipsilateral lesion detection. Two hundred and eight patients enrolled in the study of which 87% (182/208) were analyzable. Of these analyzable patients, 26.4% (48/182), 7.1% (13/182), and 64.2% (120/182) were pre-, peri-, and postmenopausal, respectively, and 48.4% (88/182) had extremely or heterogeneously dense breast tissue, while 33.5% (61/182) had a history of HRT use. Ninety-two percent (167/182) underwent core biopsy for index lesion diagnosis. Invasive cancer was found in 77.5% (141/182), while ductal carcinoma in situ (DCIS) and/or Paget's disease were found in 22.5% (41/182) of patients. Both PEM and MRI had index lesion depiction sensitivity of 92.8% and both were significantly better than WBPET (67.9%, p < 0.001, McNemar's test). For index lesions, PEM and MRI had equivalent sensitivity of various tumors, categorized by tumor stage as well as similar invasive tumor size
Final Report: Scintillator Materials for Medical Applications, December 1, 1997 - November 30, 1999
International Nuclear Information System (INIS)
Lempicki, A.; Brecher, C.; Wojtowicz, A.J.; Szupryczynski, P.
2000-01-01
From the very beginning of our program we regarded the understanding of the scintillation mechanism as our primary mission. If in addition this understanding could lead to the discovery of a new material, so much the better. When we began this work some nine years ago, the theoretical basis for the scintillation phenomenon was in disarray. The initial and final steps were reasonably well characterized, but there was no consensus on the crucial intermediate, the transfer of energy from the lattice to the emitting center. In the over 40 publications that resulted from this program, we demonstrated that despite the highly insulating nature of the hosts and the great magnitude of the band gap, the primary means of transport is through mobile charge carriers and their sequential capture by the emitting center. Although radical at the time, this picture is now generally accepted throughout the field. Subsequently, we also recognized the critical role that trapping centers localized at lattice defects can play in the process, not merely as passive sources of loss but as active participants in the kinetics. In this sense shallow traps can wreak more havoc than deep ones, impeding the rate by which carriers can reach the emitting centers and seriously slowing the resulting decay. And we established low-temperature thermoluminescence as a comprehensive tool for quantizing these effects. As for new and better materials, our work also had an impact. We were among the first to recognize the potential of LuAlO 3 (lutetium aluminum perovskite, or LuAP) as a detector for PET applications. Although this material has not supplanted LuSiO 5 (lutetium oxysilicate, or LSO) in terms of light output or absence of afterglow, LuAP still exhibits by far the highest figure of merit (light output divided by decay time) of any scintillator material currently known. Our work has also bought into stark view the dismaying realization of just how improbable it is that a material will ever be found
Separation device of radio lanthanides (DISER)
International Nuclear Information System (INIS)
Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.
2008-01-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and
Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)
Energy Technology Data Exchange (ETDEWEB)
Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com
2008-07-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166
Zhang, Jingjing; Wang, Hao; Jacobson Weiss, Orit; Cheng, Yuejuan; Niu, Gang; Li, Fang; Bai, Chunmei; Zhu, Zhaohui; Chen, Xiaoyuan
2018-04-13
Radiolabeled somatostatin analogue therapy has become an established treatment method for patients with well to moderately differentiated unresectable or metastatic neuroendocrine tumors (NETs). The most frequently used somatostatin analogues in clinical practice are octreotide and octreotate. However, both peptides showed suboptimal retention within tumors. The aim of this first-in-human study is to explore the safety and dosimetry of a long-acting radiolabeled somatostatin analogue, lutetium-177-1, 4, 7, 10-tetra-azacyclododecane-1, 4, 7, 10-tetraacetic acid-Evans blue-octreotate ( 177 Lu-DOTA-EB-TATE). Methods: Eight patients (6 males and 2 females; age range, 27-61 y) with advanced metastatic neuroendocrine tumors were recruited. Five patients received a single dose 0.35-0.70 GBq (9.5-18.9 mCi) of 177 Lu-DOTA-EB-TATE and underwent serial whole body planar and single-photon emission computed tomography-computed tomography (SPECT-CT) scans at 2, 24, 72, 120 and 168 h after injection. The other 3 patients received intravenous injection of 0.28-0.41 GBq (7.5-11.1 mCi) of 177 Lu-DOTATATE for the same imaging acquisition procedures at 1, 3, 4, 24 and 72 h after injection. The dosimetry was calculated using the OLINDA/EXM 1.1 software. Results: Administration of 177 Lu-DOTA-EB-TATE was well tolerated, with no adverse symptoms being noticed or reported in any of the patients. Compared with 177 Lu-DOTATATE, 177 Lu-DOTA-EB-TATE showed extended circulation in the blood and achieved 7.9-fold increase of tumor dose delivery. The total body effective doses were 0.205 ± 0.161 mSv/MBq for 177 Lu-DOTA-EB-TATE and 0.174 ± 0.072 mSv/MBq for 177 Lu-DOTATATE. Significant dose delivery increases to the kidneys and bone marrow were also observed in patients receiving 177 Lu-DOTA-EB-TATE than those receiving 177 Lu-DOTATATE (3.2 and 18.2-fold, respectively). Conclusion: By introducing an albumin binding moiety, 177 Lu-DOTA-EB-TATE showed remarkably higher uptake and retention in NET
Czech Academy of Sciences Publication Activity Database
Biswas, A.; Wilmanski, J.; Forsman, H.; Hrnčíř, Tomáš; Hao, L.; Tlaskalová-Hogenová, Helena; Kobayashi, K.
2011-01-01
Roč. 41, č. 1 (2011), s. 182-194 ISSN 0014-2980 R&D Projects: GA ČR GP310/09/P182 Institutional research plan: CEZ:AV0Z50200510 Keywords : Caspase-1 * Colitis * IL-10 Subject RIV: EC - Immunology Impact factor: 5.103, year: 2011
Lifescience Database Archive (English)
Full Text Available AAAAAAAACCAAAAAAAAAAXXXX XXXXXXTAAGAAAGCAAGGTGTGATNATGTCGAATGTCCNNATTTCCATANATGTG...---------TAAGAAAGCAAGGTGTGATNATGTCGAATGTCCNNATTTCCATANATGTG TTTAAANACGTGGTGGNATCTTAAGNTGTGAATTTNATCCCCCAAGAC...TTGT AAAATCAATTTGTANCAAAANCTAGTATTTTAAAAAAAAAAAAACCAAAAAAAAAA---- ------TAAGAAAGCAAGGTGTGATNATGTCGAATGTCCNNATTTCCATANA
Lifescience Database Archive (English)
Full Text Available _1( DQ114789 |pid:none) Pinctada fucata lysine-rich matrix... 33 4.0 EU017233_1( EU017233 |pid:none) Trach...elium caeruleum hypothetical ... 32 9.0 CT573213_5346( CT573213 |pid:none) Frankia
Lifescience Database Archive (English)
Full Text Available idvrtqsepnlgdiplclicdfavgkiekyld dkanttviidkvekdcnilrnswigkcknivteygpkiidllesnespkavcaiidlc*y h*TELKHKNKNKNK...liplnriet*k*k*k*k* Frame B: fkhkytmnklllaflffgliasvtismkidvrtqsepnlgdiplclicdfavgkiekyld dkanttviidkvekdcnil
Band structure in Platinum nuclei (A ∼ 182)
International Nuclear Information System (INIS)
Popescu, D.G.
1991-01-01
In this thesis, the author studies the band structure in Platinum nuclei and has divided his work in 5 parts: in the first, the author makes a general presentation of nucleus physics with a high angular momentum and introduces to the deformed nucleus notion -axial, triaxial or mixing of different deformations. The notion of form co-existence will be used to interpret the experimental results. In the second part, the author describes the detection means which have been used to make measurements. An abstract of theoretical notions, usefull for the understanding of fusion-evaporation reaction is presented. The author explains the details, performances and different modes of using of 'Chateau de cristal' and others used spectrometers. In the third part, the author presents all experimental data. He has effected γ coincidence measurements for Pt, Au and Ir nuclei. In the fourth part, for a classical analysis or an interpretation in the frame of cranking model the author presents theoretical models which are adapted at the study of high spin states and band structures
40 CFR 180.182 - Endosulfan; tolerances for residues.
2010-07-01
... 2.0 Lettuce, head 11.0 Lettuce, leaf 6.0 Milk, fat 2.0 Mustard greens 2.0 Mustard, seed 0.2... seed 1.0 Eggplant 1.0 Goat, fat 13.0 Goat, liver 5.0 Goat, meat 2.0 Goat, meat byproducts, except liver... Rapeseed, seed 0.2 Rye, grain 0.3 Rye, straw 0.3 Sheep, fat 13.0 Sheep, liver 5.0 Sheep, meat 2.0 Sheep...
Far East Asia | Page 182 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Although economic growth has reduced poverty in much of Asia, rural and ... These pressures strain the infrastructure and fray human relations, ultimately hampering development. ... Our regional office for Asia is located in New Delhi, India.
47 CFR 73.182 - Engineering standards of allocation.
2010-10-01
... stations shall be temporarily designated as Alaskan Class A stations, and calculations involving these... interfering field strengths referred to in this section, calculation of nighttime interference-free service is..., calculation of nighttime interference for non-coverage purposes is accomplished by considering the signals on...
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-08-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Energy Technology Data Exchange (ETDEWEB)
Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.
2016-08-21
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Directory of Open Access Journals (Sweden)
Hideo Honma
2012-10-01
Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan
2011-01-01
Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011
ORIGINAL ARTICLES Prevalence of drug-drug interactions of ...
African Journals Online (AJOL)
2008-02-02
Feb 2, 2008 ... Table II. Frequency of level 2 interactions between ARVs and the other drugs. Interacting ARVs and other drugs. N. %*. Didanosine + ketoconazole. 1. 0.91. Didanosine + ofloxacin. 1. 0.91. Didanosine + ciprofloxacin. 2. 1.82. Didanosine + iraconazole. 3. 2.73. Didanosine + ketoconazole. 2. 1.82. Efavirenz ...
Zhou, Li; Zhao, Minjie; Ennahar, Saïd; Bindler, Françoise; Marchioni, Eric
2012-04-01
A liquid chromatographic-electrospray ionization-tandem mass spectrometric (LC-ESI-MS(2)) method has been developed for determination of the molecular species of phosphatidylethanolamine (PE) in four food matrices (soy, egg yolk, ox liver, and krill oil). The extraction and purification method consisted of a pressurized liquid extraction procedure for total lipid (TL) extraction, purification of phospholipids (PLs) by adsorption on a silica gel column, and separation of PL classes by semi-preparative normal-phase HPLC. Separation and identification of PE molecular species were performed by reversed-phase HPLC coupled with electrospray ionization tandem mass spectrometry (ESI-MS(2)). Methanol containing 5 mmol L(-1) ammonium formate was used as the mobile phase. A variety of PE molecular species were detected in the four food matrices. (C16:0-C18:2)PE, (C18:2-C18:2)PE, and (C16:0-C18:1)PE were the major PE molecular species in soy. Egg yolk PE contained (C16:0-C18:1)PE, (C18:0-C18:1)PE, (C18:0-C18:2)PE, and (C16:0-C18:2)PE as the major molecular species. Ox liver PE was rich in the species (C18:0-C18:1)PE, (C18:0-C20:4)PE, and (C18:0-C18:2)PE. Finally, krill oil which was particularly rich in (C16:0(alkyl)-C22:6(acyl))plasmanylethanolamine (PakE), (C16:0-C22:6)PE, and (C16:0-C20:5)PE, seemed to be an interesting potential source for supplementation of food with eicosapentaenoic acid and docosahexaenoic acid.
Preliminary study on DPA cross-section of 184W in JEFF-3.2
International Nuclear Information System (INIS)
Konno, C.
2016-01-01
I investigated reasons why the DPA cross-section data of JEFF-3.2 184 W was too large above 30 MeV. As a result, I found out that the production yield of 182Ta in mf6 mt5 in JEFF-3.2 184W was too large and demonstrated that the problem was solved if the production yield of 182 Ta was modified. I picked out that the same issue also occurred in 182W, 183W and 186W. The production yield data of all the tungsten isotopes in JEFF-3.2 should be reconfirmed and revised if they have mistakes. (author)
African Journals Online (AJOL)
10332324
116. Department of Correctional Services v POPCRU 180 para 12, 182 para 18. The dress code discriminated on the basis of gender as it allowed females to wear dreadlocks and the respondents would not have been dismissed had they been female. 117. Department of Correctional Services v POPCRU 182 para 19. 118.
Performance of winter-rapeseed lines with an improved fatty acid composition
International Nuclear Information System (INIS)
Kraeling, K.
1990-01-01
Full text: High levels of linoleic (C18:2) and low content of linolenic acid (C18:3) are desired traits for rapeseed. Induced mutants with an improved fatty acid composition derived from the spring-rapeseed variety Oro were crossed with a winter-rapeseed line exhibiting an increased C18:2 content and backcrossed two times with several high yielding cultivars of winter-rapeseed. After each cross the F 2 was screened by gaschromatography for the mutant-type. After the second backcross from each of 118 lines (BC 2 -F 3 ) an observation plot (9.4 m 2 ) was sown. Results show that through backcrossing it was possible to develop lines with a high proportion of C18:2 and a reduced level of C18:3, whereas C18:1 remained unchanged, demonstrating new combinations different from the usual positive correlation between C18:2 and C18:3. Yield increased continuously with decreasing portion of the mutant genome. Relatively low genotype x location interaction for fatty acids was found. (author)
Energy Technology Data Exchange (ETDEWEB)
Chen, Yan; Li, Zheng; He, Yan; Shang, Dandan; Pan, Jigang; Wang, Hongmei; Chen, Huamei; Zhu, Zhuxia [Department of Physiology/Cancer Research Group, Guiyang Medical University School of Basic Medicine, 9 Beijing Road, Guiyang 550004, Guizhou (China); Wan, Lei [Department of Pharmacology, Guiyang Medical University School of Basic Medicine, 9 Beijing Road, Guiyang 550004, Guizhou (China); Wang, Xudong, E-mail: xdwang@gmc.edu.cn [Department of Physiology/Cancer Research Group, Guiyang Medical University School of Basic Medicine, 9 Beijing Road, Guiyang 550004, Guizhou (China)
2014-03-01
Fulvestrant (ICI 182 780, ICI) has been used in treating patients with hormone-sensitive breast cancer, yet initial or acquired resistance to endocrine therapies frequently arises and, in particular, cancer recurs as metastasis. We demonstrate here that both 17-beta-estradiol (E2) and ICI enhance cell adhesion to matrigel in MCF-7 breast cancer cells, with increased autolysis of calpain 1 (large subunit) and proteolysis of focal adhesion kinase (FAK), indicating calpain activation. Additionally, either E2 or ICI induced down-regulation of estrogen receptor α without affecting G protein coupled estrogen receptor 30 (GPR30) expression. Interestingly, GPR30 agonist G1 triggered calpain 1 autolysis but not calpain 2, whereas ER agonist diethylstilbestrol caused no apparent calpain autolysis. Furthermore, the actions of E2 and ICI on calpain and cell adhesion were tremendously suppressed by G15, or knockdown of GPR30. E2 and ICI also induced phosphorylation of extracellular regulated protein kinases 1 and 2 (ERK1/2), and suppression of ERK1/2 phosphorylation by U0126 profoundly impeded calpain activation triggered by estrogenic and antiestrogenic stimulations indicating implication of ERK1/2 in the GPR30-mediated action. Lastly, the E2- or ICI-induced cell adhesion was dramatically impaired by calpain-specific inhibitors, ALLN or calpeptin, suggesting requirement of calpain in the GPR30-associated action. These data show that enhanced cell adhesion by E2 and ICI occurs via a novel GPR30-ERK1/2-calpain pathway. Our results indicate that targeting the GPR30 signaling may be a potential strategy to reduce metastasis and improve the efficacy of antiestrogens in treatment of advanced breast cancer. - Highlights: • Estrogen and ICI augment adhesion to matrigel with calpain activation in MCF-7 cells. • GPR30 mediates cell–matrigel adhesion and calpain activation via ERK1/2. • Calpain is required in the cell–matrigel adhesion induced by E2 and ICI.
International Nuclear Information System (INIS)
Chen, Yan; Li, Zheng; He, Yan; Shang, Dandan; Pan, Jigang; Wang, Hongmei; Chen, Huamei; Zhu, Zhuxia; Wan, Lei; Wang, Xudong
2014-01-01
Fulvestrant (ICI 182 780, ICI) has been used in treating patients with hormone-sensitive breast cancer, yet initial or acquired resistance to endocrine therapies frequently arises and, in particular, cancer recurs as metastasis. We demonstrate here that both 17-beta-estradiol (E2) and ICI enhance cell adhesion to matrigel in MCF-7 breast cancer cells, with increased autolysis of calpain 1 (large subunit) and proteolysis of focal adhesion kinase (FAK), indicating calpain activation. Additionally, either E2 or ICI induced down-regulation of estrogen receptor α without affecting G protein coupled estrogen receptor 30 (GPR30) expression. Interestingly, GPR30 agonist G1 triggered calpain 1 autolysis but not calpain 2, whereas ER agonist diethylstilbestrol caused no apparent calpain autolysis. Furthermore, the actions of E2 and ICI on calpain and cell adhesion were tremendously suppressed by G15, or knockdown of GPR30. E2 and ICI also induced phosphorylation of extracellular regulated protein kinases 1 and 2 (ERK1/2), and suppression of ERK1/2 phosphorylation by U0126 profoundly impeded calpain activation triggered by estrogenic and antiestrogenic stimulations indicating implication of ERK1/2 in the GPR30-mediated action. Lastly, the E2- or ICI-induced cell adhesion was dramatically impaired by calpain-specific inhibitors, ALLN or calpeptin, suggesting requirement of calpain in the GPR30-associated action. These data show that enhanced cell adhesion by E2 and ICI occurs via a novel GPR30-ERK1/2-calpain pathway. Our results indicate that targeting the GPR30 signaling may be a potential strategy to reduce metastasis and improve the efficacy of antiestrogens in treatment of advanced breast cancer. - Highlights: • Estrogen and ICI augment adhesion to matrigel with calpain activation in MCF-7 cells. • GPR30 mediates cell–matrigel adhesion and calpain activation via ERK1/2. • Calpain is required in the cell–matrigel adhesion induced by E2 and ICI
Hunt, Alison C.; Cook, David L.; Lichtenberg, Tim; Reger, Philip M.; Ek, Mattias; Golabek, Gregor J.; Schönbächler, Maria
2018-01-01
The short-lived 182Hf-182W decay system is a powerful chronometer for constraining the timing of metal-silicate separation and core formation in planetesimals and planets. Neutron capture effects on W isotopes, however, significantly hamper the application of this tool. In order to correct for neutron capture effects, Pt isotopes have emerged as a reliable in-situ neutron dosimeter. This study applies this method to IAB iron meteorites, in order to constrain the timing of metal segregation on the IAB parent body. The ε182W values obtained for the IAB iron meteorites range from -3.61 ± 0.10 to -2.73 ± 0.09. Correlating εiPt with ε182W data yields a pre-neutron capture ε182W of -2.90 ± 0.06. This corresponds to a metal-silicate separation age of 6.0 ± 0.8 Ma after CAI for the IAB parent body, and is interpreted to represent a body-wide melting event. Later, between 10 and 14 Ma after CAI, an impact led to a catastrophic break-up and subsequent reassembly of the parent body. Thermal models of the interior evolution that are consistent with these estimates suggest that the IAB parent body underwent metal-silicate separation as a result of internal heating by short-lived radionuclides and accreted at around 1.4 ± 0.1 Ma after CAIs with a radius of greater than 60 km.
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)
2017-01-21
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography
Energy Technology Data Exchange (ETDEWEB)
O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com
2015-07-01
Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.
International Nuclear Information System (INIS)
Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun
2017-01-01
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl
International Nuclear Information System (INIS)
Ovchar, L.A.; Poluehktov, N.S.
1980-01-01
The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru
Current trends in scintillator detectors and materials
International Nuclear Information System (INIS)
Moses, W.W.
2002-01-01
The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency
International Nuclear Information System (INIS)
Kanias, G.D.
1985-01-01
Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)
Final Report on ITER Task Agreement 81-18
Energy Technology Data Exchange (ETDEWEB)
Brad J. Merrill
2008-02-01
During 2007, the US International Thermonuclear Experimental Reactor (ITER) Project Office (USIPO) entered into a Task Agreement (TA) with the ITER International Organization (IO) to conduct Research and Development activity and/or Design activity in the area of Safety Analyses. There were four tasks within this TA, which were to provide the ITER IO with: 1) Quality Assurance (QA) documentation for the MELCOR 1.8.2 Fusion code, 2) a pedigreed version of MELCOR 1.8.2, 3) assistance in MELCOR input deck development and accident analyses, and 4) support and assistance in the operation of the MELCOR 1.8.2. This report, which is the final report for this agreement, documents the completion of the work scope under this ITER TA, designated as TA 81-18.
Dilmi, S.; Saib, S.; Bouarissa, N.
2018-06-01
Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.
International Nuclear Information System (INIS)
Stierman, R.J.
1982-12-01
Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions
All projects related to | Page 182 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Topic: VIOLENCE, SOCIAL PROBLEMS, POLITICAL REFORM, SOCIAL STRUCTURE, DISCRIMINATION, SOCIAL STRATIFICATION, CASE STUDIES, RESEARCH NETWORKS, POLICY MAKING, PEACE, Capacity building. Region: Colombia, South America, Far East Asia, Indonesia, Nepal, Sudan, El Salvador, North ...
Publications | Page 182 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...
In-Source laser ionization spectroscopy of 181,182Hg
AUTHOR|(CDS)2096834
The mean square charge radii of the mercury isotopes exhibit a large odd-even staggering for the neutron-deficient mercury isotopes, which is suggested to be a manifestation of shape coexistence. Shape coexistence is the phenomenon in which two (or more) distinct types of deformation occur at low energy in one and the same atomic nucleus. Understanding the occurrence of shape coexistence in atomic nuclei is a challenge faced by theories of nuclear structure. The investigation of the neutron-deficient mercury isotopes (Z = 80) plays an important role in the understanding of shape coexistence in this region of the nuclear chart. The theoretical description of shape coexistence is discussed in chapter 1. In a recent laser-spectroscopy experiment performed at the ISOLDE facility in CERN, the hyperfine spectra were measured for 15 different mercury isotopes ranging from $^{177}$Hg to $^{208}$Hg. One of the main goals of this experiment was to extend the currently existing knowledge of the mean square charge radius...
International Nuclear Information System (INIS)
Tsiafoulis, Constantinos G.; Skarlas, Theodore; Tzamaloukas, Ouranios; Miltiadou, Despoina; Gerothanassis, Ioannis P.
2014-01-01
Highlights: • The first NMR quantification of four geometric 18:2 CLA isomers has been achieved. • Sensitivity and resolution NMR barriers have been overcome. • Selective suppression and reduced 13 C spectral width have been utilized. • The method is applied in the milk lipid fraction without derivatization steps. • The method is selective, sensitive with very good analytical characteristics. - Abstract: We report the first successful direct and unequivocal identification and quantification of four minor geometric (9-cis, 11-trans) 18:2, (9-trans, 11-cis) 18:2, (9-cis, 11-cis) 18:2 and (9-trans, 11-trans) 18:2 conjugated linoleic acid (CLA) isomers in lipid fractions of lyophilized milk samples with the combined use of 1D 1 H-NMR, 2D 1 H- 1 H TOCSY and 2D 1 H- 13 C HSQC NMR. The significant sensitivity barrier has been successfully overcome under selective suppression of the major resonances, with over 10 4 greater equilibrium magnetization of the -(CH 2 ) n - 1 H spins compared to that of the 1 H spins of the conjugated bonds of the CLA isomers. The resolution barrier has been significantly increased using reduced 13 C spectral width in the 2D 1 H- 13 C HSQC experiment. The assignment was confirmed with spiking experiments with CLA standard compounds and the method does not require any derivatization steps for the lipid fraction. The proposed method is selective, sensitive and compares favorably with the GS-MS method of analysis
GAS CHROMATOGRAPHIC AND SPECTROSCOPIC ANALYSIS OF ...
African Journals Online (AJOL)
Peroxyformic acid prepared in-situ was employed for epoxidation of canola oil in the presence of toluene. Gas chromatographic analysis of the product revealed the following species: C16:0; C18:0; C18:1; C18:2; C18:3; monoepoxy C18:0; monoepoxy C18:1; monoepoxy C18:2; diepoxy C18:0; diepoxy C18:1 and triepoxy ...
Soares-Miranda, Luisa; Stein, Phyllis K; Imamura, Fumiaki; Sattelmair, Jacob; Lemaitre, Rozenn N; Siscovick, David S; Mota, Jorge; Mozaffarian, Dariush
2014-01-01
Background Trans-fatty acid (TFA) consumption is associated with risk of coronary heart disease, and trans-18:2, but not trans-18:1, in red blood cells membranes has been associated with sudden cardiac arrest. Abnormal heart rate variability (HRV) reflects autonomic dysfunction and predicts cardiac death. Relationships between TFA consumption and HRV remain under-studied. We determined whether total TFA consumption, as well as trans-18:1 and trans-18:2 TFA consumption, were independently associated with HRV in two independent cohorts in the US and Portugal. Methods and Results In two independent cohorts of older US adults (Cardiovascular Health Study ([CHS], age=72±5yrs, 1989/1995) and young Portuguese adults (Porto, age=19±2yrs, 2008/2010), we assessed habitual TFA intake by food frequency questionnaires in CHS (separately estimating trans-18:1 and trans-18:2) and multiple 24-hour recalls in Porto (estimating total TFA only, which in a subset correlated with circulating trans-18:2, but not trans-18:1, suggesting that we captured the former). HRV was assessed using 24-hour Holters in CHS (N=1,076) and repeated short-term (5-min) ECGs in Porto (N=160). We used multivariate-adjusted linear regression to relate TFA consumption to HRV cross-sectionally (CHS, Porto) and longitudinally (CHS). In CHS, higher trans-18:2 consumption was associated with lower 24-hour standard-deviation-of-all-normal-to-normal-intervals (SDNN) both cross-sectionally (−12%, 95%CI=6–19%, p=0.001) and longitudinally (−15%, 95%CI=4–25 %, p= 0.009), and lower 24-hour SDANN and SDNN-index (pHRV, in particular time-domain indices (SDNN, SDANN, SDNN-index; pHRV in both older and young adults. Trans-18:1 consumption is associated with more favorable HRV indices in older adults. Our results support the need to investigate potential HRV related mechanisms whereby trans-18:2 may increase arrhythmic risk. PMID:22772898
Valence electron structure and properties of stabilized ZrO2
Institute of Scientific and Technical Information of China (English)
2008-01-01
To reveal the properties of stabilizers in ZrO2 on nanoscopic levels, the valence electron structures of four stable ZrO2 phases and c-ZrO2 were analyzed on the basis of the empirical electron theory of solids and molecules. The results showed that the hybridization levels of Zr atoms in c-ZrO2 doped with Ca and Mg dropped from B17 to B13, the hybridization levels of Zr atoms in c-ZrO2 doped with Y and Ce dropped from B17 to B15, and that the four stabilizing atoms all made the hybridization levels of O atoms drop from level 4 to level 2. The numbers of covalent electrons in the strongest covalent bond in the descending order are c-ZrO2>Zr0.82Ce0.18O2> Zr0.82Y0.18O1.91>Zr0.82Mg0.18O1.82>Zr0.82Ca0.18O1.82. The bond energies of the strongest covalent bond and the melting points of the solid solutions in the descending order are Zr0.82Ce0.18O2> c-ZrO2>Zr0.82Y0.18O1.91>Zr0.82Mg0.18O1.82>Zr0.82Ca0.18O1.82. The percent-ages of the total number of covalent electrons in the descending order are c-ZrO2>Zr0.82Y0.18O1.91> Zr0.82Ce0.18O2>Zr0.82Mg0.18O1.82> Zr0.82Ca0.18O1.82. From the above analysis, it can be concluded that the stabilizing degrees of the four stabilizers in the descending order are CaO> MgO>Y2O3>CeO2.
Energy Technology Data Exchange (ETDEWEB)
Song, Tae Kwang; Bae, Hong Yeol; Chun, Yun Bae; Oh, Chang Young; Kim, Yun Jae [Korea University, Seoul (Korea, Republic of); Lee, Kyoung Soo; Park, Chi Yong [Korea Electric Power Research Institute, Daejeon (Korea, Republic of)
2008-08-15
In nuclear power plants, ferritic low alloy steel nozzle was connected with austenitic stainless steel piping system through alloy 82/182 butt weld. Accurate estimation of residual stress for weldment is important in the sense that alloy 82/182 is susceptible to stress corrosion cracking. There are many results which predict residual stress distribution for alloy 82/182 weld between nozzle and pipe. However, nozzle and piping system usually connected through safe end which has short length. In this paper, residual stress distribution for pressurizer nozzle of Kori nuclear power plant was predicted using FE analysis, which considered safe end. As a result, existing residual stress profile was redistributed and residual stress of inner surface was decreased specially. It means that safe end should be considered to reduce conservatism when estimating the piping system.
Hörsch, Dieter; Ezziddin, Samer; Haug, Alexander; Gratz, Klaus Friedrich; Dunkelmann, Simone; Miederer, Matthias; Schreckenberger, Mathias; Krause, Bernd Joachim; Bengel, Frank M; Bartenstein, Peter; Biersack, Hans-Jürgen; Pöpperl, Gabriele; Baum, R P
2016-05-01
Monocentric and retrospective studies indicate effectiveness of peptide receptor radionuclide therapy targeting somatostatin receptors of neuroendocrine neoplasms. We assessed overall and progression-free survival and adverse events of peptide receptor radionuclide therapy by a multi-institutional, board certified registry with prospective follow-up in five centres in Germany. A total of 450 patients were included and followed for a mean of 24.4 months. Most patients had progressive low- or intermediate grade neuroendocrine neoplasms and 73% were pretreated with at least one therapy. Primary neuroendocrine neoplasms were mainly derived of pancreas (38%), small bowel (30%), unknown primary (19%) or bronchial system (4%). Patients were treated with Lutetium-177 in 54%, with Yttrium-90 in 17% and with both radionuclides in 29%. Overall and progression-free survival was determined with Kaplan-Meier curves and uni-variate log rank test Cox models. Median overall survival of all patients was 59 (95% confidence interval [CI] 49-68.9) months. Overall survival was significantly inferior in the patients treated with Yttrium-90 solely (hazard ratio, 3.22; 95% CI, 1.83-5.64) compared to any peptide receptor radionuclide therapy with Lutetium-177. Grade II (hazard ratio, 2.06; 95% CI, 0.79-5.32) and grade III (hazard ratio, 4.22; 95% CI, 1.41-12.06) neuroendocrine neoplasms had significantly worse overall survival than grade I neuroendocrine neoplasms. Patients with small neuroendocrine neoplasms of small bowel had significantly increased survival (hazard ratio, 0.39; 95% CI, 0.18-0.87) compared to neuroendocrine neoplasms of other locations. Median progression-free survival was 41 (35.9-46.1) months and significantly inferior in patients treated with Yttrium solely (hazard ratio, 2.7; 95% CI, 1.71-4.55). Complete remission was observed in 5.6% of patients, 22.4% had a partial remission, 47.3% were stable and 4% were progressive as best response. Adverse events of bone marrow
1994-08-15
repository for TCE, and thus a critical determinant of TCE’s pharmacokinetics. As previously mentioned, it is advantageous to have quantitative tcxicity...steel columns (182 cm x 0.317 cm) packed with 10% FFAP ( Alltech Associates, Deerfield, IL). The GC operating conditions were: headspace sampler...steel columns (182 cm x 0.317 cm) packed with 10% FFAP ( Alltech Associates, Deerfield, IL). The GC operating conditions were: headspace sampler
2016-03-24
current USD) 179 179 164 1990 0 Improved Water Source (% population with access ) 178 175 175 1960 1 Life Expectancy (years) 182 182 1990 2 Military...Microsoft Office visual basic ( VBA ) based consolidated 42 database tool was developed to compile the 39 separate identifying-information and data...conflict remains in conflictP A brief discussion of the accessibility of states within a Markov model is warranted before we proceed further
Sustainability of rare earth elements chain: from production to food - a review.
Turra, Christian
2018-02-01
Rare earth elements (REE) are a group of chemical elements that include lanthanoids (lanthanum to lutetium), scandium and yttrium. In the last decades, the REE demand in the industry and other areas has increased significantly. In general, REE have shown low concentrations in soils, plants, water and atmosphere, but they may accumulate in such environments due to anthropogenic inputs. In areas where there is REE contamination, the slow accumulation of these elements in the environment could become problematic. Many studies have shown environmental areas contaminated with REE and their toxic effects. Thus, it is important to review, in order to improve the current understanding of these elements in the environment, showing the effects of REE exposure in mining, soil, water, plants and food. Besides, there are few suppliers and a limited quantity of these elements in the world. This paper suggests options to improve the sustainability management of REE chain.
International Nuclear Information System (INIS)
Jarý, V; Mihóková, E; Mareš, J A; Beitlerová, A; Nikl, M; Kurtsev, D; Sidletskiy, O
2014-01-01
We provide a systematic comparison of the scintillation and luminescence properties, including emission mechanisms, of the highly efficient cerium-doped scintillators lutetium-(gadolinium) orthosilicates Lu 2 (SiO 4 )O (LSO), (Lu 1−x Gd x ) 2 (SiO) 4 O(LGSO) and Gd 2 (SiO 4 )O (GSO). Determined characteristics manifest an advantage of LGSO:Ce with respect to both LSO:Ce and GSO:Ce for scintillator applications around room temperature. This is thanks to combined fast decay (faster than both limit compositions) high light yield, similar to that of LSO:Ce (twice higher than GSO:Ce) and low afterglow, similar to that of GSO:Ce (almost two orders of magnitude lower than LSO:Ce). High temperature applications do not, however, seem to be a suitable option for LGSO:Ce due to evidenced thermal ionization of both Ce1 and Ce2 centres above room temperature. (paper)
International Nuclear Information System (INIS)
Romanova, E.Yu.; Bazarov, B.G.; Tushinova, Yu.L.; Fedorov, K.N.; Bazarova, Zh.G.; Klevtsova, R.F.; Glinskaya, L.A.
2007-01-01
Interactions in the ternary system K 2 MoO 4 -Lu 2 (MoO 4 ) 3 -Hf(MoO 4 ) 2 have been studied by X-ray powder diffraction and differential thermal analysis. A new triple (potassium lutetium hafnium) molybdate with the 5 : 1 : 2 stoichiometry has been found. Monocrystals of this molybdate have been grown. Its X-ray diffraction structure has been refined (an X8 APEX automated diffractometer, MoK α radiation, 1960 F(hkl), R = 0.0166). The trigonal unit cell has the following parameters: a = 10.6536(1) A, c = 37.8434(8) A, V=3719.75(9) A, Z = 6, space group R3-bar c. The mixed 3D framework of the structure is built of Mo tetrahedra sharing corners with two independent (Lu,Hf)O 6 octahedra. Two sorts of potassium atoms occupy large framework voids [ru
International Nuclear Information System (INIS)
Finston, H.L.; Williams, E.T.
1976-01-01
There has been significant progress on the project to measure the neutron-capture cross sections of reactor produced radionuclides, in particular, centering on the problems with nuclides such as 22 Na which may have a resonance for thermal-neutron capture. The thermal capture cross section of less than 40 b has been verified for 54 Mn, and cadmium ratios have been determined for 184 Re in the V-11 and V-14 positions in the HFBR. Lutetium has been used as a neutron temperature monitor for the Brookhaven reactors. Preliminary results on the project to determine the effect of chemical state on the branching ratio in 58 Co are reported. Procedures for aerosol collection and analysis by proton-induced x-ray emission (PIXE) are reported. A program to analyze aerosols for polycyclic aromatic hydrocarbons has been initiated. Progress is reported on the experimental verification of the proposed acid-base hypothesis
Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil
International Nuclear Information System (INIS)
Goncalves, P.; Navarro, F.C.; Roveri, C.D.; Bergerman, M.G.
2016-01-01
Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)
Energy Technology Data Exchange (ETDEWEB)
Xiong Hairong [Institute of Molecular Medicine and Genetics, Georgia Health Sciences University, Augusta, GA (Georgia); State Key Laboratory of Virology, Institute of Medical Virology, Wuhan University School of Medicine, Wuhan (China); Lee, Robert J. [Division of Pharmaceutics, College of Pharmacy, Ohio State University, Columbus, OH (United States); Haura, Eric B. [Thoracic Oncology and Experimental Therapeutics Programs, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL (United States); Edwards, John G. [Apeliotus Technologies, Inc., Atlanta, GA (United States); Dynan, William S. [Institute of Molecular Medicine and Genetics, Georgia Health Sciences University, Augusta, GA (Georgia); Li Shuyi, E-mail: sli@georgiahealth.edu [Institute of Molecular Medicine and Genetics, Georgia Health Sciences University, Augusta, GA (Georgia); Apeliotus Technologies, Inc., Atlanta, GA (United States)
2012-07-01
Purpose: To inhibit DNA double-strand break repair in tumor cells by delivery of a single-chain antibody variable region fragment (ScFv 18-2) to the cell nucleus. ScFv 18-2 binds to a regulatory region of the DNA-dependent protein kinase (DNA-PK), an essential enzyme in the nonhomologous end-joining pathway, and inhibits DNA end-joining in a cell-free system and when microinjected into single cells. Development as a radiosensitizer has been limited by the lack of a method for intranuclear delivery to target cells. We investigated a delivery method based on folate receptor-mediated endocytosis. Methods and Materials: A recombinant ScFv 18-2 derivative was conjugated to folate via a scissile disulfide linker. Folate-ScFv 18-2 was characterized for its ability to be internalized by tumor cells and to influence the behavior of ionizing radiation-induced repair foci. Radiosensitization was measured in a clonogenic survival assay. Survival curves were fitted to a linear-quadratic model, and between-group differences were evaluated by an F test. Sensitization ratios were determined based on mean inhibitory dose. Results: Human KB and NCI-H292 lung cancer cells treated with folate-conjugated ScFv 18-2 showed significant radiosensitization (p < 0.001). Sensitization enhancement ratios were 1.92 {+-} 0.42 for KB cells and 1.63 {+-} 0.13 for NCI-H292 cells. Studies suggest that treatment inhibits repair of radiation-induced DSBs, as evidenced by the persistence of {gamma}-H2AX-stained foci and by inhibition of staining with anti-DNA-PKcs phosphoserine 2056. Conclusions: Folate-mediated endocytosis is an effective method for intranuclear delivery of an antibody-derived DNA repair inhibitor.
Fentanyl inhibits proliferation and invasion of colorectal cancer via β-catenin
Zhang, Xiu-Lai; Chen, Min-Li; Zhou, Sheng-Li
2015-01-01
Background and aim: Fentanyl is widely used for relieving pain and narcotizing in cancer patients. However, there are few published reports regarding the effects of fentanyl on tumor control and treatment. Here we investigated the effects of fentanyl on tumor growth and cell invasion in the human colorectal carcinoma (HCT116) cells. Methods: Nude mice xenografts of HCT116 cells were established to assess the inhibition effect on tumor growth by fentanyl. MTT and Transwell were employed to determine the cell survival rate and cell invasion, respectively. MicroRNAs and mRNAs expression were quantified by real-time PCR. β-catenin and matrix metalloproteinases (MMP-2 and MMP-9) expression were assayed by western blotting. β-Catenin-specific small interfering RNA (Si-β-catenin) and miR-182 mimics were transfected in cells to investigate the mechanism underlying the effects of fentanyl on the colorectal tumor and HCT116 cells. Results: Treatment with fentanyl inhibited the tumor growth and HCT116 cells invasion. Fentanyl also downregulated the expression of β-catenin and miR-182 in both xenograft tumors and HCT116 cells, and decreased the protein level of MMP-9 in HCT116 cells. Downregulation of β-Catenin resulted in the decrease of miR-182 expression in colorectal cells. In addition, the overexpression of miR-182 reversed the effect of fentanyl on MMP-9 expression and cell invasion of HCT116 cells. Conclusions: The current study demonstrated that the inhibition of tumor growth and cell invasion in colorectal cancer by fentanyl is probably due to downregulation of miR-182 and MMP-9 expression by β-catenin. PMID:25755709
Shibamoto, Shigeaki; Murata, Tasuku; Yamamoto, Kouhei
2016-09-01
The dimethyl disulfide (DMDS) adduct method is one of the convenient and effective methods for determining double bond positions of unsaturated fatty acid methyl esters (FAME) except conjugated FAME. When analyzed using gas chromatography/electron ionization-mass spectrometry (GC/EI-MS), unsaturated FAME with DMDS added to the double bonds yields high intensity MS spectra of characteristic ions. The MS spectra of characteristic ions can then be used to easily confirm double bond positions. Here we explore the GC/EI-MS analysis of the DMDS adducts of methyl linoleate geometrical isomers isolated by high performance liquid chromatography (HPLC) with a silver nitrate column. For C18:2-c9, c12 and C18:2-t9, t12, DMDS randomly formed adducts with double bonds at either carbon 9-10 or carbon 12-13, but not both at the same time due to steric hindrance. For C18:2-c9, t12 and C18:2-t9, c12, however, DMDS only formed adducts with the double bond in the cis configuration. Consequently, when analyzing fatty acids with methylene interrupted double bonds, with one double bond in the cis and one in the trans configuration, double bond positions cannot be completely confirmed.
Directory of Open Access Journals (Sweden)
Ilir Tasha
2014-01-01
Full Text Available Aim. To determine agreement of cardiac anomalies between maternal fetal medicine (MFM physicians and pediatric cardiologists (PC in fetuses with single umbilical artery (SUA. Methods. A retrospective review of all fetuses with SUA between 1999 and 2008. Subjects were studied by MFM and PC, delivered at our institution, and had confirmation of SUA and cardiac anomaly by antenatal and neonatal PC follow-up. Subjects were divided into four groups: isolated SUA, SUA and isolated cardiac anomaly, SUA and multiple anomalies without heart anomalies, and SUA and multiple malformations including cardiac anomaly. Results. 39,942 cases were studied between 1999 and 2008. In 376 of 39,942 cases (0.94%, SUA was diagnosed. Only 182 (48.4% met inclusion criteria. Cardiac anomalies were found in 21% (38/182. Agreement between MFM physicians and PC in all groups combined was 94% (171/182 (95% CI [89.2, 96.8]. MFM physicians overdiagnosed cardiac anomalies in 4.4% (8/182. MFM physicians and PC failed to antenatally diagnose cardiac anomaly in the same two cases. Conclusions. Good agreement was noted between MFM physicians and PC in our institution. Studies performed antenatally by MFM physicians and PC are less likely to uncover the entire spectrum of cardiac abnormalities and thus neonatal follow-up is suggested.
Bughi, Stephanie A; Lie, Desiree A; Zia, Stephanie K; Rosenthal, Jane
2017-01-01
Distress and burnout are common among medical students and negatively impact students' physical, mental, and emotional health. Personality inventories such as the Myers-Briggs Type Indicator (MBTI), used in medical education, may have a role in identifying burnout risk early. The authors conducted a cross-sectional survey study among 185 1st year medical students with the MBTI, the general well-being schedule (GWB), and Maslach Burnout Inventory-Student Survey (MBI-SS). Descriptive statistics and one-way MANOVAs were used to identify the prevalence and differences in MBTI preferences and distress/burnout risk. Response rate was 185/185 (100%). Distress (GWB) was reported by 84/185 (45.4%). High scores on exhaustion were reported by 118/182 (64.8%), cynicism by 76/182 (41.8%), and decreased professional efficacy by 38/182 (20.9%) for the three dimensions of the MBI-SS. Only 21/182 (11.5%) of respondents had high scores on all three dimensions of burnout. Students with MBTI preferences for extraversion reported greater positive well-being (P burnout are prevalent early in medical training. The significant difference between extraversion and introversion in relation to distress and burnout deserves further study. Use of a personality inventory may help identify students at risk of burnout and allow appropriate early stress management.
International Nuclear Information System (INIS)
BINGERT, S.; DESCH, P.; TRUJILLO, E.
1999-01-01
A Molybdenum-- 182 Tungsten (Mo- 182 W) alloy was specified for an application that would ultimately result in the measurement of temperature and particle velocity during the steady state time following the shock loading of various materials. The 182 W isotope provides a tag for the analysis of neutron resonance line shape from which the temperature may be calculated. The material was specified to have 1.8 atom percent W, with W-rich regions no larger than 1 microm in size. Both the composition and W distribution were critical to the experiment. Another challenge to the processing was the very small quantity of 182 W material available for the synthesis of the alloy. Therefore, limited fabrication routes were available for evaluation. Several synthesis and processing routes were explored to fabricate the required alloy components. First, precipitation of W onto Mo powder using ammonium metatungstate was investigated for powder synthesis followed by uniaxial hot pressing. Second, mechanical alloying (MA) followed by hot isostatic pressing (HIP) and warm forging was attempted. Finally, arc-melting techniques followed by either hot rolling or crushing the alloyed button into powder and consolidation were pursued. The results of the processing routes and characterization of the materials produced will be discussed
Corrosion Damage in Penetration Nozzle and Its Weldment of Reactor Pressure Vessel Head
International Nuclear Information System (INIS)
Lim, Yun Soo; Kim, Joung Soo; Kim, Hong Pyo; Hwang, Seong Sik; Yi, Young Sun; Kim, Dong Jin; Jung, Man Kyo
2003-07-01
The recent status on corrosion damage of reactor vessel head (RVH) penetration nozzles at primary water reactors (PWRs), including control rod drive mechanism (CRDM) and thermocouple nozzles, was investigated. The studies for primary water stress corrosion cracking (PWSCC) characteristics of Alloy 600 and Alloy 182/82 were reviewed and summarized in terms of the crack initiation and crack growth rate. The studies on the boric acid corrosion (BAC) of low alloy steels were also included in this report. PWSCC was found to be the main failure mechanism of RVH CRDM nozzles, which are constituted with Alloy 600 base metal and Alloy 182 weld filler materials. Alloy 600 and Alloy 182/82 are very susceptible to intergranular SCC in the PWR environments. The PWSCC crack initiation and growth features in the fusion zone of Alloy 182/82 were strongly dependant on solidification anisotropy during welding, test temperature, weld heat, mechanical loading, stress relief heat treatment, cold work and so on. BAC of low alloy steels is a wastage phenomenon due to general corrosion occurring on the over-all surface area of material. Systematic studies, concerned with structural integrity of RVH penetration nozzles as well as improvement of PWSCC resistance of nickel-based weld metals in the simulated PWR environment, are needed
High-z semiconductor nuclear radiation detectors for room-temperature gamma-ray spectrometry
International Nuclear Information System (INIS)
Bornand, Bernard; Friant, Alain.
1978-09-01
A bibliographical review (182 articles of periodicals, conferences, reports, thesis and french patents) is presented, as addendum of the report CEA-BIB-210 (1974) on high-Z semiconductor compounds used as materials for the gamma and X-ray detection and spectrometry. This publication reviews issues from 1974 to 1977. References and summaries (in french) are incorporated into 182 bibliograhical notices. Index for authors, corporate authors, documents and periodicals, and subjects is included [fr
Meng, Xiaodan; Joosse, Simon A; Müller, Volkmar; Trillsch, Fabian; Milde-Langosch, Karin; Mahner, Sven; Geffken, Maria; Pantel, Klaus; Schwarzenbach, Heidi
2015-11-03
Owing to late diagnosis in advanced disease stages, prognosis of patients with epithelial ovarian cancer (EOC) is poor. The quantification of deregulated levels of microRNAs could facilitate earlier diagnosis and improve prognosis of EOC. Seven microRNAs (miR-7, miR-16, miR-25, miR-93, miR-182, miR-376a and miR-429) were quantified in the serum of 180 EOC patients and 66 healthy women by TaqMan PCR microRNA assays. Median follow-up time was 21 months. The effects of miR-7 and miR-429 on apoptosis, cell proliferation, migration and invasion were investigated in two (EOC) cell lines. Serum levels of miR-25 (P=0.0001) and miR-93 (P=0.0001) were downregulated, whereas those of miR-7 (P=0.001) and miR-429 (P=0.0001) were upregulated in EOC patients compared with healthy women. The four microRNAs discriminated EOC patients from healthy women with a sensitivity of 93% and a specificity of 92%. The levels of miR-429 positively correlated with CA125 values (P=0.0001) and differed between FIGO I-II and III-IV stages (P=0.001). MiR-429 was an independent predictor of overall survival (P=0.011). Overexpressed miR-429 in SKOV3 cells led to suppression of cell migration (P=0.037) and invasion (P=0.011). Increased levels of miR-7 were associated with lymph node metastases (P=0.0001) and FIGO stages III-IV (P=0.0001). Overexpressed miR-7 in SKOV3 cells resulted in increased cell migration (P=0.001) and invasion (P=0.011). Additionally, the increased levels of miR-376a correlated with FIGO stages III-IV (P=0.02). Our data indicate the diagnostic potential of miR-7, miR-25, miR-93 and miR-429 in EOC and the prognostic potential of miR-429. This microRNA panel may be promising molecules to be targeted in the treatment of EOC.
Some Comparisons of Complexity in Dictionary-Based and Linear Computational Models
Czech Academy of Sciences Publication Activity Database
Gnecco, G.; Kůrková, Věra; Sanguineti, M.
2011-01-01
Roč. 24, č. 2 (2011), s. 171-182 ISSN 0893-6080 R&D Project s: GA ČR GA201/08/1744 Grant - others:CNR - AV ČR project 2010-2012(XE) Complexity of Neural-Network and Kernel Computational Models Institutional research plan: CEZ:AV0Z10300504 Keywords : linear approximation schemes * variable-basis approximation schemes * model complexity * worst-case errors * neural networks * kernel models Subject RIV: IN - Informatics, Computer Science Impact factor: 2.182, year: 2011
Barate, R.; Ghez, Philippe; Goy, C.; Jezequel, S.; Lees, J.P.; Martin, F.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Alemany, R.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Morawitz, P.; Pacheco, A.; Riu, I.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Ciulli, V.; Davies, G.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Halley, A.W.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.C.; Machefert, F.; Rouge, A.; Swynghedauw, M.; Tanaka, R.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Curtis, L.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raeven, B.; Raine, C.; Smith, D.; Teixeira-Dias, P.; Thompson, A.S.; Ward, J.J.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E.E.; Putzer, A.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Marinelli, N.; Martin, E.B.; Nash, J.; Nowell, J.; Przysiezniak, H.; Sciaba, A.; Sedgbeer, J.K.; Thomson, Evelyn J.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C.K.; Buck, P.G.; Ellis, G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Smizanska, M.; Williams, M.I.; Giehl, I.; Holldorfer, F.; Jakobs, K.; Kleinknecht, K.; Krocker, M.; Muller, A.S.; Nurnberger, H.A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Aubert, J.J.; Bonissent, A.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Tilquin, A.; Aleppo, M.; Antonelli, M.; Gilardoni, Simone S.; Ragusa, F.; Buescher, Volker; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Kado, M.; Lefrancois, J.; Serin, L.; Veillet, J.J.; Videau, I.; de Vivie de Regie, J.B.; Zerwas, D.; Bagliesi, Giuseppe; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Coles, J.; Cowan, G.; Green, M.G.; Hutchcroft, D.E.; Jones, L.T.; Medcalf, T.; Strong, J.A.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Thompson, J.C.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Fabbro, B.; Faif, G.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Rosowsky, A.; Seager, P.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S.N.; Dann, J.H.; Loomis, C.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Hodgson, P.N.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Hess, J.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Putz, J.; Rothberg, J.E.; Wasserbaech, S.; Williams, R.W.; Armstrong, S.R.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A.; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; von Wimmersperg-Toeller, J.H.; Wu, S.L.; Wu, X.; Zobernig, G.
1999-01-01
The e+e- -> ZZ cross section at sqrt(s)=182.7 and 188.6 GeV has been measured using the ALEPH detector. The analysis covers all of the visible ZZ final states and yields cross section measurements of sigma_ZZ(182.7 GeV) = 0.11 +- (0.16,0.11) (stat.) +- 0.04 (syst.) pb and sigma_ZZ(188.6 GeV) = 0.67 +- 0.13 (stat.) +- 0.04 (syst.) pb consistent with the Standard Model expectations.
Bodo, Enrico
2015-09-03
By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).
Energy Technology Data Exchange (ETDEWEB)
Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)
2013-12-15
In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.
DEFF Research Database (Denmark)
Holm, René; Porter, Christopher J H; Edwards, Glenn A
2003-01-01
The potential for lipidic self-microemulsifying drug delivery systems (SMEDDS) containing triglycerides with a defined structure, where the different fatty acids on the glycerol backbone exhibit different metabolic fate, to improve the lymphatic transport and the portal absorption of a poorly water......-soluble drug, halofantrine, were investigated in fasted lymph cannulated canines. Two different structured triglycerides were incorporated into the SMEDDS; 1,3-dioctanoyl-2-linoleyl-sn-glycerol (C8:0-C18:2-C8:0) (MLM) and 1,3-dilinoyl-2-octanoyl-sn-glycerol (C18:2-C8:0-C18:2) (LML). A previously optimised...... availability was affected by the triglyceride incorporated into the multi-component delivery system and availabilities of 56.9% (MLM) and 37.2% (LML) were found. These data indicate that the pharmaceutical scientist can use the structure of the lipid to affect the relative contribution of the two absorption...
A novel strategy for screening blood donors for syphilis at Komfo Anokye Teaching Hospital, Ghana
DEFF Research Database (Denmark)
Sarkodie, F; Ullum, H; Owusu-Dabo, E
2016-01-01
OBJECTIVE: To implement and describe a novel syphilis screening strategy for blood donors. BACKGROUND: The seroprevalence of syphilis in blood donors is often high in low- and middle-income countries (LMIC) although the proportion of infectious donations is probably low. Syphilis screening may...... not happen at all; or the use of non-specific screening tests, which have high false positive rates, results in many donations being discarded unnecessarily. This can have a critical effect on already inadequate blood supplies. MATERIALS AND METHODS: Blood donors were screened at the time of donation...... negative were released to stock and test-positive units discarded. RESULTS: Of the 2213 blood donors, 182 (8·2%; 182/2213) screened positive by RDT. In addition, 38 out of these 182 (20·9%) were RPR positive on post-donation testing. Over 2 months there was a 79% reduction in blood units discarded due...
Energy Technology Data Exchange (ETDEWEB)
Tárkányi, F.; Ditrói, F.; Takács, S. [Institute of Nuclear Research (ATOMKI), Debrecen (Hungary); Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Department, Vrije Universiteit Brussel, (VUB), Brussels (Belgium)
2017-01-15
New experimental excitation functions for proton induced reactions on {sup nat}W are presented in the 32–65 MeV energy range. The cross-sections for {sup nat}W(p,xn){sup 186,184m,184g,183,} {sup 182m,182g,181}Re, {sup nat}W(p,x){sup 178}W{sup ,} {sup nat}W(p,x){sup 183,182,} {sup 180m,} {sup 177,176,175}Ta, {sup 175}Hf and {sup 177}Lu were measured via an activation method by using a stacked-foil irradiation technique and high resolution gamma-ray spectroscopy. The results were compared with predicted values obtained with the nuclear reaction code TALYS (results taken from the TENDL 2014 and TENDL 2015 on-line libraries). Production routes of the medically relevant radionuclides {sup 186}Re, the {sup 178}W → {sup 178}Ta generator and {sup 181}W are discussed.
Effect of CLA and other C18 unsaturated fatty acids on DGAT in bovine milk fat biosynthetic systems.
Sørensen, Brent M; Chris Kazala, E; Murdoch, Gordon K; Keating, Aileen F; Cruz-Hernandez, Cristina; Wegner, Jochen; Kennelly, John J; Okine, Erasmus K; Weselake, Randall J
2008-10-01
Production of dairy products with increased amounts of nutraceutic FA such as conjugated linoleic acid (CLA) represents a recent approach for dairy producers and processors to increase the value of their products. The effect of CLA and other FA on the expression of diacylglycerol acyltransferase-1 (DGAT-1) and DGAT-2, and DGAT activity were investigated in bovine mammary gland epithelial (MAC-T) cells. DGAT gene expression analyses were also conducted using bovine mammary gland tissue from dairy cows. In the studies with MAC-T cells, there were no significant effects of CLA isomers or other FA on DGAT1 expression, whereas all FA tested showed enhanced DGAT2 expression (P < 0.05 to P < 0.001), with alpha-linolenic acid (alpha-18:3) having the greatest effect. Additionally, DGAT2 expression was co-ordinated with expression of lysophosphatidic acid acyltransferase (LPAAT), an observation that was also apparent in mammary gland from lactating dairy cows. In contrast, treatment of MAC-T cells with trans-10, cis-12 18:2 or alpha-18:3 resulted in a significant (P < 0.05) decrease in overall DGAT enzyme activity, although the mechanisms resulting in these effects are unclear. Competition assays using microsomes from bovine mammary gland tissue and 1-[(14)C]oleoyl-CoA suggested that DGAT activity was more selective for oleoyl (cis-9 18:1)-CoA than cis-9, trans-11 18:2-, trans-10, cis-12 18:2- or cis-9, cis-12 18:2-CoA. Collectively, the results suggest the relationship between trans-10, cis-12 18:2 and reduced TAG production in bovine milk is not linked to the production of DGAT1 or DGAT2 transcripts, but probably involves effects of this CLA isomer at events beyond transcription, such as post-translational and/or enzyme activity effects.
Distinct metal-exchange pathways of doped Ag25 nanoclusters
Bootharaju, Megalamane Siddaramappa
2016-09-09
Atomically precise metal nanoclusters (NCs) containing more than one type of metal atom (i.e., doped or alloyed), due to synergistic effects, open new avenues for engineering the catalytic and optical properties of NCs in a manner that homometal NCs cannot. Unfortunately, it is still a major challenge to controllably introduce multimetallic dopants in NCs, understanding the dopants\\' positions, mechanism, and synergistic effects. To overcome these challenges, we designed a metal-exchange approach involving NCs as molecular templates and metal ions as the source of the incoming dopant. In particular, two structurally similar monodoped silver-rich NCs, [MAg24(SR)(18)](2-) (M = Pd/Pt and SR: thiolate), were synthesized as templates to study their mechanistic transformation in response to the introduction of gold atoms. The controllable incorporation of Au atoms into the MAg24 framework facilitated the elucidation of distinct doping pathways through high-resolution mass spectrometry, optical spectroscopy and elemental analysis. Interestingly, gold replaced the central Pd atom of [PdAg24(SR)(18)](2-) clusters to produce predominantly bimetallic [AuAg24(SR)(18)](-) clusters along with a minor product of an [Au2Ag23(SR)(18)](-) cluster. In contrast, the central Pt atom remained intact in [PtAg24(SR)(18)](2-) clusters, and gold replaced the noncentral Ag atoms to form trimetallic [AuxPtAg24-x(SR)(18)](2-) NCs, where x = 1-2, with a portion of the starting [PtAg24(SR)(18)](2-) NCs remaining. This study reveals some of the unusual metal-exchange pathways of doped NCs and the important role played by the initial metal dopant in directing the position of a second dopant in the final product.
International Nuclear Information System (INIS)
Sekharam, K.M.; Patel, J.M.; Block, E.R.
1990-01-01
Vitamin E, a dietary antioxidant, is presumed to be incorporated into the lipid bilayer of biological membranes to an extent proportional to the amount of polyunsaturated fatty acids or phospholipids in the membrane. In the present study we evaluated the distribution of incorporated polyunsaturated fatty acids (PUFA) and phosphatidylethanolamine (PE) in various membranes of pulmonary artery endothelial cells. We also studied whether incorporation of PUFA or PE is responsible for increased incorporation of [3H]-vitamin E into the membranes of these cells. Following a 24-hr incubation with linoleic acid (18:2), 18:2 was increased by 6.9-, 9.2-, and 13.2-fold in plasma, mitochondrial, and microsomal membranes, respectively. Incorporation of 18:2 caused significant increases in the unsaturation indexes of mitochondrial and microsomal polyunsaturated fatty acyl chains (P less than .01 versus control in both membranes). Incubation with arachidonic acid (20:4) for 24 hr resulted in 1.5-, 2.3-, and 2.4-fold increases in 20:4 in plasma, mitochondrial, and microsomal membranes, respectively. The unsaturation indexes of polyunsaturated fatty acyl chains of mitochondrial and microsomal membranes also increased (P less than .01 versus control in both membranes). Although incubations with 18:2 or 20:4 resulted in several-fold increases in membrane 18:2 or 20:4 fatty acids, incorporation of [3H]-vitamin E into these membranes was similar to that in controls. Following a 24-hr incubation with PE, membrane PE content was significantly increased, and [3H]-vitamin E incorporation was also increased to a comparable degree, i.e., plasma membrane greater than mitochondria greater than microsomes. Endogenous vitamin E content of the cells was not altered because of increased incorporation of PE and [3H]-vitamin E
Energy Technology Data Exchange (ETDEWEB)
Wang, Daojing; Huang, Jing; Hu, Zhi
2011-11-15
RNA helicase DDX5 (also p68) is involved in all aspects of RNA metabolism and serves as a transcriptional co-regulator, but its functional role in breast cancer remains elusive. Here, we report an integrative biology study of DDX5 in breast cancer, encompassing quantitative proteomics, global MicroRNA profiling, and detailed biochemical characterization of cell lines and human tissues. We showed that protein expression of DDX5 increased progressively from the luminal to basal breast cancer cell lines, and correlated positively with that of CD44 in the basal subtypes. Through immunohistochemistry analyses of tissue microarrays containing over 200 invasive human ductal carcinomas, we observed that DDX5 was upregulated in the majority of malignant tissues, and its expression correlated strongly with those of Ki67 and EGFR in the triple-negative tumors. We demonstrated that DDX5 regulated a subset of MicroRNAs including miR-21 and miR-182 in basal breast cancer cells. Knockdown of DDX5 resulted in reorganization of actin cytoskeleton and reduction of cellular proliferation. The effects were accompanied by upregulation of tumor suppressor PDCD4 (a known miR-21 target); as well as upregulation of cofilin and profilin, two key proteins involved in actin polymerization and cytoskeleton maintenance, as a consequence of miR-182 downregulation. Treatment with miR-182 inhibitors resulted in morphologic phenotypes resembling those induced by DDX5 knockdown. Using bioinformatics tools for pathway and network analyses, we confirmed that the network for regulation of actin cytoskeleton was predominantly enriched for the predicted downstream targets of miR-182. Our results reveal a new functional role of DDX5 in breast cancer via the DDX5→miR-182→actin cytoskeleton pathway, and suggest the potential clinical utility of DDX5 and its downstream MicroRNAs in the theranostics of breast cancer.