International Nuclear Information System (INIS)
Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated
Low temperature heat capacity of lutetium and lutetium hydrogen alloys
International Nuclear Information System (INIS)
Thome, D.K.
1977-10-01
The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium
Lutetium oxide-based transparent ceramic scintillators
Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.
2016-01-19
In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.
Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride
Energy Technology Data Exchange (ETDEWEB)
Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)
2014-11-15
Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.
International Nuclear Information System (INIS)
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.
PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid
International Nuclear Information System (INIS)
Kostromina, N.A.; Novikova, L.B.
1975-01-01
Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined
Saturated vapor pressure of lutetium tris-acetylacetonate
Energy Technology Data Exchange (ETDEWEB)
Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))
1983-12-01
By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.
First principles study of electronic, elastic and thermal properties of lutetium intermetallics
International Nuclear Information System (INIS)
Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.
2011-01-01
In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)
International Nuclear Information System (INIS)
Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe
2008-01-01
We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer
Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex
Energy Technology Data Exchange (ETDEWEB)
Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)
2016-05-28
The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.
International Nuclear Information System (INIS)
Warmińska, Dorota; Wawer, Jarosław
2012-01-01
Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.
Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium
International Nuclear Information System (INIS)
Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2006-01-01
The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)
Thermal decomposition of lutetium propionate
DEFF Research Database (Denmark)
Grivel, Jean-Claude
2010-01-01
The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Energy Technology Data Exchange (ETDEWEB)
Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)
2017-11-15
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.
2017-11-01
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Separation of thulium, ytterbium and lutetium from uranium
International Nuclear Information System (INIS)
Lopez, G.H.
1987-01-01
The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)
International Nuclear Information System (INIS)
Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer
2007-01-01
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film
Independent fissile inventory verification in a large tank employing lutetium double spikes
International Nuclear Information System (INIS)
Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.
1987-01-01
A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas
DOTA-TATE peptides labelling with Lutetium 177: Preliminary study
International Nuclear Information System (INIS)
Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor
2014-01-01
he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).
Energy Technology Data Exchange (ETDEWEB)
Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr
2007-11-09
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.
Effect of pressure on the bandstructure and superconductivity in lutetium
International Nuclear Information System (INIS)
Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.
1984-08-01
The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)
International Nuclear Information System (INIS)
Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.
1997-01-01
With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)
Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators
International Nuclear Information System (INIS)
Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.
2007-01-01
For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV
X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.
1985-01-01
An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)
Hyperfine interactions in 111Cd-doped lutetium sesquioxide
International Nuclear Information System (INIS)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.
1999-01-01
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample
Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium
International Nuclear Information System (INIS)
Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false General. 668.171 Section 668.171 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Financial Responsibility § 668.171 General. (a...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Appeals. 171.22 Section 171.22 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Executive Order 12958 Provisions § 171.22 Appeals. Any denial of a mandatory declassification review request...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.117 Section 171.117... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Simplified Directional Facility (SDF) § 171.117 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the time...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 171.12 Section 171... RESPONSIBILITY ACTIONS General Provisions § 171.12 Settlement. At any time before the Commission has reached a... settlement agreement. If, in its view, the settlement is consistent with the public interest, the Commission...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.33 Section 171.33 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Nondirectional Radio Beacon Facilities § 171.33 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.53 Section 171.53 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Instrument Landing System (ILS) Facilities § 171.53 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.213 Section 171.213... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VHF Marker Beacons § 171.213 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times indicated, to the...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
Optical emission spectrographic analysis of lutetium oxide for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Dixit, V.S.
1986-01-01
An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)
2010-01-01
... 7 Agriculture 9 2010-01-01 2009-01-01 true Reports. 1150.171 Section 1150.171 Agriculture... Order Reports, Books and Records § 1150.171 Reports. Each producer marketing milk of that producer's own... collection of the assessment under § 1150.152 shall be required to report at the time for remitting...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.13 Section 171.13 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VOR Facilities § 171.13 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by the FAA, at the times...
International Nuclear Information System (INIS)
Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel
2013-01-01
Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions
Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide
Energy Technology Data Exchange (ETDEWEB)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)
1999-09-15
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.
Neutron capture cross section measurements: case of lutetium isotopes
International Nuclear Information System (INIS)
Roig, O.; Meot, V.; Belier, G.
2011-01-01
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering
Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A
2017-07-01
Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.
46 CFR 160.171-9 - Construction.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.171-9 Section 160.171-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-9 Construction. (a) General. Each...
46 CFR 160.171-11 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.171-11 Section 160.171-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-11 Performance. (a) Buoyancy. Each...
22 CFR 171.21 - Declassification review.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Declassification review. 171.21 Section 171.21 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Executive Order 12958 Provisions § 171.21 Declassification review. (a) Scope. All information...
22 CFR 171.13 - Business information.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Business information. 171.13 Section 171.13 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Freedom of Information Act Provisions § 171.13 Business information. (a) Business information...
7 CFR 3015.171 - Unused supplies.
2010-01-01
..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.171 Unused supplies. (a) If unused supplies exceeding $1,000 in total aggregate market value are left over upon termination or... 7 Agriculture 15 2010-01-01 2010-01-01 false Unused supplies. 3015.171 Section 3015.171...
International Nuclear Information System (INIS)
Hu, Andrew Teh; Hu Tenyi; Liu Lungchang
2003-01-01
Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )
49 CFR 171.3 - Hazardous waste.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hazardous waste. 171.3 Section 171.3... waste. (a) No person may offer for transportation or transport a hazardous waste (as defined in § 171.8... waste for which a manifest is required unless that person: (1) Has marked each motor vehicle used to...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h
36 CFR 406.171-406.999 - [Reserved
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.171-406.999 Section 406.171-406.999 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.171-406.999 [Reserved] ...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 171.31 Section 171.31 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC... Department, including, but not limited to education, financial transactions, medical history, and criminal or...
45 CFR 2490.171-2490.999 - [Reserved
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.171-2490.999 Section 2490.171-2490.999 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.171-2490.999 [Reserved] ...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.275 Section 171.275... Reports. The owner of the ISMLS facility or his maintenance representative must make the following reports... the need for periodic maintenance visits to the facility, monthly reports from the remote monitoring...
22 CFR 171.40 - Purpose and scope.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose and scope. 171.40 Section 171.40... PUBLIC Ethics in Government Act Provisions § 171.40 Purpose and scope. This subpart sets forth the... 2634, require that high-level Federal officials disclose publicly their personal financial interests. ...
49 CFR 28.171-28.999 - [Reserved
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.171-28.999 Section 28.171-28.999 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.171-28.999 [Reserved] ...
Electrochromism of solid films of blue form of lutetium phthalocyanine complexe
Energy Technology Data Exchange (ETDEWEB)
Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V
1986-12-01
Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 17.1 Section 17.1 Food and Drugs FOOD AND... Food, Drug, and Cosmetic Act (the act) authorizing civil money penalties for certain violations of the... trial data bank and section 303(f)(4) of the act authorizing civil money penalties for certain...
Labelling of the peptide Dota-Octreotate with Lutetium 177
International Nuclear Information System (INIS)
Hernandez B, C.A.
2004-01-01
In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
14 CFR 171.269 - Marker beacon performance requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Marker beacon performance requirements. 171.269 Section 171.269 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Landing System (ISMLS) § 171.269 Marker beacon performance requirements. ISMLS marker beacon equipment...
17 CFR 171.28 - Participation by Commission staff.
2010-04-01
... staff. 171.28 Section 171.28 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION..., Membership Denial and Registration Actions § 171.28 Participation by Commission staff. The Division of.... The Commission shall by order establish a supplementary briefing schedule for the Commission staff and...
22 CFR 171.12 - Processing requests.
2010-04-01
... inform the public concerning actual or alleged Federal Government activity. News media requesters would.... Ordinarily this means a breaking news story of general public interest. Information of historical interest... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Processing requests. 171.12 Section 171.12...
48 CFR 203.171-2 - Definition.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definition. 203.171-2..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 203.171-2 Definition. Covered DoD official as used in this section, is defined in the clause at 252.203...
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 207.171-3 Section... DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.171-3 Policy. DoD policy is to... it is anticipated that a prime contract will be awarded without adequate price competition, and the...
40 CFR 205.171 - Selective enforcement auditing (SEA) requirements.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing (SEA) requirements. 205.171 Section 205.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 205.171 Selective enforcement auditing (SEA) requirements. ...
Energy Technology Data Exchange (ETDEWEB)
Loeser, Anastassia
2016-09-28
The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.
46 CFR 171.118 - Automatic ventilators and side ports.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Automatic ventilators and side ports. 171.118 Section 171.118 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY... Bulkhead or Weather Deck § 171.118 Automatic ventilators and side ports. (a) An automatic ventilator must...
46 CFR 171.100 - Shaft tunnels and stern tubes.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Shaft tunnels and stern tubes. 171.100 Section 171.100... PERTAINING TO VESSELS CARRYING PASSENGERS Additional Subdivision Requirements § 171.100 Shaft tunnels and... passengers on an international voyage. (b) The watertight seal in the bulkhead between the stern tube space...
Level Densities and Radiative Strength Functions in 170,171Yb
International Nuclear Information System (INIS)
Agvaanluvsan, U.; Schiller, A.; Becker, J.A.; Berstein, L.A.; Guttormsen, M.; Mitchell, G.E.; Rekstad, J.; Siem, S.; Voinov, A.
2003-01-01
Level densities and radiative strength functions in 171 Yb and 170 Yb nuclei have been measured with the 171 Yb( 3 He, 3 He(prime) γ) 171 Yb and 171 Yb( 3 He, αγ) 170 Yb reactions. A simultaneous determination of the nuclear level density and the radiative strength function was made. The present data adds to and is consistent with previous results for several other rare earth nuclei. The method will be briefly reviewed and the result from the analysis will be presented. The radiative strength function for 171 Yb is compared to previously published work.
Energy Technology Data Exchange (ETDEWEB)
Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)
2006-07-01
solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)
40 CFR 265.171 - Condition of containers.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 265.171... DISPOSAL FACILITIES Use and Management of Containers § 265.171 Condition of containers. If a container... transfer the hazardous waste from this container to a container that is in good condition, or manage the...
40 CFR 264.171 - Condition of containers.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 264.171... Use and Management of Containers § 264.171 Condition of containers. If a container holding hazardous... leak, the owner or operator must transfer the hazardous waste from this container to a container that...
International Nuclear Information System (INIS)
Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de
2008-01-01
In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process
40 CFR 171.3 - Categorization of commercial applicators of pesticides.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Categorization of commercial applicators of pesticides. 171.3 Section 171.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS CERTIFICATION OF PESTICIDE APPLICATORS § 171.3 Categorization of commercial...
12 CFR 410.171-410.999 - [Reserved
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.171-410.999 Section 410.171-410.999 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...
40 CFR 141.171 - Criteria for avoiding filtration.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...
29 CFR 1952.171 - Where the plan may be inspected.
2010-07-01
... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.171 Section 1952.171..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS California § 1952.171...
Energy Technology Data Exchange (ETDEWEB)
Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)
2008-10-31
In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.
Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C
2014-02-01
Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum
K-electron capture probability in 171Lu
International Nuclear Information System (INIS)
Mishra, N.R.; Vara Prasad, N.V.S.; Chandrasekhara Rao, M.V.S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.
1999-01-01
The K-electron capture probability in the decay of 171 Lu to the 835.06 keV level of the daughter nucleus 171 Yb is measured to be 0.822 ± 0.027 involving two transitions, in agreement with the theoretical value 0.833. The experimental value is seen to be consistent with the mass prediction of the relationship due to Wapstra and Bos. (author)
Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications
Directory of Open Access Journals (Sweden)
Kamal Yavari
2012-06-01
Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical. Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h. Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours. Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.
46 CFR 67.171 - Deletion; requirement and procedure.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Deletion; requirement and procedure. 67.171 Section 67...; Requirement for Exchange, Replacement, Deletion, Cancellation § 67.171 Deletion; requirement and procedure. (a... provided in § 67.161, and the vessel is subject to deletion from the roll of actively documented vessels...
42 CFR 456.171 - Medicaid agency review of need for admission.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Medicaid agency review of need for admission. 456.171 Section 456.171 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND... Hospitals Medical, Psychiatric, and Social Evaluations and Admission Review § 456.171 Medicaid agency review...
Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals
Energy Technology Data Exchange (ETDEWEB)
Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry
2017-01-15
The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.
49 CFR 17.1 - What is the purpose of these regulations?
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false What is the purpose of these regulations? 17.1 Section 17.1 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.1 What is the purpose of these regulations? (a) The...
International Nuclear Information System (INIS)
Silva, Giovana Pasqualini da
2008-01-01
The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
40 CFR 205.171-2 - Test exhaust system sample selection and preparation.
2010-07-01
... Systems § 205.171-2 Test exhaust system sample selection and preparation. (a)(1) Exhaust systems... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test exhaust system sample selection and preparation. 205.171-2 Section 205.171-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix
Directory of Open Access Journals (Sweden)
Marc Debliquy
2018-03-01
Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.
RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE
V. A. Ivchin; K. Y. Samsonov
2014-01-01
The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter) flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.
9 CFR 381.171 - Definition and standard for “Turkey Ham.”
2010-01-01
... Ham.â 381.171 Section 381.171 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Standards of Identity or Composition § 381.171 Definition and standard for “Turkey Ham.” (a) “Turkey Ham... label shall show the word “Turkey” in the same size, style, color, and with the same background as the...
40 CFR 171.5 - Standards for certification of private applicators.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Standards for certification of private applicators. 171.5 Section 171.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... practical knowledge of the pest problems and pest control practices associated with his agricultural...
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1992-01-01
The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)
RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE
Directory of Open Access Journals (Sweden)
V. A. Ivchin
2014-01-01
Full Text Available The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.
Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.
Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M
2006-10-01
Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in
26 CFR 1.381(c)(17)-1 - Deficiency dividend of personal holding company.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deficiency dividend of personal holding company. 1.381(c)(17)-1 Section 1.381(c)(17)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(17)-1...
25 CFR 171.310 - Can I use water delivered by BIA for livestock purposes?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Can I use water delivered by BIA for livestock purposes? 171.310 Section 171.310 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND MAINTENANCE Water Use § 171.310 Can I use water delivered by BIA for livestock...
Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.
Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J
2015-01-01
Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.
25 CFR 171.305 - Will BIA provide leaching service to me?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Will BIA provide leaching service to me? 171.305 Section... OPERATION AND MAINTENANCE Water Use § 171.305 Will BIA provide leaching service to me? (a) We may provide you leaching service if: (1) You submit a written plan that documents how soil salinity limits your...
14 CFR 171.109 - Performance requirements.
2010-01-01
... communications to that due to the identification signal is approximately 9:1. (iii) The audio frequency... interfere in any way with the basic SDF function. (ii) The identification signal must be produced by Class... standards and tolerances contained in § 171.111(j). (d) The monitor system must provide a warning to the...
42 CFR 423.171 - Procedures for approval of accreditation as a basis for deeming compliance.
2010-10-01
... BENEFIT Cost Control and Quality Improvement Requirements § 423.171 Procedures for approval of... 42 Public Health 3 2010-10-01 2010-10-01 false Procedures for approval of accreditation as a basis for deeming compliance. 423.171 Section 423.171 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES...
Displaying of formation of atomic clusters in radioactive lutetium oxide films
International Nuclear Information System (INIS)
Kartashov, V.M.; Troitskata, A.G.
2002-01-01
We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds
Harrington, Robert D; Herrmann-Hoesing, Lynn M; White, Stephen N; O'Rourke, Katherine I; Knowles, Donald P
2009-01-22
Selective breeding of sheep for arginine (R) at prion gene (PRNP) codon 171 confers resistance to classical scrapie. However, other effects of 171R selection are uncertain. Ovine progressive pneumonia/Maedi-Visna virus (OPPV) may infect up to 66% of a flock thus any affect of 171R selection on OPPV susceptibility or disease progression could have major impact on the sheep industry. Hypotheses that the PRNP 171R allele is 1) associated with the presence of OPPV provirus and 2) associated with higher provirus levels were tested in an Idaho ewe flock. OPPV provirus was found in 226 of 358 ewes by quantitative PCR. The frequency of ewes with detectable provirus did not differ significantly among the 171QQ, 171QR, and 171RR genotypes (p > 0.05). Also, OPPV provirus levels in infected ewes were not significantly different among codon 171 genotypes (p > 0.05). These results show that, in the flock examined, the presence of OPPV provirus and provirus levels are not related to the PRNP 171R allele. Therefore, a genetic approach to scrapie control is not expected to increase or decrease the number of OPPV infected sheep or the progression of disease. This study provides further support to the adoption of PRNP 171R selection as a scrapie control measure.
Directory of Open Access Journals (Sweden)
Herrmann-Hoesing Lynn M
2009-01-01
Full Text Available Abstract Selective breeding of sheep for arginine (R at prion gene (PRNP codon 171 confers resistance to classical scrapie. However, other effects of 171R selection are uncertain. Ovine progressive pneumonia/Maedi-Visna virus (OPPV may infect up to 66% of a flock thus any affect of 171R selection on OPPV susceptibility or disease progression could have major impact on the sheep industry. Hypotheses that the PRNP 171R allele is 1 associated with the presence of OPPV provirus and 2 associated with higher provirus levels were tested in an Idaho ewe flock. OPPV provirus was found in 226 of 358 ewes by quantitative PCR. The frequency of ewes with detectable provirus did not differ significantly among the 171QQ, 171QR, and 171RR genotypes (p > 0.05. Also, OPPV provirus levels in infected ewes were not significantly different among codon 171 genotypes (p > 0.05. These results show that, in the flock examined, the presence of OPPV provirus and provirus levels are not related to the PRNP 171R allele. Therefore, a genetic approach to scrapie control is not expected to increase or decrease the number of OPPV infected sheep or the progression of disease. This study provides further support to the adoption of PRNP 171R selection as a scrapie control measure.
47 CFR 17.1 - Basis and purpose.
2010-10-01
... antenna structure owners. The standards are referenced from two Federal Aviation Administration (FAA... STRUCTURES General Information § 17.1 Basis and purpose. (a) The rules in this part are issued pursuant to the authority contained in Title III of the Communications Act of 1934, as amended, which vest...
Directory of Open Access Journals (Sweden)
Xudong Zhu
2015-07-01
Full Text Available The microRNA171 (miR171 family is widely distributed and highly conserved in a range of species and plays critical roles in regulating plant growth and development through repressing expression of ( transcription factors. However, information on the evolutionary conservation and functional diversification of the miRNA171 family members remains scanty. We reconstructed the phylogenetic relationships among miR171 precursor and mature sequences so as to investigate the extent and degree of evolutionary conservation of miR171 in (L. Heynh. (ath, grape ( L. (vvi, poplar ( Torr. & A.Gray ex Hook. (ptc, and rice ( L. (osa. Despite strong conservation of over 80%, some mature miR171 sequences, such as , and and , -, and -, have undergone critical sequence variation, leading to functional diversification, since they target non gene transcript(s. Phylogenetic analyses revealed a combination of old ancestral relationships and recent lineage-specific diversification in the miR171 family within the four model plants. The -regulatory motifs on the upstream promoter sequences of genes were highly divergent and shared some similar elements, indicating their possible contribution to the functional variation observed within the miR171 family. This study will buttress our understanding of the functional differentiation of miRNAs and the relationships of miRNA–target pairs based on the evolutionary history of genes.
12 CFR 308.171 - Responses to application.
2010-01-01
... PRACTICE AND PROCEDURE Rules and Procedures Relating to the Recovery of Attorney Fees and Other Expenses § 308.171 Responses to application. (a) By FDIC. (1) Within 20 days after service of an application... statement of intent to negotiate under § 308.179 of this subpart, failure to file an answer within the 20...
Energy Technology Data Exchange (ETDEWEB)
Hernandez B, C.A
2004-07-01
In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
21 CFR 14.171 - Utilization of an advisory committee on the initiative of FDA.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Utilization of an advisory committee on the initiative of FDA. 14.171 Section 14.171 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... technical advisory committee for human prescription drugs. The Commissioner's determinations on the agenda...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Property held for future telecommunications use-Account 2002; Telecommunications plant under construction-Account 2003; and Telecommunications plant adjustment-Account 2005. 36.171 Section 36.171 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED...
Energy Technology Data Exchange (ETDEWEB)
Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2012-04-16
Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the
48 CFR 3009.171-3 - Determination of eligibility for award of FPS guard service contracts.
2010-10-01
... eligibility for award of FPS guard service contracts. 3009.171-3 Section 3009.171-3 Federal Acquisition... eligibility for award of FPS guard service contracts. (a) Contracting officers shall make a determination of eligibility for award of FPS guard service contracts upon identification of the apparent successful offeror as...
Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium
International Nuclear Information System (INIS)
Bretheau-Raynal, Francoise
1981-01-01
Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr
22 CFR 171.44 - Improper use of reports.
2010-04-01
... PUBLIC Ethics in Government Act Provisions § 171.44 Improper use of reports. (a) The Attorney General may bring a civil action against any person who obtains or uses a financial disclosure report: (1) For any... person who obtains or uses the reports for these prohibited purposes. Such remedy shall be in addition to...
40 CFR 205.171-3 - Test motorcycle sample selection.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test motorcycle sample selection. 205... ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.171-3 Test motorcycle sample selection. A test motorcycle to be used for selective enforcement audit testing...
46 CFR 171.065 - Subdivision requirements- Type I.
2010-10-01
... the following: (i) 0.6LN (0.056LN) where— N=the total number of passengers; and L=LBP in feet (meters... bulkhead deck. EC01MR91.021 Table 171.065(a) (English units) Vessel length (LBP) Criterion numeral (CN) FS CN less than or equal to 23 A Vessel length greater than 392 feet CN greater than 23 and less than...
2010-01-01
... of the portfolio company. Examples of the types of actions that may be subject to these types of... operating a portfolio company held as a merchant banking investment? 225.171 Section 225.171 Banks and... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Merchant Banking Investments § 225.171 What...
Potential probiotic of Lactobacillus johnsonii LT171 for chicken ...
African Journals Online (AJOL)
The objective of this research was to investigate the potential probiotic of Lactobacillus johnsonii LT171. It had aggregation (60 min) and antibacterial effects against Salmonella Enteritidis, Salmonella Typhimurium and Escherichia coli O78:K80. It showed amylase and protease activity and high clear zone in culture medium ...
21 CFR 171.7 - Withdrawal of petition without prejudice.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Withdrawal of petition without prejudice. 171.7... Withdrawal of petition without prejudice. (a) In some cases the Commissioner will notify the petitioner that... clarification or the obtaining of additional data. This withdrawal will be without prejudice to a future filing...
International Nuclear Information System (INIS)
Hee, Chee Seng; Gao, Song; Miller, Marcia M.; Goto, Ronald M.; Ziegler, Andreas; Daumke, Oliver; Uchanska-Ziegler, Barbara
2009-01-01
The chicken classical MHC class I antigen YF1*7.1 was crystallized together with β 2 -microglobulin but without a peptide ligand. Crystals diffracted synchrotron radiation to 1.32 Å and belonged to the monoclinic space group P2 1 . YF1*7.1 is an allele of a polymorphic major histocompatibility complex (MHC) class I-like locus within the chicken Y gene complex. With the aim of understanding the possible role of the YF1*7.1 molecule in antigen presentation, the complex of YF1*7.1 heavy chain and β 2 -microglobulin was reconstituted and purified without a peptide. Crystals diffracted synchrotron radiation to 1.32 Å resolution and belonged to the monoclinic space group P2 1 . The phase problem was solved by molecular replacement. A detailed examination of the structure may provide insight into the type of ligand that could be bound by the YF1*7.1 molecule
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
2009-01-01
Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even
40 CFR 267.171 - What standards apply to the containers?
2010-07-01
... STANDARDIZED PERMIT Use and Management of Containers § 267.171 What standards apply to the containers... to the management of the containers. (a) Condition of containers. If a container holding hazardous... that are compatible and will not react with the hazardous waste to be stored. (c) Management of...
14 CFR 171.321 - DME and marker beacon performance requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false DME and marker beacon performance... (MLS) § 171.321 DME and marker beacon performance requirements. (a) The DME equipment must meet the..._regulations/ibr_locations.html. (b) MLS marker beacon equipment must meet the performance requirements...
Gene expression profiling in colon of mice exposed to food additive titanium dioxide (E171).
Proquin, Héloïse; Jetten, Marlon J; Jonkhout, Marloes C M; Garduño-Balderas, Luis G; Briedé, Jacob J; de Kok, Theo M; Chirino, Yolanda I; van Loveren, Henk
2018-01-01
Dietary factors that may influence the risks of colorectal cancer, including specific supplements, are under investigation. Previous studies showed the capacity of food additive titanium dioxide (E171) to induce DNA damage in vitro and facilitate growth of colorectal tumours in vivo. This study aimed to investigate the molecular mechanisms behind these effects after E171 exposure. BALB/c mice were exposed by gavage to 5 mg/kg bw /day of E171 for 2, 7, 14, and 21 days. Transcriptome changes were studied by whole genome mRNA microarray analysis on the mice's distal colons. In addition, histopathological changes as well as a proliferation marker were analysed. The results showed significant gene expression changes in the olfactory/GPCR receptor family, oxidative stress, the immune system and of cancer related genes. Transcriptome analysis also identified genes that thus far have not been included in known biological pathways and can induce functional changes by interacting with other genes involved in different biological pathways. Histopathological analysis showed alteration and disruption in the normal structure of crypts inducing a hyperplastic epithelium. At cell proliferation level, no consistent increase over time was observed. These results may offer a mechanistic framework for the enhanced tumour growth after ingestion of E171 in BALB/c mice. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)
2011-07-15
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering
2010-01-01
... Annual Statutory Financial Statement be filed. 400.171 Section 400.171 Agriculture Regulations of the... filing an Annual Statutory Financial Statement must, in addition to the requirements of § 400.170 (a), (b), (c) and (d), submit an Annual Statutory Financial Statement audited by a Certified Public Accountant...
The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta
International Nuclear Information System (INIS)
Turner, J.H.
2007-01-01
-limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at
Kwak, Dong Hoon; Moussavou, Ghislain; Lee, Ju Hyoung; Heo, Sung Youn; Ko, Kisung; Hwang, Kyung-A; Jekal, Seung-Joo; Choo, Young-Kug
2014-11-14
We have generated the transgenic Tabaco plants expressing multiple monoclonal antibody (mAb) CO7-1A × BR55 by cross-pollinating with mAb CO17-1A and mAb BR55. We have demonstrated the anti-cancer effect of plant-derived multiple mAb CO17-1A × BR55. We find that co-treatment of colorectal mAbs (anti-epithelial cellular adhesion molecule (EpCAM), plant-derived monoclonal antibody (mAb(P)) CO17-1A and mAb(P) CO17-1A × BR55) with RAW264.7 cells significantly inhibited the cell growth in SW620 cancer cells. In particular, multi mAb(P) CO17-1A × BR55 significantly and efficiently suppressed the growth of SW620 cancer cells compared to another mAbs. Apoptotic death-positive cells were significantly increased in the mAb(P) CO17-1A × BR55-treated. The mAb(P) CO17-1A × BR55 treatment significantly decreased the expression of B-Cell lymphoma-2 (BCl-2), but the expression of Bcl-2-associated X protein (Bax), and cleaved caspase-3 were markedly increased. In vivo, the mAb(P) CO17-1A × BR55 significantly and efficiently inhibited the growth of colon tumors compared to another mAbs. The apoptotic cell death and inhibition of pro-apoptotic proteins expression were highest by treatment with mAb(P) CO17-1A × BR55. In addition, the mAb(P) CO17-1A × BR55 significantly inhibited the extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation in cancer cells and tumors. Therefore, this study results suggest that multiple mAb(P) CO17-1A × BR55 has a significant effect on apoptosis-mediated anticancer by suppression of ERK1/2 phosphorylation in colon cancer compared to another mAbs. In light of these results, further clinical investigation should be conducted on mAb(P) CO17-1A × BR55 to determine its possible chemopreventive and/or therapeutic efficacy against human colon cancer.
46 CFR 171.017 - One and two compartment standards of flooding.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false One and two compartment standards of flooding. 171.017... standards of flooding. (a) One compartment standard of flooding. A vessel is designed to a one compartment standard of flooding if the margin line is not submerged when the total buoyancy between each set of two...
International Nuclear Information System (INIS)
Fernandez R, E.
2008-01-01
The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
International Nuclear Information System (INIS)
Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.
2008-01-01
Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)
Dorier, Marie; Béal, David; Marie-Desvergne, Caroline; Dubosson, Muriel; Barreau, Frédérick; Houdeau, Eric; Herlin-Boime, Nathalie; Carriere, Marie
2017-08-01
The whitening and opacifying properties of titanium dioxide (TiO 2 ) are commonly exploited when it is used as a food additive (E171). However, the safety of this additive can be questioned as TiO 2 nanoparticles (TiO 2 -NPs) have been classed at potentially toxic. This study aimed to shed some light on the mechanisms behind the potential toxicity of E171 on epithelial intestinal cells, using two in vitro models: (i) a monoculture of differentiated Caco-2 cells and (ii) a coculture of Caco-2 with HT29-MTX mucus-secreting cells. Cells were exposed to E171 and two different types of TiO 2 -NPs, either acutely (6-48 h) or repeatedly (three times a week for 3 weeks). Our results confirm that E171 damaged these cells, and that the main mechanism of toxicity was oxidation effects. Responses of the two models to E171 were similar, with a moderate, but significant, accumulation of reactive oxygen species, and concomitant downregulation of the expression of the antioxidant enzymes catalase, superoxide dismutase and glutathione reductase. Oxidative damage to DNA was detected in exposed cells, proving that E171 effectively induces oxidative stress; however, no endoplasmic reticulum stress was detected. E171 effects were less intense after acute exposure compared to repeated exposure, which correlated with higher Ti accumulation. The effects were also more intense in cells exposed to E171 than in cells exposed to TiO 2 -NPs. Taken together, these data show that E171 induces only moderate toxicity in epithelial intestinal cells, via oxidation.
International Nuclear Information System (INIS)
Zhang, Yanfeng; Gao, Xiaoli
2011-01-01
Recombinant wild-type l-lactate dehydrogenase from B. subtilis (BsLDH) was cocrystallized with fructose 1,6-bisphosphate and NAD + and the crystal diffracted to 2.38 Å resolution. The H171C mutant of BsLDH was also crystallized as the apoenzyme and in complex with NAD + and the crystals diffracted to 2.20 and 2.49 Å, respectively. All crystals belonged to space group P3. l-Lactate dehydrogenase (LDH) is an important enzyme involved in the last step of glycolysis that catalyzes the reversible conversion of pyruvate to l-lactate with the simultaneous oxidation of NADH to NAD + . In this study, wild-type LDH from Bacillus subtilis (BsLDH-WT) and the H171C mutant (BsLDH-H171C) were expressed in Escherichia coli and purified to near-homogeneity. BsLDH-WT was crystallized in the presence of fructose 1,6-bisphosphate (FBP) and NAD + and the crystal diffracted to 2.38 Å resolution. The crystal belonged to space group P3, with unit-cell parameters a = b = 171.04, c = 96.27 Å. BsLDH-H171C was also crystallized as the apoenzyme and in complex with NAD + , and data sets were collected to 2.20 and 2.49 Å resolution, respectively. Both BsLDH-H171C crystals belonged to space group P3, with unit-cell parameters a = b = 133.41, c = 99.34 Å and a = b = 133.43, c = 99.09 Å, respectively. Tetramers were observed in the asymmetric units of all three crystals
46 CFR 160.171-17 - Approval testing for adult size immersion suit.
2010-10-01
... test described in § 160.171-17(d). (c) Mobility and flotation tests. The mobility and flotation... suit at the beginning of the period of flotation by more than 200 grams. (11) Impact. While wearing a... is required for this test: (i) A sealed copper or aluminum can that has at least two parallel flat...
Energy Technology Data Exchange (ETDEWEB)
Silva, Giovana Pasqualini da
2008-07-01
The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
42 CFR 137.171 - Where do Self-Governance Tribes send their audit reports?
2010-10-01
... Provisions Audits and Cost Principles § 137.171 Where do Self-Governance Tribes send their audit reports? (a) For fiscal years ending on or before June 30, 1996, the audit report must be sent to: National... years, beginning after June 30, 1996, the audit report must be sent to: Single Audit Clearinghouse, 1201...
Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl
Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...
Kumari, Archana; Akkoç, Nefise; Akçelik, Mustafa
2012-04-01
Lactic acid bacteria (LAB) are possessing ability to synthesize antimicrobial compounds (like bacteriocin) during their growth. In this regard, novel bacteriocin compound secreting capability of LAB isolated from Tulum Cheese in Turkey was demonstrated. The synthesized bacteriocin was purified by ammonium sulphate precipitation, dialysis and gel filtration. The molecular weight (≈3.4 kDa) of obtained bacteriocin was confirmed by SDS-PAGE, which revealed single peptide band. Molecular identification of LAB strain isolated from Tulum Cheese was conducted using 16S rDNA gene sequencing as Lactococcus lactis ssp. lactis LL171. The amino acid sequences (KKIDTRTGKTMEKTEKKIELSLKNMKTAT) of the bacteriocin from Lactococcus lactis ssp. lactis LL171 was found unique and novel than reported bacteriocins. Further, the bacteriocin was possessed the thermostable property and active at wide range of pH values from 1 to 11. Thus, bacteriocin reported in this study has the potential applications property as food preservative agent.
Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert
2015-02-01
Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.
Time-of-flight and activation experiments on 147Pm and 171Tm for astrophysics
Guerrero, C.; Lerendegui-Marco, J.; Domingo-Pardo, C.; Casanovas, A.; Dressler, R.; Halfon, S.; Heinitz, S.; Kivel, N.; Köster, U.; Paul, M.; Quesada-Molina, J. M.; Schumann, D.; Tarifeño-Saldivia, A.; Tessler, M.; Weissman, L.; Aberle, O.; Andrzejewski, J.; Audouin, L.; Bacak, M.; Balibrea, J.; Barbagallo, M.; Becvar, F.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Caamaño, M.; Calviño, F.; Calviani, M.; Cano-Ott, D.; Cardella, R.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Damone, L. A.; Diakaki, M.; Dupont, E.; Durán, I.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Göbel, K.; García, A. R.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González, E.; Griesmayer, E.; Gunsing, F.; Harada, H.; Heyse, J.; Jenkins, D. G.; Jericha, E.; Käppeler, F.; Kadi, Y.; Kalamara, A.; Kavrigin, P.; Kimura, A.; Kivel, N.; Kokkoris, M.; Krticka, M.; Kurtulgil, D.; Leal-Cidoncha, E.; Lederer, C.; Leeb, H.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Marganiec, J.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Maugeri, E. A.; Mazzone, A.; Mendoza, E.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Porras, I.; Praena, J.; Radeck, D.; Rauscher, T.; Reifarth, R.; Rout, P. C.; Rubbia, C.; Ryan, J. A.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Tassan-Got, L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Warren, S.; Weiss, C.; Woods, P. J.; Wright, T.; Žugec, P.
2017-09-01
The neutron capture cross section of several key unstable isotopes acting as branching points in the s-process are crucial for stellar nucleosynthesis studies, but they are very challenging to measure due to the difficult production of sufficient sample material, the high activity of the resulting samples, and the actual (n,γ) measurement, for which high neutron fluxes and effective background rejection capabilities are required. As part of a new program to measure some of these important branching points, radioactive targets of 147Pm and 171Tm have been produced by irradiation of stable isotopes at the ILL high flux reactor. Neutron capture on 146Nd and 170Er at the reactor was followed by beta decay and the resulting matrix was purified via radiochemical separation at PSI. The radioactive targets have been used for time-of-flight measurements at the CERN n_TOF facility using the 19 and 185 m beam lines during 2014 and 2015. The capture cascades were detected using a set of four C6D6 scintillators, allowing to observe the associated neutron capture resonances. The results presented in this work are the first ever determination of the resonance capture cross section of 147Pm and 171Tm. Activation experiments on the same 147Pm and 171Tm targets with a high-intensity 30 keV quasi-Maxwellian flux of neutrons will be performed using the SARAF accelerator and the Liquid-Lithium Target (LiLiT) in order to extract the corresponding Maxwellian Average Cross Section (MACS). The status of these experiments and preliminary results will be presented and discussed as well.
Lu, Zhen; Marks, Eileen; Chen, Jianfang; Moline, Jenna; Barrows, Lorraine; Raisbeck, Merl; Volitakis, Irene; Cherny, Robert A; Chopra, Vanita; Bush, Ashley I; Hersch, Steven; Fox, Jonathan H
2014-11-01
Disruption of redox homeostasis is a prominent feature in the pathogenesis of Huntington's disease (HD). Selenium an essential element nutrient that modulates redox pathways and has been reported to provide protection against both acute neurotoxicity (e.g. methamphetamine) and chronic neurodegeneration (e.g. tauopathy) in mice. The objective of our study was to investigate the effect of sodium selenite, an inorganic form of selenium, on behavioral, brain degeneration and biochemical outcomes in the N171-82Q Huntington's disease mouse model. HD mice, which were supplemented with sodium selenite from 6 to 14 weeks of age, demonstrated increased motor endurance, decreased loss of brain weight, decreased mutant huntingtin aggregate burden and decreased brain oxidized glutathione levels. Biochemical studies revealed that selenite treatment reverted HD-associated changes in liver selenium and plasma glutathione in N171-82Q mice and had effects on brain selenoprotein transcript expression. Further, we found decreased brain selenium content in human autopsy brain. Taken together, we demonstrate a decreased selenium phenotype in human and mouse HD and additionally show some protective effects of selenite in N171-82Q HD mice. Modification of selenium metabolism results in beneficial effects in mouse HD and thus may represent a therapeutic strategy. Copyright © 2014 Elsevier Inc. All rights reserved.
Gao, Qi; Zhou, Min; Han, Chengyin; Li, Shangyan; Zhang, Shuang; Yao, Yuan; Li, Bo; Qiao, Hao; Ai, Di; Lou, Ge; Zhang, Mengya; Jiang, Yanyi; Bi, Zhiyi; Ma, Longsheng; Xu, Xinye
2018-05-22
Optical clocks are the most precise measurement devices. Here we experimentally characterize one such clock based on the 1 S 0 - 3 P 0 transition of neutral 171 Yb atoms confined in an optical lattice. Given that the systematic evaluation using an interleaved stabilization scheme is unable to avoid noise from the clock laser, synchronous comparisons against a second 171 Yb lattice system were implemented to accelerate the evaluation. The fractional instability of one clock falls below 4 × 10 -17 after an averaging over a time of 5,000 seconds. The systematic frequency shifts were corrected with a total uncertainty of 1.7 × 10 -16 . The lattice polarizability shift currently contributes the largest source. This work paves the way to measuring the absolute clock transition frequency relative to the primary Cs standard or against the International System of Units (SI) second.
19 CFR 171.24 - Remission of forfeitures and payment of fees, costs or interest.
2010-04-01
... Disposition of Petitions § 171.24 Remission of forfeitures and payment of fees, costs or interest. Any seizure... fees, costs or interest from the Government. [T.D. 00-88, 65 FR 78093, Dec. 14, 2000] ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Remission of forfeitures and payment of fees...
Detailed high-spin spectroscopy and the search for the wobbling mode in 171Ta
International Nuclear Information System (INIS)
Hartley, D J.; Mohr, W.H.; Vanhoy, J.R.
2005-01-01
High-spin states in 171 Ta were populated in the 124 Sn( 51 V,4n) reaction at 228 MeV to search for evidence of stable triaxial deformation. Identification of a wobbling sequence based on the previously known πi 13/2 structure would provide a unique signature for this rarely observed shape. No such sequence was identified in these data, which suggests that the island of triaxial strongly deformed bands may be smaller than once thought. However, over 200 new transitions and two new bands were placed in the level scheme and the sequence based on the πi 13/2 orbital could be observed up to spin and parity I π =(101/2 + ). The relative excitations of all the sequences were determined and the ground state of 171 Ta was found to have 5/2 + quantum numbers, contrary to previous reports. All of the previously known structures were extended to much higher spin and their high-frequency band crossings are interpreted within the framework of the cranked shell model
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de
2008-01-01
Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)
F-state quenching with CH4 for buffer-gas cooled 171Y b+ frequency standard
Directory of Open Access Journals (Sweden)
Y.-Y. Jau
2015-11-01
Full Text Available We report that methane, CH4, can be used as an efficient F-state quenching gas for trapped ytterbium ions. The quenching rate coefficient is measured to be (2.8 ± 0.3 × 106 s−1 Torr−1. For applications that use microwave hyperfine transitions of the ground-state 171Y b ions, the CH4 induced frequency shift coefficient and the decoherence rate coefficient are measured as δν/ν = (−3.6 ± 0.1 × 10−6 Torr−1 and 1/T2 = (1.5 ± 0.2 × 105 s−1 Torr−1. In our buffer-gas cooled 171Y b+ microwave clock system, we find that only ≤10−8 Torr of CH4 is required under normal operating conditions to efficiently clear the F-state and maintain ≥85% of trapped ions in the ground state with insignificant pressure shift and collisional decoherence of the clock resonance.
Investigation of neutron-rich rare-earth nuclei including the new isotopes 177Tm and 184Lu
International Nuclear Information System (INIS)
Rykaczewski, K.; Gippert, K.L.; Runte, E.; Schmidt-Ott, W.D.; Tidemand-Petersson, P.; Kurcewicz, W.; Nazarewicz, W.
1989-01-01
Decays of neutron-rich isotopes in the rare-earth region were studied by means of on-line mass separation and β-γ spectroscopy using multinucleon-transfer reactions between beams of 136 Xe (9 and 11.7 MeV/u), 186 W (11.7 and 15 MeV/u) and 238 U (11.4 MeV/u) and targets of nat W and Ta. The higher beam energies appear to be advantageous for the production of such isotopes. Two new isotopes were identified: 177 Tm with a half-life T 1/2 = 85±10/15 s, and 184 Lu with T 1/2 ≅ 18 s. A new 47 s-activity found at A = 171 is tentatively assigned to the decay of the new isotope 171 Ho. The properties of the ground and excited states of neutron-rich lanthanide isotopes are interpreted within the shell model using the deformed Woods-Saxon potential. A change of the ground-state configuration for odd-mass neutron-rich lutetium isotopes from π 7/2 + [404] to π 9/2 - [514] is suggested, this change being due to the influence of a large hexadecapole deformation. The role of a possible isometric state in 180 Lu for the nucleosynthesis of 180m Ta is discussed. (orig.)
Measurement of high energy neutrons via Lu(n,xn) reactions
International Nuclear Information System (INIS)
Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.
1997-07-01
High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab
Hazen, Tracy H; Michalski, Jane; Nagaraj, Sushma; Okeke, Iruka N; Rasko, David A
2017-09-01
Enteropathogenic Escherichia coli (EPEC) is a leading cause of severe infantile diarrhea in developing countries. Previous research has focused on the diversity of the EPEC virulence plasmid, whereas less is known regarding the genetic content and distribution of antibiotic resistance plasmids carried by EPEC. A previous study demonstrated that in addition to the virulence plasmid, reference EPEC strain B171 harbors a second, larger plasmid that confers antibiotic resistance. To further understand the genetic diversity and dissemination of antibiotic resistance plasmids among EPEC strains, we describe the complete sequence of an antibiotic resistance plasmid from EPEC strain B171. The resistance plasmid, pB171_90, has a completed sequence length of 90,229 bp, a GC content of 54.55%, and carries protein-encoding genes involved in conjugative transfer, resistance to tetracycline ( tetA ), sulfonamides ( sulI ), and mercury, as well as several virulence-associated genes, including the transcriptional regulator hha and the putative calcium sequestration inhibitor ( csi ). In silico detection of the pB171_90 genes among 4,798 publicly available E. coli genome assemblies indicates that the unique genes of pB171_90 ( csi and traI ) are primarily restricted to genomes identified as EPEC or enterotoxigenic E. coli However, conserved regions of the pB171_90 plasmid containing genes involved in replication, stability, and antibiotic resistance were identified among diverse E. coli pathotypes. Interestingly, pB171_90 also exhibited significant similarity with a sequenced plasmid from Shigella dysenteriae type I. Our findings demonstrate the mosaic nature of EPEC antibiotic resistance plasmids and highlight the need for additional sequence-based characterization of antibiotic resistance plasmids harbored by pathogenic E. coli . Copyright © 2017 American Society for Microbiology.
Directory of Open Access Journals (Sweden)
K. Anitha
2015-07-01
Full Text Available The adsorption of Reactive Blue 171 (Reactive Dye from aqueous solution using activated carbon prepared from Albizia amara pod shell waste as an adsorbent have been carried out. The experimental adsorption data fitted reasonably well to Langmuir and Freundlich adsorption isotherms. Kinetic parameters as a function of Initial dye concentration have been calculated and the kinetic data were substituted in Pseudo First Order, Elovich and Pseudo Second order equations. A probable explanation is offered to account for the results of kinetic study. The thermodynamic parameter enthalpy change (∆H suggests the exothermic nature of absorption of Reactive Blue 171 onto activated Albizia amara pod shell waste carbon.
van Langelaar, Jamie; van der Vuurst de Vries, Roos M; Janssen, Malou; Wierenga-Wolf, Annet F; Spilt, Isis M; Siepman, Theodora A; Dankers, Wendy; Verjans, Georges M G M; de Vries, Helga E; Lubberts, Erik; Hintzen, Rogier Q; van Luijn, Marvin M
2018-05-01
Interleukin-17-expressing CD4+ T helper 17 (Th17) cells are considered as critical regulators of multiple sclerosis disease activity. However, depending on the species and pro-inflammatory milieu, Th17 cells are functionally heterogeneous, consisting of subpopulations that differentially produce interleukin-17, interferon-gamma and granulocyte macrophage colony-stimulating factor. In the current study, we studied distinct effector phenotypes of human Th17 cells and their correlation with disease activity in multiple sclerosis patients. T helper memory populations single- and double-positive for C-C chemokine receptor 6 (CCR6) and CXC chemokine receptor 3 (CXCR3) were functionally assessed in blood and/or cerebrospinal fluid from a total of 59 patients with clinically isolated syndrome, 35 untreated patients and 24 natalizumab-treated patients with relapsing-remitting multiple sclerosis, and nine patients with end-stage multiple sclerosis. Within the clinically isolated syndrome group, 23 patients had a second attack within 1 year and 26 patients did not experience subsequent attacks during a follow-up of >5 years. Low frequencies of T helper 1 (Th1)-like Th17 (CCR6+CXCR3+), and not Th17 (CCR6+CXCR3-) effector memory populations in blood strongly associated with a rapid diagnosis of clinically definite multiple sclerosis. In cerebrospinal fluid of clinically isolated syndrome and relapsing-remitting multiple sclerosis patients, Th1-like Th17 effector memory cells were abundant and showed increased production of interferon-gamma and granulocyte macrophage colony-stimulating factor compared to paired CCR6+ and CCR6-CD8+ T cell populations and their blood equivalents after short-term culturing. Their local enrichment was confirmed ex vivo using cerebrospinal fluid and brain single-cell suspensions. Across all pro-inflammatory T helper cells analysed in relapsing-remitting multiple sclerosis blood, Th1-like Th17 subpopulation T helper 17.1 (Th17.1; CCR6+CXCR3+CCR4
National Research Council Canada - National Science Library
2004-01-01
... (PM-MAS) to conduct Air Pressure Tests during MIL-STD-1660, "Design Criteria for Ammunition Unit Loads" testing on the PA171 containers on a wood pallet with metal top adapter as manufactured by Alliant Tech...
2010-04-01
... of, amendment of, accounting of disclosures of, or challenge to classification of records. 171.52..., amendment of, accounting of disclosures of, or challenge to classification of records. (a) Right of... records, amendment of records, accounting of disclosures of records, or any authorized holder of...
International Nuclear Information System (INIS)
Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping
2016-01-01
Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.
25 CFR 171.420 - Can I dispose of sewage, trash, or other refuse on a BIA irrigation project?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Can I dispose of sewage, trash, or other refuse on a BIA... AND WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Facilities § 171.420 Can I dispose of sewage, trash, or other refuse on a BIA irrigation project? No. Sewage, trash, or other refuse are considered...
Self-image perception of 171 children and adolescents with cleft lip and palate from 22 countries.
Abd-Elsayed, Alaa A; Delgado, Sergio V; Livingstone, Morgan
2013-01-01
Cleft lip (CL) and cleft palate (CP) are among the most common congenital deformities of the head and neck. They are associated with many problems, physical and psychological. We describe 171 children and adolescents with CL/CP from 22 countries who were asked to draw their faces in a self-image perception drawing 2 hours before surgery to repair their deformities. The aim of the study was to explore whether children and adolescents with CL and CP perceived themselves as deformed when given the opportunity to draw their faces before surgery to repair their deformities. Children were asked to lie down on a large piece of paper to have their body outline traced. Subsequently, the children were asked to draw their faces within the outline. All of the children included in this study drew their faces with normal mouths. None of the 171 patients with CL/CP drew their deformity when asked to draw their faces; the reasons are not clear. The children may have wanted to compensate for their disability with the constructive use of fantasy as they anticipated the surgery to repair their CL/CP. An additional hypothesis is that the children felt the need to draw an image that they knew represented their parents' desires.
DEFF Research Database (Denmark)
Bross, P; Pedersen, P; Nyholm, M
1999-01-01
The consequences of two amino acid polymorphisms of human electron transfer flavoprotein (alpha-T/I171 in the alpha-subunit and beta-M/T154 in the beta-subunit) on the thermal stability of the enzyme are described. The alpha-T171 variant displayed a significantly decreased thermal stability, wher....... This is compatible with a negative modulating effect of the less-stable alpha-T171 ETF variant in this group of VLCAD patients that harbor missense mutations in at least one allele and therefore potentially display residual levels of VLCAD enzyme activity. Udgivelsesdato: 1999-Jun...
Han, Yongtao; Song, Le; Zou, Nan; Chen, Ronghua; Qin, Yuhong; Pan, Canping
2016-09-15
A rapid and sensitive method for the determination of 171 pesticides in cowpea was developed using multi-walled carbon nanotubes (MWCNTs) as reversed-dispersive solid-phase (r-DSPE) extraction materials. The clean-up performance of MWCNTs was proved to be obviously superior to PSA and GCB. This method was validated on cowpea spiked at 0.01 and 0.1mgkg(-1) with five replicates. The mean recoveries for 169 pesticides ranged from 74% to 129% with relative standard deviations (RSDs) (n=5) lower than 16.4%, except diflufenican and quizalofop-ethyl. Good linearity for all pesticides was obtained with the calibration curve coefficients (R(2)) larger than 0.9970. The limit of detection (LODs) and limit of quantification (LOQs) for the 171 pesticides ranged from 0.001 to 0.003mgkg(-1) and from 0.002 to 0.009mgkg(-1), respectively. The method was demonstrated to be reliable and sensitive for the routine monitoring of the 171 pesticides in cowpea samples. Copyright © 2016 Elsevier B.V. All rights reserved.
DEFF Research Database (Denmark)
Hatse, S; Princen, K; Gerlach, L O
2001-01-01
by mutational analysis. We established a set of stably transfected U87.CD4 cell lines expressing different mutant forms of CXCR4 (i.e., CXCR4[WT], CXCR4[D171N], CXCR4[D262N], CXCR4[D171N,D262N], and CXCR4[H281A]), to compare the activity of the compound against mutated versus wild-type CXCR4. We found...... by substitution of Asp(171) and/or Asp(262) by neutral asparagine residue(s). Both aspartates, but most particularly Asp(262), also proved essential for the anti-HIV-1 activity of AMD3100 against the viruses NL4.3, IIIB, and HE. In contrast, substitution of His(281) by a neutral alanine potentiated...
Low-power, miniature {sup 171}Yb ion clock using an ultra-small vacuum package
Energy Technology Data Exchange (ETDEWEB)
Jau, Y.-Y.; Schwindt, P. D. D. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Partner, H. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Quantum Information and Control (CQuIC), Department of Physics and Astronomy, University of New Mexico, Albuquerque, New Mexico 87131 (United States); Prestage, J. D.; Kellogg, J. R.; Yu, N. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109 (United States)
2012-12-17
We report a demonstration of a very small microwave atomic clock using the 12.6 GHz hyperfine transition of the trapped {sup 171}Yb ions inside a miniature, completely sealed-off 3 cm{sup 3} ion-trap vacuum package. In the ion clock system, all of the components are highly miniaturized with low power consumption except the 369 nm optical pumping laser still under development for miniaturization. The entire clock, including the control electronics, consumes <300 mW. The fractional frequency instability of the miniature Yb{sup +} clock reaches the 10{sup -14} range after a few days of integration.
International Nuclear Information System (INIS)
Parr, A.F.; Beihn, R.M.; Franz, R.M.; Szpunar, G.J.; Jay, M.
1987-01-01
External gamma scintigraphy was used to monitor the gastrointestinal (GI) transit of radiolabeled sustained-release tablets containing 800 mg ibuprofen in eight fasted healthy volunteers. Ibuprofen serum concentrations were determined from blood samples drawn sequentially over a 24-hr period. Serum concentrations and related parameters were correlated to the position of the dosage form in the GI tract from the scintiphotos. The sustained-release tablets were radiolabeled intact utilizing a neutron activation procedure, by incorporating 0.18% of 170 Er2O3 (enriched to greater than 96% 170 Er) into the bulk formulation. After manufacture of the final dosage forms, the tablets were irradiated in a neutron flux (4.4 x 10(13) n/cm2.sec) for 2 min, converting the stable 170 Er to radioactive 171 Er (t1/2 = 7.5 hr). Each tablet contained 50 microCi of 171 Er at the time of administration. The scintigraphy studies suggested that the greatest proportion of ibuprofen was absorbed from this dosage form while the tablet was in the large bowel. The dosage forms eroded slowly in the small bowel and appeared to lose their integrity in the large bowel. In vitro studies showed only minimal effects of the neutron irradiation procedure on the dosage form performance
International Nuclear Information System (INIS)
Schlimok, G.; Funke, I.; Holzmann, B.
1987-01-01
The detection of early micrometastasis or disseminated single tumor cells poses a problem for conventional diagnosis procedures. Using a panel of monoclonal antibodies against cytokeratin and the 17-1A epithelial antigen the authors identified immunocytochemically tumor cells in bone marrow of patients with breast cancer and colorectal cancer at the time of surgery of the primary tumor. Monoclonal antibody CK2, recognizing the human cytokeratin component 18 in simple epithelia, appeared to be the most suitable reagent because of its negative reaction with bone marrow samples of the noncarcinoma patients. Its specificity was further demonstrated in a double-marker staining procedure using an anti-leukocyte common antigen monoclonal antibody (T200) as counterstain. A comparative analysis showed that immunocytology was clearly superior to conventional cytology and histology. In 9.5-20.5% of patients without distant metastasis, tumor cells could be detected in bone marrow. They found a significant correlation between tumor cells in bone marrow and conventional risk factors, such as distant metastasis or lymph node involvement. In a first approach toward immunotherapy they demonstrated in 3 patients that infused monoclonal antibody 17-1A can label single tumor cells in bone marrow in vivo. They then used this single approach to follow up on 7 patients undergoing 17-1A therapy in an adjuvant clinical trial
Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer
International Nuclear Information System (INIS)
Lima, Clarice Maria de
2011-01-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1993-01-01
The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)
Radiological profile of pulmonary tuberculosis in HIV: concerning 171 observations in Kinshasa
International Nuclear Information System (INIS)
Djamba, O.N.; Mukaya, J.; Kayembe, J.M.
2011-01-01
This prospective descriptive study was conducted in Depistage center of the Tuberculosis treatment of Kabinda during a period of three months, had as objectives to study the radiological profile of pulmonary tuberculosis in HIV and HIV- patients, then to compare the frequency of different radiological abnormalities between the two groups to determine some characteristics of co-infection HIV/TP+. Among 171 patients with contagious pulmonary tuberculosis, 50 patients had positive serology for HIV, a prevalence of 29,2%. The intrathoracic lymph nodes, localized lesions only in the lower field were more observed in HIV, as well as pleurisy and the absence of radiological abnormality. The only one case of miliary was HIV positive. By contrast, excavations and localized lesions in the upper field were predominant in HIV-. Atypical radiological manifestations of pulmonary tuberculosis were more common in patients with HIV infection.
International Nuclear Information System (INIS)
1998-05-01
The Minerals Management Service proposes to hold annual oil and gas lease sales in the Western Planning Area (WPA) of the Gulf of Mexico Outer Continental Shelf (OCS). The proposed actions are the Western Gulf sales scheduled in the Outer Continental Shelf Oil and Gas Leasing Program: 1997-2002 (Sale 171 in 1998, Sale 174 in 1999, Sale 177 in 2000, and Sale 180 in 2001). This environmental impact statement (EIS) serves as a decision document for proposed Sale 171. This document includes the purpose and background of the proposed actions, identification of the alternatives, description of the affected environment, and an analysis of the potential environmental impacts of the proposed actions, alternatives, and associated activities, including proposed mitigating measures and their potential effects. Potential contributions to cumulative impacts resulting from activities associated with the proposed actions are also analyzed. Each of the proposed actions will offer for lease all unleased blocks in the Western Planning Area of the Gulf of Mexico OCS, with the exclusion of the East and West Flower Garden Banks (Blocks A-375 and A-398 in the High Island Area, East Addition, South Extension) and three blocks used for Naval mine warfare testing and training (Blocks 793, 799, and 816 in the Mustang Island Area). Additionally, discussions between the United States and Mexico regarding tracts beyond the U.S. Exclusive Economic Zone are ongoing and may result in the deferral of those tracts for Sale 171 (approximately 277 tracts) in the open-quotes Northern Portion of the Western Gapclose quotes (Figure 1-1). Additional copies of this EIS and the referenced visuals may be obtained from the MMS, Gulf of Mexico OCS Region, Public Information Office (MS 5034), 1201 Elmwood Park Boulevard, New Orleans, Louisiana 70123-2394, or by telephone at I-800-200-GULF
Ma, Zhaoxue; Hu, Xupeng; Cai, Wenjuan; Huang, Weihua; Zhou, Xin; Luo, Qian; Yang, Hongquan; Wang, Jiawei; Huang, Jirong
2014-01-01
An extraordinarily precise regulation of chlorophyll biosynthesis is essential for plant growth and development. However, our knowledge on the complex regulatory mechanisms of chlorophyll biosynthesis is very limited. Previous studies have demonstrated that miR171-targeted scarecrow-like proteins (SCL6/22/27) negatively regulate chlorophyll biosynthesis via an unknown mechanism. Here we showed that SCLs inhibit the expression of the key gene encoding protochlorophyllide oxidoreductase (POR) in light-grown plants, but have no significant effect on protochlorophyllide biosynthesis in etiolated seedlings. Histochemical analysis of β-glucuronidase (GUS) activity in transgenic plants expressing pSCL27::rSCL27-GUS revealed that SCL27-GUS accumulates at high levels and suppresses chlorophyll biosynthesis at the leaf basal proliferation region during leaf development. Transient gene expression assays showed that the promoter activity of PORC is indeed regulated by SCL27. Consistently, chromatin immunoprecipitation and quantitative PCR assays showed that SCL27 binds to the promoter region of PORC in vivo. An electrophoretic mobility shift assay revealed that SCL27 is directly interacted with G(A/G)(A/T)AA(A/T)GT cis-elements of the PORC promoter. Furthermore, genetic analysis showed that gibberellin (GA)-regulated chlorophyll biosynthesis is mediated, at least in part, by SCLs. We demonstrated that SCL27 interacts with DELLA proteins in vitro and in vivo by yeast-two-hybrid and coimmunoprecipitation analysis and found that their interaction reduces the binding activity of SCL27 to the PORC promoter. Additionally, we showed that SCL27 activates MIR171 gene expression, forming a feedback regulatory loop. Taken together, our data suggest that the miR171-SCL module is critical for mediating GA-DELLA signaling in the coordinate regulation of chlorophyll biosynthesis and leaf growth in light. PMID:25101599
2016-07-01
The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium
Frequency measurement of the 2S(1/2)-2D(3/2) electric quadrupole transition in a single 171Yb+ ion.
Webster, Stephen; Godun, Rachel; King, Steven; Huang, Guilong; Walton, Barney; Tsatourian, Veronika; Margolis, Helen; Lea, Stephen; Gill, Patrick
2010-03-01
We report on precision laser spectroscopy of the 2S(1/2)(F = 0)-2D(3/2) (F = 2, m(F) = 0) clock transition in a single ion of 171Yb+. The absolute value of the transition frequency, determined using an optical frequency comb referenced to a hydrogen maser, is 688358979309310 +/- 9 Hz. This corresponds to a fractional frequency uncertainty of 1.3 x 10(-14).
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli
2009-01-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the
International Nuclear Information System (INIS)
Martinez-Guridi, G.; Samanta, P.; Chu, L.; Yang, J.
1998-01-01
Generic Safety Issue 171 (GSI-171), Engineered Safety Feature (ESF) from a Loss Of Offsite Power (LOOP) subsequent to a Loss Of Coolant Accident (LOCA), deals with an accident sequence in which a LOCA is followed by a LOOP. This issue was later broadened to include a LOOP followed by a LOCA. Plants are designed to handle a simultaneous LOCA and LOOP. In this paper, the authors address the unique issues that are involved i LOCA with delayed LOOP (LOCA/LOOP) and LOOP with delayed LOCA (LOOP/LOCA) accident sequences. LOCA/LOOP accidents are analyzed further by developing event-tree/fault-tree models to quantify their contributions to core-damage frequency (CDF) in a pressurized water reactor and a boiling water reactor (PWR and a BWR). Engineering evaluation and judgments are used during quantification to estimate the unique conditions that arise in a LOCA/LOOP accident. The results show that the CDF contribution of such an accident can be a dominant contributor to plant risk, although BWRs are less vulnerable than PWRs
Energy Technology Data Exchange (ETDEWEB)
Crain, S.; Mount, E.; Baek, S.; Kim, J., E-mail: jungsang@duke.edu [Electrical and Computer Engineering Department, Fitzpatrick Institute for Photonics, Duke University, Durham, North Carolina 27708 (United States)
2014-11-03
The ability to individually manipulate the increasing number of qubits is one of the many challenges towards scalable quantum information processing with trapped ions. Using micro-mirrors fabricated with micro-electromechanical systems technology, we focus laser beams on individual ions in a linear chain and steer the focal point in two dimensions. We demonstrate sequential single qubit gates on multiple {sup 171}Yb{sup +} qubits and characterize the gate performance using quantum state tomography. Our system features negligible crosstalk to neighboring ions (<3×10{sup −4}), and switching speed comparable to typical single qubit gate times (<2 μs)
Acutis, P.L.; Sbaiz, L.; Verburg, F.J.; Riina, M.V.; Ru, G.; Moda, G.; Caramelli, M.; Bossers, A.
2004-01-01
Frequencies of polymorphisms at codons 136, 154 and 171 of the prion protein (PrP) gene were studied in 1207 pure-bred and cross-bred Italian Biellese rams, a small ovine breed of about 65 000 head in Italy. Aside from the five most common alleles (VRQ, ARQ, ARR, AHQ and ARH), the rare ARK allele
International Nuclear Information System (INIS)
Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.
1997-01-01
A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs
Heinitz, S; Schumann, D; Dressler, R; Kivel, N; Guerrero, C; Köster, U; Tessler, M; Paul, M; Halfon, S
2015-01-01
The knowledge of the neutron capture cross sections of s-process branching point isotopes represents a basic requirement for the understanding of star evolution. Since such branching point isotopes are by definition radioactive, the measurement of their cross sections from thermal to stellar energies becomes a challenging task. Considerable amounts of material have to be produced, representing a significant radioactive hazard. We report here on the production and separation of 3.5 mg 171Tm from 240 mg 170Er2O3 and 72 µg 147Pm from 100 mg 146Nd2O3 irradiated at the ILL high flux reactor. Thin targets were prepared with high chemical and radioisotopic purity suitable for neutron capture measurements at n_TOF CERN and the SARAF-LiLiT facility.
[A role for hypnosis in cataract surgery: Report of 171 procedures].
Agard, E; Pernod, C; El Chehab, H; Russo, A; Haxaire, M; Dot, C
2016-03-01
To study the effectiveness of relaxation hypnosis in outpatient cataract surgery. Prospective study of 171 patients undergoing cataract surgery under hypnosis, performed by the same nurse anesthetist. The procedures were performed by 2 senior surgeons, A and B (A=78 surgeries, and B=93 surgeries) under topical anesthesia and with a 2.2-mm mini-incision. The hypnosis group (n=102) was compared to a control group (n=69) according to quantitative, objective criteria: hemodynamic changes and the need for intravenous medication in operating room, as well as subjective, qualitative criteria: surgical comfort, effectiveness of hypnosis, and patient satisfaction. Subgroup analyses by surgeon, 1st and 2nd eye surgery, were performed. Hemodynamic parameters were not significantly different between the 2 groups: systolic blood pressure (P=0.06) and maximum heart rate (P=0.25). However, the use of intraoperative intravenous medication was significantly higher in the control group (49.3% versus 21.6%, Phypnosis group reported a mean comfort rating of 8.4/10, and 100% were satisfied with this hypnosis experience. Preliminary results of this study are very positive for all three parties: patient/anesthetist/surgeon. They are leading to an expanded university training program for operating room personnel in order to improve quality of care and reduce premedication in elderly patients so as to facilitate their return to home. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
Banerjee, P.T.; Rathrock, R.; Mitra, S.
1981-01-01
A physical map of Kilham rat virus strain 171 DNA was constructed by analyzing the sizes and locations of restriction endonuclease-generated fragments of the replicative-form viral DNA synthesized in vitro. BglI, KpnI, BamHI, SmaI, XhoI, and XorII did not appear to have any cleavage sites, whereas 11 other enzymes cleaved the genome at one to eight sites, and AluI generated more than 12 distinct fragments. The 30 restriction sites that were mapped were distributed randomly in the viral genome. A comparison of the restriction fragments of in vivo- and in vitro-replicated replicative-form DNAs showed that these DNAs were identical except in the size or configuration of the terminal fragments
International Nuclear Information System (INIS)
De Bievre, P.; Eschbach, H.L.; Lesser, R.; Meyer, H.; Audenhove, Van J.
1986-01-01
This certification report contains the information necessary for the final certification of EC nuclear reference material 171. It is also intended to inform the user of the reference material concerned on technical/scientific details which are not given in the certificate. The report describes the reference material which consists of sets of U 3 O 8 samples with five different 235 U/U abundances, filled in cylindrical aluminium cans. The can bottom serves as window for emitted gamma radiation. The report describes how the 235 U/U abundances were characterized, how the other properties relevant for gamma measurements were determined and gives all connected results as well as those from the verification measurements. Appendix A represents the draft certificate. 32 refs
Measurement of the acoustic reflectivity of sirenia (Florida manatees) at 171 kHz.
Jaffe, Jules S; Simonet, Fernando; Roberts, Paul L D; Bowles, Ann E
2007-01-01
The Florida manatee (Trichechus manatus latirostris) is an endangered sirenian. At present, its adult population (approximately 2200) seems stable, but tenuous. Manatee-boat collisions are a significant proportion (approximately 25%) of mortalities. Here, the potential use of active sonar for detecting manatees by quantifying sonic reflectivity is explored. In order to estimate reflectivity two methods were used. One method measured live reflections from captive animals using a carefully calibrated acoustic and co-registered optical system. The other method consisted of the analysis of animal tissue in order to obtain estimates of the sound speed and density and to predict reflectivity. The impedance measurement predicts that for a lateral view, the tissue reflectivity is close to 0.13, with a critical grazing angle of 28 degrees. Data measured from live animals indicate that substantial reflections can be recorded, however in many instances observed "empirical target strengths" were less than an experimentally dependent -48-dB threshold. Conclusions favor the hypothesis that the animals reflect substantial amounts of sound; however, the reflections can often be specular, and therefore impractical for observation by a manatee detection sonar operating at 171 kHz.
Method of isolation of traces of americium by using the +6 oxidation state properties
International Nuclear Information System (INIS)
Kwinta, Jean; Michel, Jean-Jacques
1969-05-01
The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr
International Nuclear Information System (INIS)
Roussin, R.W.; Weisbin, C.R.; White, J.E.; Wright, R.Q.; Greene, N.M.; Ford, W.E. III; Wright, J.B.; Diggs, B.R.
1978-01-01
The Department of Energy (DOE) Division of Magnetic Fusion Energy (DMFE) and Reactor Research and Technology (DRRT) jointly sponsored the development of a coupled, fine-group cross-section library. The 171-neutron, 36-gamma-ray group library is intended to be applicable to fusion reactor neutronics and LMFBR core and shield analysis. Versions of the library are available from the Radiation Shielding Information Center (RSIC) at Oak Ridge National Laboratory in both AMPX and CCCC formats. Computer codes for energy group collapsing, interpolation on Bondarenko factors for resonance self-shielding and temperature corrections, and various other useful data manipulations are available. The experience gained in the utilization of this library is discussed. Indications are that this venture, which is designed to allow users to derive problem-dependent cross sections from a fine-group master library, has been a success
International Nuclear Information System (INIS)
Matak, Mehdi Youssefi; Moghaddam, Majid Erfani
2009-01-01
Understanding structural determinants in enzyme active site integrity can provide a good knowledge to design efficient novel catalytic machineries. Fusarium solani pisi cutinase with classic triad Ser-His-Asp is a promising enzyme to scrutinize these structural determinants. We performed two MD simulations: one, with the native structure, and the other with the broken Cys171-Cys178 disulfide bond. This disulfide bond stabilizes a turn in active site on which catalytic Asp175 is located. Functionally important H-bonds and atomic fluctuations in catalytic pocket have been changed. We proposed that this disulfide bond within active site can be considered as an important determinant of cutinase active site structural integrity.
International Nuclear Information System (INIS)
Lopez G, H.D.
2005-01-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Comparing Zeeman qubits to hyperfine qubits in the context of the surface code: +174Yb and +171Yb
Brown, Natalie C.; Brown, Kenneth R.
2018-05-01
Many systems used for quantum computing possess additional states beyond those defining the qubit. Leakage out of the qubit subspace must be considered when designing quantum error correction codes. Here we consider trapped ion qubits manipulated by Raman transitions. Zeeman qubits do not suffer from leakage errors but are sensitive to magnetic fields to first order. Hyperfine qubits can be encoded in clock states that are insensitive to magnetic fields to first order, but spontaneous scattering during the Raman transition can lead to leakage. Here we compare a Zeeman qubit (+174Yb) to a hyperfine qubit (+171Yb) in the context of the surface code. We find that the number of physical qubits required to reach a specific logical qubit error can be reduced by using +174Yb if the magnetic field can be stabilized with fluctuations smaller than 10 μ G .
Energy Technology Data Exchange (ETDEWEB)
Heinitz, Stephan; Maugeri, Emilio A.; Schumann, Dorothea; Dressler, Rugard; Kivel, Niko [Paul Scherrer Institute, Villigen (Switzerland); Guerrero, Carlos [Sevilla Univ. (Spain); Koester, Ullrich [Institut Laue-Langevin, Grenoble (France); Tessler, Moshe; Paul, Michael [Hebrew Univ. of Jerusalem (Israel); Halfon, Shlomi [Soreq Nuclear Research Center, Yavne (Israel); Collaboration: nTOF Collaboration
2017-07-01
The knowledge of the neutron capture cross sections of s-process branching point isotopes represents a basic requirement for the understanding of star evolution. Since such branching point isotopes are by definition radioactive, the measurement of their cross sections from thermal to stellar energies becomes a challenging task. Considerable amounts of material have to be produced, representing a significant radioactive hazard. We report here on the production and separation of 3.5 mg {sup 171}Tm from 240 mg {sup 170}Er{sub 2}O{sub 3} and 72 μg {sup 147}Pm from 100 mg {sup 146}Nd{sub 2}O{sub 3} irradiated at the ILL high flux reactor. Thin targets were prepared with high chemical and radioisotopic purity suitable for neutron capture measurements at nTOF CERN and the SARAF-LiLiT facility.
Calculations of the relative effectiveness of alanine for neutrons with energies up to 17.1 MeV
International Nuclear Information System (INIS)
Gerstenberg, H.M.; Coyne, J.J.
1990-01-01
The relative effectiveness (RE) of alanine has been calculated for neutrons using the RE of alanine for charged particles. The neutrons interact with one or more of the elements (hydrogen, carbon, nitrogen and oxygen) that compose the alanine. These interactions produce spectra of secondary charged particles consisting of ions of H, D, He, Be, B, C, N and O. From a combination of the calculated secondary charged particle spectra generated by the slowing down neutrons, and the calculated RE of the ions produced, a RE for the neutrons can be obtained. In addition, lineal energy spectra were determined for neutrons with energies up to 17.1 MeV interacting with alanine. An analytical code was used to calculate these spectra for a 1 μm diameter alanine cell surrounded by an alanine medium. For comparison, similar calculations were made for muscle tissue. Finally, the calculated differential RE was folded with dose distributions to obtain RE-weighted distributions for alanine. (author)
Directory of Open Access Journals (Sweden)
María Angustias Díaz Gómez
2011-06-01
Full Text Available El objeto de este trabajo es analizar el Protocolo Familiar, estudiando su concepto, naturaleza jurídica y eficacia, su contenido, publicidad y desarrollo. El protocolo familiar es un instrumento jurídico que pretende organizar la relación entre la familia y la empresa, separando ambas realidades y, especialmente, trata de planificar adecuadamente la sucesión de la empresa familiar. Se trata de reflexionar sobre el Real Decreto español 171/2007, de 9 de febrero, por el que se regula la publicidad de los protocolos familiares en las Sociedades Familiares.The object of this work is to analyze the Family Protocol, studying his concept, juridical nature and effectiveness, his content, advertising and development. The family protocol is a legal instrument that, intends to organize the interaction between a family and their family-owned business, separating both realities and, specially, it tries to plan adequately the succession of the family business. It is a question of thinking about the Spanish Royal decree 171/2007, of February 9rd, by which there is regulated the advertising of the family protocols in the Familiar Companies.
Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid
Energy Technology Data Exchange (ETDEWEB)
Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii
1978-01-01
To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.
Basal Cell Carcinoma of the Head and Neck Region: An Analysis of 171 Cases
Directory of Open Access Journals (Sweden)
Omer Sefvan Janjua
2012-01-01
Full Text Available Objective. To analyze the pattern of presentation of basal cell carcinoma (BCC and margin status for excised specimens in the head and neck region. Study Design. Retrospective cross-sectional. Duration of Study. January 2009 to December 2011. Methodology. The database of the pathology department was searched to identify records of all malignant skin tumors that underwent standard excision with margins. Out of these records, tumors with a diagnosis of BCC in the head and neck region were retrieved and separated. Age, gender, anatomic location, pattern of tumor, and margin status were noted. Results. A total of 171 cases of BCC from various sites of head and neck were retrieved. Male to female ratio was 1.4 : 1. The age ranged from 22 to 90 years. Seventy-six cases presented on right side, 79 on left, and 16 were in the midline. Most common anatomical site was the nose followed by the cheek. Nodular lesions were the most common (46.2% followed by pigmented variety (18.7%. Margins were clear in 77 (45.1% cases, involved in 86 (50.2% cases, and close in 8 (4.7% cases. Conclusion. Nose was the most common site followed by the cheek. Nodular and pigmented varieties were the most frequent and margins were involved in more than fifty percent of the cases.
Basal Cell Carcinoma of the Head and Neck Region: An Analysis of 171 Cases
International Nuclear Information System (INIS)
Janjua, O. S.; Qureshi, S. M.
2012-01-01
Objective. To analyze the pattern of presentation of basal cell carcinoma (BCC) and margin status for excised specimens in the head and neck region. Study Design. Retrospective cross-sectional. Duration of Study. January 2009 to December 2011. Methodology. The database of the pathology department was searched to identify records of all malignant skin tumors that underwent standard excision with margins. Out of these records, tumors with a diagnosis of BCC in the head and neck region were retrieved and separated. Age, gender, anatomic location, pattern of tumor, and margin status were noted. Results. A total of 171 cases of BCC from various sites of head and neck were retrieved. Male to female ratio was 1.4?:?1. The age ranged from 22 to 90 years. Seventy-six cases presented on right side, 79 on left, and 16 were in the midline. Most common anatomical site was the nose followed by the cheek. Nodular lesions were the most common (46.2%) followed by pigmented variety (18.7%). Margins were clear in 77 (45.1%) cases, involved in 86 (50.2%) cases, and close in 8 (4.7%) cases. Conclusion. Nose was the most common site followed by the cheek. Nodular and pigmented varieties were the most frequent and margins were involved in more than fifty percent of the cases
International Nuclear Information System (INIS)
Calzada, V.
2011-01-01
This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium
DISCOVERY OF A GIANT RADIO HALO IN A NEW PLANCK GALAXY CLUSTER PLCKG171.9-40.7
Energy Technology Data Exchange (ETDEWEB)
Giacintucci, Simona [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Kale, Ruta; Venturi, Tiziana [INAF-Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Wik, Daniel R.; Markevitch, Maxim, E-mail: simona@astro.umd.edu [Astrophysics Science Division, NASA/Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2013-03-20
We report the discovery of a giant radio halo in a new, hot, X-ray luminous galaxy cluster recently found by Planck, PLCKG171.9-40.7. The radio halo was found using Giant Metrewave Radio Telescope observations at 235 MHz and 610 MHz, and in the 1.4 GHz data from an NRAO Very Large Array Sky Survey pointing that we have reanalyzed. The diffuse radio emission is coincident with the cluster X-ray emission, and has an extent of {approx}1 Mpc and a radio power of {approx}5 Multiplication-Sign 10{sup 24} W Hz{sup -1} at 1.4 GHz. Its integrated radio spectrum has a slope of {alpha} Almost-Equal-To 1.8 between 235 MHz and 1.4 GHz, steeper than that of a typical giant halo. The analysis of the archival XMM-Newton X-ray data shows that the cluster is hot ({approx}10 keV) and disturbed, consistent with X-ray-selected clusters hosting radio halos. This is the first giant radio halo discovered in one of the new clusters found by Planck.
High-resolution Laboratory Measurements of Coronal Lines near the Fe IX Line at 171 Å
Beiersdorfer, Peter; Träbert, Elmar
2018-02-01
We present high-resolution laboratory measurements in the spectral region between 165 and 175 Å that focus on the emission from various ions of C, O, F, Ne, S, Ar, Fe, and Ni. This wavelength region is centered on the λ171 Fe IX channel of the Atmospheric Imaging Assembly on the Solar Dynamics Observatory, and we place special emphasis on the weaker emission lines of Fe IX predicted in this region. In general, our measurements show a multitude of weak lines missing in the current databases, where the emission lines of Ni are probably most in need of further identification and reclassification. We also find that the wavelengths of some of the known lines need updating. Using the multi-reference Møller–Plesset method for wavelength predictions and collisional-radiative modeling of the line intensities, we have made tentative assignments of more than a dozen lines to the spectrum of Fe IX, some of which have formerly been identified as Fe VII, Fe XIV, or Fe XVI lines. Several Fe features remain unassigned, although they appear to be either Fe VII or Fe X lines. Further work will be needed to complete and correct the spectral line lists in this wavelength region.
Pessina, G P; Bocci, V; Nicoletti, C; Becherucci, C; Presentini, R; Parente, L; Villa, L; Tagliabue, A; Boraschi, D
1990-01-01
The pharmacokinetic parameters and distribution of the adjuvant synthetic nonapeptide VQGEESNDK, corresponding to the fragment in position 163-171 in human IL-1, were analyzed after administration to rabbit through different routes. The radiolabeled peptide did not bind to plasma proteins and, when inoculated i.v., it disappeared very rapidly from the circulation, with a t1/2 alpha of 1 min and a t 1/2 beta of 166 min. Upon administration through i.m., s.c. and oral route, the Cmax was reached between 30 and 90 min after inoculum and ranged between 7 and 4% of the administered dose. Organ distribution showed that most of the radioactivity was concentrated in kidneys and excreted in urine. From Sephadex G-10 chromatography, about 60% of the peptide recovered in the urine 4h after i.v. inoculum was intact, whereas it was more than 85% degraded when administered by other routes. The amount of intact peptide recovered in the urine correlated with the biological effectiveness through different routes, suggesting that the adjuvant effect in vivo is exerted by the intact peptide, rather than by its metabolites.
Scarlet fever: A not so typical exanthematous pharyngotonsillitis (based on 171 cases).
García-Vera, César; de Dios Javierre, Bárbara; Castán Larraz, Beatriz; Arana Navarro, Teresa; Cenarro Guerrero, Teresa; Ruiz Pastora, Rafael; Sánchez Gimeno, Javier
2016-01-01
To describe the age, signs and clinical symptoms of children with scarlet fever at the present time, and to check whether they are equivalent to those with traditional streptococcal pharyngotonsillitis. An observational, retrospective study was conducted on the clinical records of 5500 children aged from 0 to 15 years attending a primary health care center. A record was made of the percentage of the cases in which signs and symptoms appear and the Centor score was calculated. Microbiological diagnosis of the disease was made using the rapid antigen-detection test or traditional culture. A total of 171 out of 252 scarlet fever diagnoses were microbiologically verified in 158 patients. The median age was 3.8 years (interquartile range: 2.91-4.78), with the majority (57%) under the age of 4 years. There was fever in 89% of the processes (95% CI: 84-94%), with a temperature of >38°C in 73% (95% CI: 65-80%), enlarged lymph nodes in 70% (95% CI: 58-82%), absence of cough in 73% (95% CI: 65-80%), and tonsillar exudate in only 24% (95% CI: 17-31%). The Centor score (n=105) was ≤2 points in 86% (95% CI: 79-92%). The only difference regarding age is that episodes in patients under the age of 4 years old have significantly higher fever (>38°C) than the older ones (80% versus 63%. OR 3.13; 95% CI: 1.46-6.71). Scarlet fever pharyngotonsillitis differs from the traditional streptococcal pharyngotonsillitis, and its evaluation using clinical prediction rules such as Centor or McIsaac is questionable. The main diagnostic key must certainly be rash, regardless of patient age. Copyright © 2015 Elsevier España, S.L.U. and Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.
Casanovas, A.; Domingo-Pardo, C.; Guerrero, C.; Lerendegui-Marco, J.; Calviño, F.; Tarifeño-Saldivia, A.; Dressler, R.; Heinitz, S.; Kivel, N.; Quesada, J. M.; Schumann, D.; Aberle, O.; Alcayne, V.; Andrzejewski, J.; Audouin, L.; Bécares, V.; Bacak, M.; Barbagallo, M.; Bečvář, F.; Bellia, G.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Busso, M.; Caamaño, M.; Caballero-Ontanaya, L.; Calviani, M.; Cano-Ott, D.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Cristallo, S.; Damone, L. A.; Diakaki, M.; Dietz, M.; Dupont, E.; Durán, I.; Eleme, Z.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Furman, V.; Göbel, K.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González-Romero, E.; Gunsing, F.; Heyse, J.; Jenkins, D. G.; Käppeler, F.; Kadi, Y.; Katabuchi, T.; Kimura, A.; Kokkoris, M.; Kopatch, Y.; Krtička, M.; Kurtulgil, D.; Ladarescu, I.; Lederer-Woods, C.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Matteucci, F.; Maugeri, E. A.; Mazzone, A.; Mendoza, E.; Mengoni, A.; Michalopoulou, V.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Ogállar, F.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Persanti, L.; Porras, I.; Praena, J.; Radeck, D.; Ramos, D.; Rauscher, T.; Reifarth, R.; Rochman, D.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Simone, S.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Talip, T.; Tassan-Got, L.; Tsinganis, A.; Ulrich, J.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Woods, P. J.; Wright, T.; Žugec, P.; Köster, U.
2018-05-01
The neutron capture cross section of some unstable nuclei is especially relevant for s-process nucleosynthesis studies. This magnitude is crucial to determine the local abundance pattern, which can yield valuable information of the s-process stellar environment. In this work we describe the neutron capture (n,γ) measurement on two of these nuclei of interest, 204Tl and 171Tm, from target production to the final measurement, performed successfully at the n_TOF facility at CERN in 2014 and 2015. Preliminary results on the ongoing experimental data analysis will also be shown. These results include the first ever experimental observation of capture resonances for these two nuclei.
Rapid detection of TiO2 (E171) in table sugar using Raman spectroscopy.
Tan, Chen; Zhao, Bin; Zhang, Zhiyun; He, Lili
2017-02-01
The potential toxic effects of titanium dioxide (TiO 2 ) to humans remain debatable despite its broad application as a food additive. Thus, confirmation of the existence of TiO 2 particles in food matrices and subsequently quantifying them are becoming increasingly critical. This study developed a facile, rapid (E171) from food products (e.g., table sugar) by Raman spectroscopy. To detect TiO 2 particles from sugar solution, sequential centrifugation and washing procedures were effectively applied to separate and recover 97% of TiO 2 particles from the sugar solution. The peak intensity of TiO 2 sensitively responded to the concentration of TiO 2 with a limit of detection (LOD) of 0.073 mg kg -1 . In the case of sugar granules, a mapping technique was applied to directly estimate the level of TiO 2 , which can be potentially used for rapid online monitoring. The plot of averaged intensity to TiO 2 concentration in the sugar granules exhibited a good linear relationship in the wide range of 5-2000 mg kg -1 , with an LOD of 8.46 mg kg -1 . Additionally, we applied Raman spectroscopy to prove the presence of TiO 2 in sugar-coated doughnuts. This study begins to fill in the analytical gaps that exist regarding the rapid detection and quantification of TiO 2 in food, which facilitate the risk assessment of TiO 2 through food exposure.
The joint PNC-ORNL tank calibration experiment of 1991
International Nuclear Information System (INIS)
Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.
1991-11-01
A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs
Czech Academy of Sciences Publication Activity Database
Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.
2014-01-01
Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2008-07-01
The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.
2015-01-01
Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015
Effective atomic number, electron density and kerma of gamma ...
Indian Academy of Sciences (India)
rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.
THE EFFECT OF DIFFERENT OPTIONS OF BLADES MAIN ROTOR ON THE X-SHAPED TAIL ROTOR OF THE MI-171 LL
Directory of Open Access Journals (Sweden)
Valery A. Ivchin
2018-01-01
Full Text Available This paper describes the effect of different rotor blades on the X-shaped tail rotor of the Mi-171 LL, observed conducting flight tests. The tests were carried out on the same helicopter in the similar atmospheric conditions.The objective of the tests was the comparison of flight performance of two sets of rotor blades of the helicopter Mi-171 LL. However, materials test revealed a difference in the angles of the tail rotor at different MRs with the same takeoff weight.The authors are grateful to I.G. Peskov, S.R. Zamula and A.I. Orlov for assistance in carrying out this work and the preparation of this article.Noted that the helicopter takeoff weight when hovering out of ground effect in ISA with blades from polymer composite materials (PCM exceeds the takeoff weight of the helicopter with the serial blades in the nominal mode of the engine operation at ~ 750kg, in the takeoff mode at ~ 700kg.Knowing the altitude and climatic characteristics of the engine, the obtained dependence allows to determine the balancing value of jрв on hovering at different combinations of pressure altitude and outside air temperature for a given speed of the main rotor (MR.It follows from the work that when the same value Nпр(95/nнвпр3 or Nfact the balancing values of jрв for the helicopter with the main rotor blades from the PCM is less than for the helicopters with serial blades by 0.5…0.9°. The difference in the angles of the tail rotor increases with growing of Nепр(95/nнвпр3 (Nfact. Perhaps this is caused by different induction effect of the main rotor on the tail rotor to the MR from PCM and the serial ones.As follows from the materials, the thrust of the main rotor with blades from PCM with the same engine power is more in comparison with the serial blades. Consequently inductive speeds of the main rotor are more and the angles of the tail rotor are less. It can be assumed that a large induced velocity of the main rotor increases the thrust
Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype
Ziemons, K; Streun, M; Pietrzyk, U
2004-01-01
The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...
Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long
2015-01-01
The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510
Directory of Open Access Journals (Sweden)
Liangjie Pan
2015-08-01
Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.
Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy
Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E
2014-01-01
In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...
Czech Academy of Sciences Publication Activity Database
Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.
2015-01-01
Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015
Czech Academy of Sciences Publication Activity Database
Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.
2014-01-01
Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014
Magnetic structures of holmium-lutetium alloys and superlattices
DEFF Research Database (Denmark)
Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.
1996-01-01
Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....
Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver
International Nuclear Information System (INIS)
Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.
2001-01-01
A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.
2016-01-01
Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Lima, Clarice Maria de
2011-07-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu
Directory of Open Access Journals (Sweden)
Tiago Nunes da Silva
2018-04-01
Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.
Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides
International Nuclear Information System (INIS)
Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2001-01-01
The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)
International Nuclear Information System (INIS)
Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.
2003-01-01
Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru
Czech Academy of Sciences Publication Activity Database
Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin
2016-01-01
Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016
International Nuclear Information System (INIS)
Rabatin, J.G.
1984-01-01
Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)
Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav
2009-01-01
Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena
2012-01-01
Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012
Energy Technology Data Exchange (ETDEWEB)
Hsu, P. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Strout, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Reynolds, J. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kahl, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ellsworth, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Healy, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-09-21
Incidents caused by fire and other thermal events can heat energetic materials that may lead to thermal explosion and result in structural damage and casualty. Thus, it is important to understand the response of energetic materials to thermal insults. The One-Dimensional-Time to Explosion (ODTX) system at the Lawrence Livermore National Laboratory (LLNL) has been used for decades to characterize thermal safety of energetic materials. In this study, an integration of a pressure monitoring element has been added into the ODTX system (P-ODTX) to perform thermal explosion (cook-off) experiments (thermal runaway) on PETN powder, PBX-9407, LX-10-2, LX-17-1, and detonator samples (cup tests). The P-ODTX testing generates useful data (thermal explosion temperature, thermal explosion time, and gas pressures) to assist with the thermal safety assessment of relevant energetic materials and components. This report summarizes the results of P-ODTX experiments that were performed from May 2015 to July 2017. Recent upgrades to the data acquisition system allows for rapid pressure monitoring in microsecond intervals during thermal explosion. These pressure data are also included in the report.
An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3
International Nuclear Information System (INIS)
Osborn, R.
1998-01-01
We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence
Directory of Open Access Journals (Sweden)
Peter D. Olcott
2009-03-01
Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Olcott, Peter D; Peng, Hao; Levin, Craig S
2009-01-01
A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Energy Technology Data Exchange (ETDEWEB)
Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)
2016-07-07
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.
2016-07-01
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Energy Technology Data Exchange (ETDEWEB)
Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)
2009-05-15
Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.
Low-temperature thermal properties of yttrium and lutetium dodecaborides
International Nuclear Information System (INIS)
Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y
2005-01-01
The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K
Lutetium-177-EDTMP for pain palliation in bone metastases
International Nuclear Information System (INIS)
Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.
1999-01-01
Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)
Czech Academy of Sciences Publication Activity Database
Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.
2016-01-01
Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016
Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.
2014-01-01
Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014
Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin
2016-01-01
Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016
Yttrium and rare earths separation by ion exchange resin
International Nuclear Information System (INIS)
Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.
1988-01-01
The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt
International Nuclear Information System (INIS)
Bellis, V.M. de.
1984-01-01
The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt
International Nuclear Information System (INIS)
1996-01-01
The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented
African Journals Online (AJOL)
Boaz
A SURVEY ON URINARY TRACT INFECTION ASSOCIATED WITH TWO MOST COMMON. UROPATHOGENIC BACTERIA .... UTI due to Escherichia coli and Klebsiella pneumoniae .... activity and high pregnancy rate (among females) that.
1971-01-01
Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11
Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates
International Nuclear Information System (INIS)
Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.
1975-01-01
Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out
Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems
1991-03-15
Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State
USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.
1978-11-02
magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel
Food-grade titanium dioxide exposure exacerbates tumor formation in colitis associated cancer model.
Urrutia-Ortega, Ismael M; Garduño-Balderas, Luis G; Delgado-Buenrostro, Norma L; Freyre-Fonseca, Verónica; Flores-Flores, José O; González-Robles, Arturo; Pedraza-Chaverri, José; Hernández-Pando, Rogelio; Rodríguez-Sosa, Miriam; León-Cabrera, Sonia; Terrazas, Luis I; van Loveren, Henk; Chirino, Yolanda I
2016-07-01
Colorectal cancer is the fourth worldwide cause of death and even if some dietary habits are consider risk factors, the contribution of food additives including foodgrade titanium dioxide (TiO2), designated as E171, has been poorly investigated. We hypothesized that oral E171 intake could have impact on the enhancement of colorectal tumor formation and we aimed to investigate if E171 administration could enhance tumor formation in a colitis associated cancer (CAC) model. BALB/c male mice were grouped as follows: a) control, b) E171, c) CAC and d) CAC + E171 group (n = 6). E171 used in this study formed agglomerates of 300 nm in water. E171 intragastric administration (5 mg/kg body weight/5 days/10 weeks) was unable to induce tumor formation but dysplastic alterations were observed in the distal colon but enhanced the tumor formation in distal colon (CAC + E171 group) measured by tumor progression markers. Some E171 particles were internalized in colonic cells of the E171 and CAC + E171 groups and both groups showed a decrease in goblet cells in the distal colon. However the CAC + E171 group showed a higher decrease of these cells that act as protection barrier in colon. These results suggest that E171 could worsen pre-existent intestinal diseases. Copyright © 2016 Elsevier Ltd. All rights reserved.
Neutron temperature measurements in a cryogenic hydrogenous moderator
International Nuclear Information System (INIS)
Ball, R.M.; Hoovler, G.S.; Lewis, R.H.
1995-01-01
Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations
Measurement of the half-life of sup 1 sup 7 sup 6 Lu
Nir-El, Y
1998-01-01
The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-01-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...
First principle calculation of structure and lattice dynamics of Lu2Si2O7
Directory of Open Access Journals (Sweden)
Nazipov D.V.
2017-01-01
Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.
International Nuclear Information System (INIS)
Akanji, Akinkunmi Ganiyu
2012-01-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different
Energy Technology Data Exchange (ETDEWEB)
Akanji, Akinkunmi Ganiyu
2012-07-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated
International Nuclear Information System (INIS)
Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh
2017-01-01
Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story
The migrant 152Eu as europium humate
International Nuclear Information System (INIS)
Klotz, D.
2001-01-01
Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de
Development of Scintillators in Nuclear Medicine
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...
African Journals Online (AJOL)
Items 151 - 171 of 171 ... Vol 4 (2013), World Trade Organisation (WTO): Trade rules/agreements and developing countries, Abstract PDF. Emeka Adibe. Vol 6 (2015), Xenophobia: A crime against humanity and its attendant implications on human rights, Abstract PDF. Simon-Peter Ayooluwa St. Emmanuel. 151 - 171 of 171 ...
Analysis of the spectrum of four-times-ionized lutetium (Lu V)
International Nuclear Information System (INIS)
Kaufman, V.; Sugar, J.
1978-01-01
Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given
The isolation of lutetium from gadolinium contained in Purex process solutions
International Nuclear Information System (INIS)
Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.
1992-09-01
A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference
Energy Technology Data Exchange (ETDEWEB)
Pujatti, Priscilla Brunelli
2009-07-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of
Energy Technology Data Exchange (ETDEWEB)
Lopez G, H.D
2005-07-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Neutron activation analysis of the rare earth elements in Nasu hot springs
International Nuclear Information System (INIS)
Ikeda, Nagao; Takahashi, Naruto.
1978-01-01
Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.
1995-01-01
The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab
Baek, Kyung-Hwa; Yoon, Byung-Dae; Cho, Dae-Hyun; Kim, Byung-Hyuk; Oh, Hee-Mock; Kim, Hee-Sik
2009-04-01
We evaluated the activity and abundance of the crude oil- degrading bacterium Nocardia sp. H17-1 during bioremediation of oil-contaminated soil, using real-time PCR. The total petroleum hydrocarbon (TPH) degradation rate constants (k) of the soils treated with and without H17-1 were 0.103 d-1 and 0.028 d-1, respectively. The degradation rate constant was 3.6 times higher in the soil with H17-1 than in the soil without H17-1. In order to detect and quantify the Nocardia sp. H17-1 in soil samples, we quantified the genes encoding 16S ribosomal RNA (16S rRNA), alkane monooxygenase (alkB4), and catechol 2,3-dioxygenase (23CAT) with real-time PCR using SYBR green. The amounts of H17-1 16S rRNA and alkB4 detected increased rapidly up to 1,000-folds for the first 10 days, and then continued to increase only slightly or leveled off. However, the abundance of the 23CAT gene detected in H17-1-treated soil, where H17-1 had neither the 23CAT gene for the degradation of aromatic hydrocarbons nor the catechol 2,3-dioxygenase activity, did not differ significantly from that of the untreated soil (alpha=0.05, p>0.22). These results indicated that H17-1 is a potential candidate for the bioaugmentation of alkane-contaminated soil. Overall, we evaluated the abundance and metabolic activity of the bioremediation strain H17-1 using real-time PCR, independent of cultivation.
Growth of large detector crystals. CRADA final report
International Nuclear Information System (INIS)
Boatner, L.A.; Samuelson, S.
1997-01-01
In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications
International Nuclear Information System (INIS)
Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.
1991-01-01
Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates
Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent
International Nuclear Information System (INIS)
Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.
2012-01-01
Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.
High pressure and temperature induced structural and elastic properties of lutetium chalcogenides
Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh
2018-04-01
The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.
Kinetic properties of solid yttrium at high temperatures
International Nuclear Information System (INIS)
Ivliev, A.D.
1993-01-01
Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature
International Nuclear Information System (INIS)
Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.
2007-01-01
Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru
Scintillator Evaluation for High-Energy X-Ray Diagnostics
International Nuclear Information System (INIS)
Lutz, S. S.; Baker, S. A.
2001-01-01
This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1
Progress report for the Office of Safeguards and Security for FY 1982
International Nuclear Information System (INIS)
Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.
1982-12-01
Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples
International Nuclear Information System (INIS)
Resbeut, Michel; Cowen, Didier; Blaise, Didier; Gluckman, Eliane; Cosset, Jean-Marc; Rio, Bernard; Pene, Francoise; Milpied, Nicolas; Cuillere, Jean-Claude; Reiffers, Josy; Richaud, Pierre
1995-01-01
Purpose: To evaluate the importance of fractionating total body irradiation (TBI) in patients receiving an allogenic bone marrow transplant (BMT) for an acute myeloblastic leukemia (AML) in first complete remission (CR1). Methods and Materials: Between 1983 and 1990, 171 consecutive patients received either single dose TBI (STBI) (n = 65) or fractionated TBI (FTBI) (n = 106) after being conditioned with cyclophosphamide and before receiving a non-T-depleted Human Leucocyte Antigen (HLA)-identical marrow. Both groups were comparable except for date of BMT and diagnosis-to-BMT interval (D-BMT). Results: After 63 months median follow-up, transplant-related mortality (TRM), probability of relapse, and 5-year disease-free survival (DFS) were 0.38 and 0.27 (p = 0.04), 0.29 and 0.26 (p = 0.22), 0.43 and 0.56 (p = 0.06), respectively, for STBI and FTBI. The supposed influence of the schedule of TBI disappeared in the multivariate analysis: TRM was enhanced by severe acute graft vs. host disease (p = 0.0002), early years of transplant (before January 1, 1987) (p = 0.0003), and longer D-BMT intervals (p = 0.038). Relapse was linked to early years of transplant (p < 0.00001), and the absence of chronic GVHD (p = 0.007). Longer DFSs were observed for later years of transplant (after January 1, 1987 and later) (p = 0.001), milder acute GVHD (p = 0.005), and shorter D-BMT intervals (p = 0.045). Important improvements of the results were made during the 7-year observation period: TRM, probability of relapse, and DFS were, respectively, 0.36, 0.28, and 0.46 for patients transplanted before January 1, 1987 vs. 0.21, 0.15, and 0.67 after that date. Conclusion: Our data strongly suggest that allogenic BMT is the best postremission treatment for AML in CR1, and the results are better when BMT shortly follows the achievement of remission. The schedule of TBI was of little importance compared with the improvements made in the management of patients undergoing BMT during the 1980s, and
2010-04-01
... AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Office of Food Additive Safety (HFS-200), Center for Food Safety and Applied Nutrition, Food and Drug... formulas. (3) All correspondence and written summaries of oral discussions relating to a food additive...
2010-04-01
... Privacy Act, E.O. 12958, and the Ethics in Government Act; (e) Record means all information under the... when they can qualify as disseminators of “news”) who make their products available for purchase by the...
2010-04-01
... against unauthorized disclosure and is marked to indicate its classified status when in documentary form... documentary material, regardless of its physical form or characteristics that is owned by, produced by or for... Management. ...
2010-07-01
... pesticide applicator program in this part: (1) The term accident means an unexpected, undesirable event... pesticide which permits its use with other chemicals without undesirable results being caused by the... the act or process whereby the application of a pesticide is made by a competent person acting under...
BDML Metadata: 171 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available NC-SA 0.180 ddc4bac7-2646-4717-a00a-4daff073490b 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_R10E4.4_061107_01.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_R10E4.4_061107_01.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_...P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/ddc4bac7-2646-4717-a00a-4daff073490b/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-87 ...
2010-04-01
... evaluation material used solely to determine individual qualifications for employment or promotion and to avoid giving unfair advantage to individuals by virtue of their having access to such material. Foreign...
2010-01-01
... self-supporting chain reaction. Operating license means having a license issued pursuant to § 50.57 of..., partnership, firm, association, trust, estate, public or private institution, group, Government agency other...
2010-10-01
... tunnel. (e) Freeing port means any direct opening through the vessel's bulwark or hull to quickly drain... 600 nautical miles (1111 kilometers). (o) Scupper means a pipe or tube of at least 30 millimeters (1.25 inches) in diameter leading down from a deck or sole and through the hull to drain water overboard...
Positive Gene Regulation by a Natural Protective miRNA Enables Arbuscular Mycorrhizal Symbiosis.
Couzigou, Jean-Malo; Lauressergues, Dominique; André, Olivier; Gutjahr, Caroline; Guillotin, Bruno; Bécard, Guillaume; Combier, Jean-Philippe
2017-01-11
Arbuscular mycorrhizal (AM) symbiosis associates most plants with fungi of the phylum Glomeromycota. The fungus penetrates into roots and forms within cortical cell branched structures called arbuscules for nutrient exchange. We discovered that miR171b has a mismatched cleavage site and is unable to downregulate the miR171 family target gene, LOM1 (LOST MERISTEMS 1). This mismatched cleavage site is conserved among plants that establish AM symbiosis, but not in non-mycotrophic plants. Unlike other members of the miR171 family, miR171b stimulates AM symbiosis and is expressed specifically in root cells that contain arbuscules. MiR171b protects LOM1 from negative regulation by other miR171 family members. These findings uncover a unique mechanism of positive post-transcriptional regulation of gene expression by miRNAs and demonstrate its relevance for the establishment of AM symbiosis. Copyright © 2017 Elsevier Inc. All rights reserved.
Faust, James J; Doudrick, Kyle; Yang, Yu; Capco, David G; Westerhoff, Paul
2016-01-01
Recent studies indicate the presence of nano-scale titanium dioxide (TiO2) as an additive in human foodstuffs, but a practical protocol to isolate and separate nano-fractions from soluble foodstuffs as a source of material remains elusive. As such, we developed a method for separating the nano and submicron fractions found in commercial-grade TiO2 (E171) and E171 extracted from soluble foodstuffs and pharmaceutical products (e.g., chewing gum, pain reliever, and allergy medicine). Primary particle analysis of commercial-grade E171 indicated that 54% of particles were nano-sized (i.e., E171 and E171 isolated from foodstuffs and pharmaceuticals was accomplished using rate-zonal centrifugation. Commercial-grade E171 was separated into nano- and submicron-enriched fractions consisting of a nano:submicron fraction of approximately 0.45:1 and 3.2:1, respectively. E171 extracted from gum had nano:submicron fractions of 1.4:1 and 0.19:1 for nano- and submicron-enriched, respectively. We show a difference in particle adhesion to the cell surface, which was found to be dependent on particle size and epithelial orientation. Finally, we provide evidence that E171 particles are not immediately cytotoxic to the Caco-2 human intestinal epithelium model. These data suggest that this separation method is appropriate for studies interested in isolating the nano-sized particle fraction taken directly from consumer products, in order to study separately the effects of nano and submicron particles.
Directory of Open Access Journals (Sweden)
David SAMUELS
2011-01-01
Full Text Available
171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">Este artículo explora datos del 171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF K+ Simoncini Garamond';">Estudo Eleitoral Brasileiro 171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">para investigar las bases de apoyo al 171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF K+ Simoncini Garamond';">Partido dos Trabalhadores 171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">(171a; font-size: 6pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">PT171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">, que llegó por primera vez a la Presidencia de la República en Brasil en las elecciones de 2002. Los resultados muestran que los electores del 171a; font-size: 6pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">PT 171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">están más identificados con el liderazgo de Luiz Inácio Lula da Silva, actual presidente y líder histórico del partido, que con la ideología del 171a; font-size: 6pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">PT171a; font-size: 8.5pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">. Sin embargo, los vínculos ideológicos entre el 171a; font-size: 6pt; mso-bidi-font-family: 'BFHAF J+ Simoncini Garamond';">PT 171a; font-size: 8.5pt; mso
Metabolomics and Prostate Cancer
2013-05-01
PRINCIPAL INVESTIGATOR: Fredrik Wiklund CONTRACTING ORGANIZATION: Karolinska Institutet, SE-171 77 Stockholm, Sweden REPORT DATE: May 2013...PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) B and Biostatistics, Karolinska Institutet, P.O. Box 281, SE-171 77 Stockholm, Sweden AND ADDRESS(ES) 8...PERFORMING ORGANIZATION REPORT NUMBER Karolinska Institutet SE-171 77 Stockholm Sweden 9. SPONSORING / MONITORING AGENCY
177Lu-DOTA-Bevacizumab: Radioimmunotherapy Agent for Melanoma.
Camacho, Ximena; Calzada, Victoria; Fernandez, Marcelo; Alonso, Omar; Chammas, Roger; Riva, Eloisa; Gambini, Juan Pablo; Cabral, Pablo
2017-01-01
Vascular endothelial growth factor (VEGF) is one of the classic factors to tumor-induced angiogenesis in several types, including melanoma. Bevacizumab is a humanized monoclonal antibody directed against VEGF. To radiolabel Bevacizumab with 177-Lutetium as a potential radioimmunotherapy agent for melanoma. Bevacizumab was derivatized with DOTA-NHS-ester at 4 ºC for 18 h. DOTABevacizumab was radiolabeled with 177LuCl3 (15 MBq/mg) at 37 ºC for 1 h. The studies were performed in healthy and B16F1 tumor-bearing C57BL/6J mice at 24 and 48 h (n = 5). Scinthigraphic imaging studies were performed at 24 h to determine the radiochemical stability, targeting specificity and pharmacokinetics of the 177Lutetium-labeled antibody. DOTA-Bevacizumab was efficiently labeled with 177LuCl3 at 37 °C. The in-vitro stability of labeled product was optimal over 72 h. In-vivo biodistribution studies showed a high liver and tumor uptake of 177Lu-DOTA-Bevacizumab, with tumor-to-muscle ratios of 11.58 and 6.37 at 24 and 48 h p.i. Scintigraphic imaging of melanoma tumor-bearing C57BL/6J mice showed liver and a high tumor selective uptake of 177Lu-DOTA-Bevacizumab at 24 h. Our results support the potential role of 177Lu-DOTA-Bevacizumab as a novel radioimmunotherapy agent for melanoma. We hope that these novel molecular imaging agents will open the path to new diagnostic and therapeutic strategies for Melanoma disease. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Результаты первого этапа летных испытаний вертолета – летающей лаборатории Ми-171А2
ИВЧИН ВАЛЕРИЙ АНДРЕЕВИЧ; САМСОНОВ КОНСТАНТИН ЮРЬЕВИЧ
2014-01-01
В настоящей работе представлены результаты первого этапа летных испытаний летающей лаборатории модернизированного вертолета Ми-171А2 на базе летающей лаборатории Ми-171А, оборудованного несущим винтом с новыми лопастями из композитных материалов и новым рулевым винтом.
Development of Scintillators in Nuclear Medicine
International Nuclear Information System (INIS)
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality
Development of Scintillators in Nuclear Medicine.
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.
Detector for positronium temperature measurements by two-photon angular correlation
Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.
2018-05-01
We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.
4d--4f emission resonances in laser-produced plasmas
International Nuclear Information System (INIS)
O'Sullivan, G.; Carroll, P.K.
1981-01-01
Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element
High spin K isomeric target of 177mLu
International Nuclear Information System (INIS)
Roig, O.; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D.
2004-01-01
The techniques used to produce a 177m Lu (J π =23/2 - ,T 1/2 =160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of 176 Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the 177m Lu isomer by the 176 Lu(n,γ) reaction. Finally, a chemical separation was performed to extract 10 13 nuclei of 177m Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the 177m Lu
Adamou, Harissou; Magagi, Ibrahim Amadou; Habou, Oumarou; Magagi, Amadou; Maazou, Halidou; Adamou, Mansour; Harouna, Yacouba
2016-01-01
L’occlusion intestinale aigue (OIA) mécanique, représente l’une des pathologies les plus fréquentes en chirurgie digestive d’urgence. L’objectif de cette étude était de décrire les aspects étiologiques et pronostiques des occlusions intestinales aigues mécaniques à l’Hôpital National de Zinder (HNZ), Niger. Il s’agissait d’une étude transversale sur 24 mois (Janvier 2013 à Décembre 2014) ayant inclus tous les patients opérés pour OIA. Les occlusions intestinales mécaniques représentaient 24,50% (n=171) des urgences chirurgicales digestives (n=622). L’âge médian était à 25 ans (extrêmes: 1 jour et 95 ans). Le sexe ratio était à 3,5 en faveur des hommes. Les enfants représentaient 38,60% (n=66). Le siège de l’obstacle était sur le grêle dans 60,82% (n=104), colique dans 21,63%(n=37) et mixte dans 17,54% (n=30). Le mécanisme par strangulation constituait 88,89% (n=152) dont les hernies étranglées avec 49,70% (n=85) et les invaginations intestinales aigues avec 19,88% (n=34) des patients. Les malformations ano-rectales et les tumeurs constituaient les principales étiologies par obstruction avec respectivement 7,02% (n=12) et 3,51% (n=6). Une résection intestinale était faite dans 52 cas (30,41%). Les complications septiques prédominaient (n=39/53), dont la suppuration pariétale (n=23). Le séjour moyen était de 7,82 jours. La mortalité globale était 11,70% (n=20). Celle-ci était corrélée statistiquement à la nécrose intestinale (p=0,01) et au retard d’admission (p=0,04). Les étiologies des OIA sont multiples et dominées par les hernies étranglées. La morbi-mortalité élevée qu’elles entrainent pourrait être évitée par la prise en charge précoce avant l’installation d’une nécrose intestinale. PMID:27800103
Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals
International Nuclear Information System (INIS)
Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki
2013-01-01
177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)
Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride
Czech Academy of Sciences Publication Activity Database
Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.
2012-01-01
Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012
Yang, Yu; Capco, David G.; Westerhoff, Paul
2016-01-01
Recent studies indicate the presence of nano-scale titanium dioxide (TiO2) as an additive in human foodstuffs, but a practical protocol to isolate and separate nano-fractions from soluble foodstuffs as a source of material remains elusive. As such, we developed a method for separating the nano and submicron fractions found in commercial-grade TiO2 (E171) and E171 extracted from soluble foodstuffs and pharmaceutical products (e.g., chewing gum, pain reliever, and allergy medicine). Primary particle analysis of commercial-grade E171 indicated that 54% of particles were nano-sized (i.e., < 100 nm). Isolation and primary particle analysis of five consumer goods intended to be ingested revealed differences in the percent of nano-sized particles from 32%‒58%. Separation and enrichment of nano- and submicron-sized particles from commercial-grade E171 and E171 isolated from foodstuffs and pharmaceuticals was accomplished using rate-zonal centrifugation. Commercial-grade E171 was separated into nano- and submicron-enriched fractions consisting of a nano:submicron fraction of approximately 0.45:1 and 3.2:1, respectively. E171 extracted from gum had nano:submicron fractions of 1.4:1 and 0.19:1 for nano- and submicron-enriched, respectively. We show a difference in particle adhesion to the cell surface, which was found to be dependent on particle size and epithelial orientation. Finally, we provide evidence that E171 particles are not immediately cytotoxic to the Caco-2 human intestinal epithelium model. These data suggest that this separation method is appropriate for studies interested in isolating the nano-sized particle fraction taken directly from consumer products, in order to study separately the effects of nano and submicron particles. PMID:27798677
In Vivo Measurement and Characterization of a Novel Formulation of [177Lu]-DOTA-Octreotate
Directory of Open Access Journals (Sweden)
Dale Bailey
2016-01-01
Full Text Available Objective(s:Lutetium-177 can be made with high specific activity and with no other isotopes of lutetium present, referred to as “No Carrier Added” (NCA 177Lu. We have radiolabelled DOTA-conjugated peptide DOTA‐(Tyr3‐octreotate with NCA 177Lu (“NCA-LuTATE” and used it in nearly 40 therapeutic administrations for subjects with neuroendocrine tumours or meningiomas. In this paper, we report on our initial studies on aspects of the biodistribution and dosimetry of NCA-LuTATE from gamma camera 2D whole body (WB and quantitative 3D SPECT (qSPECT 177Lu imaging. Methods: Thirteen patients received 39 NCA-LuTATE injections. Extensive WB planar and qSPECT imaging was acquired at approximately 0.5, 4, 24 and 96 h to permit estimates of clearance and radiation dose estimation using MIRD-based methodology (OLINDA-EXM. Results:The average amount of NCA-Lutate administered per cycle was 7839±520 MBq. Bi-exponential modelling of whole body clearance showed half lives for the fast & slow components of t½=2.1±0.6 h and t½=58.1±6.6 h respectively. The average effective dose to kidneys was 3.1±1.0 Gy per cycle. In eight patients completing all treatment cycles the average total dose to kidneys was 11.7±3.6 Gy. Conclusions: We have shown that NCA-LuTATE has an acceptable radiation safety profile and is a suitable alternative to Carrier-Added 177Lu formulations. The fast component of the radiopharmaceutical clearance was closely correlated with baseline renal glomerular filtration rate, and this had an impact on radiation dose to the kidneys. In addition, it has less radioactive waste issues and requires less peptide per treatment.
Energy Technology Data Exchange (ETDEWEB)
Rogalev, A. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Goulon, J. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France)], E-mail: goulon@esrf.fr; Wilhelm, F. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Brouder, Ch. [Institut de Mineralogie et de Physique des Milieux Condenses, UMR-CNRS 7590, Universite Paris VI-VII, 4 place Jussieu, F-75252 Paris Cedex 05 (France); Yaresko, A. [Max Planck Institute for Solid State Research, Heisenbergstrasse 1, 70569 Stuttgart (Germany); Ben Youssef, J.; Indenbom, M.V. [Laboratoire de Magnetisme de Bretagne, CNRS FRE 2697, UFR Sciences et Techniques, F-29328 Brest Cedex (France)
2009-12-15
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M{sub 1}-edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {l_brace}Y, Bi{r_brace}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
International Nuclear Information System (INIS)
Rogalev, A.; Goulon, J.; Wilhelm, F.; Brouder, Ch.; Yaresko, A.; Ben Youssef, J.; Indenbom, M.V.
2009-01-01
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M 1 -edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {Y, Bi}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
Publications | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of ... Using Information and Communication Technologies (ICTs) for water ... involving natural, social, and health scientists, engineers, and economists.
Publications | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
We share the results of our funded research, and offer free training materials to guide ... impact on disadvantaged populations, resulting in poor access to quality. ... provide equal distribution of basic health service for people in isolated areas.
40 CFR 763.171 - Labeling requirements.
2010-07-01
... plastic, paper, metal, or other durable substances. Labels must be attached in such a manner that they... Act (15 U.S.C. 2605) as of (insert effective date of ban on distribution in commerce). Distribution of...
49 CFR 171.7 - Reference material.
2010-10-01
.../publications.com; AAR Manual of Standards and Recommended Practices, Section C—Part III, Specifications for... Edition, March 1996 172.102. American Pyrotechnics Association (APA), P.O. Box 30438, Bethesda, MD 20824, (301) 907-8181, www.americanpyro.com: APA Standard 87-1, Standard for Construction and Approval for...
2010-10-01
... ethics counselor regarding the applicability of post-employment restrictions to activities that the... receiving compensation from the contractor, the post-employment ethics opinion described in paragraph (a) of... procurement, rescission of a contract, or initiation of suspension or debarment proceedings. [74 FR 2409, Jan...
171-IJBCS-Article-Dr Rene Bikomo
African Journals Online (AJOL)
Dr Gatsing
étaient fermés par rabattement simple du bord d'ouverture ... (Tableau 1). Le macabo blanc a le moins perdu du poids, en comparaison de la réduction de poids considérable enregistrée sur le macabo rouge pendant la même phase. ... Tableau 1: Analyse de la variance de l'effet de la variété, du stade de maturité, de la.
14 CFR 171.9 - Installation requirements.
2010-01-01
...) The facility must be installed according to accepted good engineering practices, applicable electric... a power distribution system or locally generated, with a supplemental standby system, if needed. (c...
14 CFR 171.159 - Installation requirements.
2010-01-01
... Installation requirements. (a) The facility must be installed according to accepted good engineering practices... must have a reliable source of suitable primary power, either from a power distribution system or...
Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry
Directory of Open Access Journals (Sweden)
Jarrett A. Moyer
2014-01-01
Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.
Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R
2005-12-08
We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.
Transparent Ceramic Scintillator Fabrication, Properties and Applications
International Nuclear Information System (INIS)
Cherepy, N.J.; Kuntz, J.D.; Roberts, J.J.; Hurst, T.A.; Drury, O.B.; Sanner, R.D.; Tillotson, T.M.; Payne, S.A.
2008-01-01
Transparent ceramics offer an alternative to single crystals for scintillator applications such as gamma ray spectroscopy and radiography. We have developed a versatile, scaleable fabrication method, using Flame Spray Pyrolysis (FSP) to produce feedstock which is readily converted into phase-pure transparent ceramics. We measure integral light yields in excess of 80,000 Ph/MeV with Cerium-doped Garnets, and excellent optical quality. Avalanche photodiode readout of Garnets provides resolution near 6%. For radiography applications, Lutetium Oxide offers a high performance metric and is formable by ceramics processing. Scatter in transparent ceramics due to secondary phases is the principal limitation to optical quality, and afterglow issues that affect the scintillation performance are presently being addressed
International Nuclear Information System (INIS)
Syed Ali Raza Naqvi; Rashid Rasheed; Muhammad Tauqeer Ahmed; Ameer Fawad Zahoor
2017-01-01
Sulfadiazine acts through inhibition of bacterial dihydropteroate synthetase. The radio-labeling of sulfadiazine with lutetium-177 ( 177 Lu) is expected to serve as a theranostic agent for deep-seated bacterial infections. The radiosynthesis of 177 Lu-sulfadiazine indicated a > 95% yield under optimized reaction conditions, and promising stability was found in blood serum. Biodistribution data in the absence of infection revealed minimal accumulation in key body organs. Kidneys were the main excretory organs, showed an uptake of 1.76 ± 0.09% ID/g organ at 6-h post-injection. Biodistribution, scintigraphic data, glomerular filtration rate, and cytotoxicity results encourage clinical investigation of 177 Lu-sulfadiazine as a novel theranostic agent for deep-seated bacterial infection. (author)
High spin K isomeric target of {sup 177m}Lu
Energy Technology Data Exchange (ETDEWEB)
Roig, O. E-mail: olivier.roig@cea.fr; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D
2004-03-21
The techniques used to produce a {sup 177m}Lu (J{sup {pi}}=23/2{sup -},T{sub 1/2}=160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of {sup 176}Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the {sup 177m}Lu isomer by the {sup 176}Lu(n,{gamma}) reaction. Finally, a chemical separation was performed to extract 10{sup 13} nuclei of {sup 177m}Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the {sup 177m}Lu.
Ethnologische Nahrungsforschung im östlichen Europa. Esskultur und kulturelle Identität
Czech Academy of Sciences Publication Activity Database
Nosková, Jana
2008-01-01
Roč. 18, č. 3 (2008), s. 171-171 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : East Europe * ethnology * conference review Subject RIV: AC - Archeology, Anthropology, Ethnology
Characterization of active site residues of nitroalkane oxidase.
Valley, Michael P; Fenny, Nana S; Ali, Shah R; Fitzpatrick, Paul F
2010-06-01
The flavoenzyme nitroalkane oxidase catalyzes the oxidation of primary and secondary nitroalkanes to the corresponding aldehydes and ketones plus nitrite. The structure of the enzyme shows that Ser171 forms a hydrogen bond to the flavin N5, suggesting that it plays a role in catalysis. Cys397 and Tyr398 were previously identified by chemical modification as potential active site residues. To more directly probe the roles of these residues, the S171A, S171V, S171T, C397S, and Y398F enzymes have been characterized with nitroethane as substrate. The C397S and Y398 enzymes were less stable than the wild-type enzyme, and the C397S enzyme routinely contained a substoichiometric amount of FAD. Analysis of the steady-state kinetic parameters for the mutant enzymes, including deuterium isotope effects, establishes that all of the mutations result in decreases in the rate constants for removal of the substrate proton by approximately 5-fold and decreases in the rate constant for product release of approximately 2-fold. Only the S171V and S171T mutations alter the rate constant for flavin oxidation. These results establish that these residues are not involved in catalysis, but rather are required for maintaining the protein structure. 2009 Elsevier Inc. All rights reserved.
Digital Repository Service at National Institute of Oceanography (India)
Bhosle, N.B.; McCarrol, D.; Evans, L.V.; Edyvean, R.G.J.
stream_size 15 stream_content_type text/plain stream_name Biofouling_7_171.pdf.txt stream_source_info Biofouling_7_171.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
46 CFR 173.058 - Double bottom requirements.
2010-10-01
... PERTAINING TO VESSEL USE School Ships § 173.058 Double bottom requirements. Each new sailing school vessel... service must comply with the double bottom requirements in §§ 171.105 through 171.109, inclusive, of this...
Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets
International Nuclear Information System (INIS)
Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.
2005-01-01
Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed
The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes
International Nuclear Information System (INIS)
Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.
1981-01-01
The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)
Compartmental analysis to predict biodistribution in radiopharmaceutical design studies
Energy Technology Data Exchange (ETDEWEB)
Lima, Marina F.; Pujatti, Priscilla B.; Araujo, Elaine B.; Mesquita, Carlos H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)], e-mail: mflima@ipen.br
2009-07-01
The use of compartmental analysis allows the mathematical separation of tissues and organs to determinate the concentration of activity in each fraction of interest. Although the radiochemical purity must observe Pharmacopoeia specification (values upper 95%), very lower contains of free radionuclides could contribute significantly as dose in the neighborhood organs and make tumor up take studies not viable in case of radiopharmaceutical on the basis of labeled peptides. Animal studies with a product of Lutetium-177 labeled Bombesin derivative ({sup 177}Lu-BBNP) developed in IPEN-CNEN/SP and free Lutetium-177 developed in CNEA/EZEIZA was used to show how subtract free {sup 177}Lu contribution over {sup 177}Lu-BBNP to estimate the radiopharmaceutical potential as diagnosis or therapy agent. The first approach of the studies included the knowledge of chemical kinetics and mimetism of the Lutetium and the possible targets of the diagnosis/therapy to choose the possible models to apply over the sampling standard methods used in experimental works. A model with only one physical compartment (whole body) and one chemical compartment ({sup 177}Lu-BBNP) generated with the compartmental analysis protocol ANACOMP showed high differences between experimental and theoretical values over 2.5 hours, in spite of the concentration of activity had been in a good statistics rang of measurement. The values used in this work were residence time from three different kinds of study with free {sup 177}Lu: whole body, average excretion and maximum excretion as a chemical compartment. Activity concentration values as time function in measurements of total whole body and activity measurement in samples of blood with projection to total circulating blood volume with {sup 177}Lu-BBNP. Considering the two sources of data in the same modeling a better consistence was obtained. The next step was the statistic treatment of biodistribution and dosimetry in mice (Balb C) considering three chemical
Electro-kinetic separation of rare earth elements using a redox-active ligand
Energy Technology Data Exchange (ETDEWEB)
Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)
2017-10-16
Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Simultaneous molecular and anatomical imaging of the mouse in vivo
International Nuclear Information System (INIS)
Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R
2002-01-01
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice
Simultaneous molecular and anatomical imaging of the mouse in vivo
Energy Technology Data Exchange (ETDEWEB)
Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)
2002-12-21
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.
Single crystalline LuAG fibers for homogeneous dual-readout calorimeters
International Nuclear Information System (INIS)
Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G
2013-01-01
For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m
Design and development of 1 mm resolution PET detectors with position-sensitive PMTs
Shao, Y; Chatziioannou, A F
2002-01-01
We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.
International Nuclear Information System (INIS)
Bodryakov, V.Yu.; Povzner, A.A.
2000-01-01
The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru
Unraveling the nature of B[e] star candidates
Czech Academy of Sciences Publication Activity Database
Arias, M.L.; Torres, A.F.; Cidale, L.S.; Kraus, Michaela
2013-01-01
Roč. 56, č. 1 (2013), s. 171-174 E-ISSN 1669-9521 Institutional support: RVO:67985815 Keywords : Be star * massive star * spectroscopic observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www. astronomia argentina.org.ar/b56/2013baaa...56...171A.pdf
Czech Academy of Sciences Publication Activity Database
Lízal, Lubomír; Kočenda, Evžen
č. 171 (2001), s. 1-23 ISSN 1211-3298 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : corruption * transition * hidden economy Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp171.pdf
Characterization of Active Site Residues of Nitroalkane Oxidase†
Valley, Michael P.; Fenny, Nana S.; Ali, Shah R.; Fitzpatrick, Paul F.
2010-01-01
The flavoenzyme nitroalkane oxidase catalyzes the oxidation of primary and secondary nitrolkanes to the corresponding aldehydes and ketones plus nitrite. The structure of the enzyme shows that Serl71 forms a hydrogen bond to the flavin N5, suggesting that it plays a role in catalysis. Cys397 and Tyr398 were previously identified by chemical modification as potential active site residues. To more directly probe the roles of these residues, the S171A, S171V, S171T, C397S, and Y398F enzymes have been characterized with nitroethane as substrate. The C397S and Y398 enzymes were less stable than the wild-type enzyme, and the C397S enzyme routinely contained a substoichiometric amount of FAD. Analysis of the steady-state kinetic parameters for the mutant enzymes, including deuterium isotope effects, establishes that all of the mutations result in decreases in the rate constants for removal of the substrate proton by ~5-fold and decreases in the rate constant for product release of ~2-fold. Only the S171V and S171T mutations alter the rate constant for flavin oxidation. These results establish that these residues are not involved in catalysis, but rather are required for maintaining the protein structure. PMID:20056514
Regulation of rice root development by a retrotransposon acting as a microRNA sponge.
Cho, Jungnam; Paszkowski, Jerzy
2017-08-26
It is well documented that transposable elements (TEs) can regulate the expression of neighbouring genes. However, their ability to act in trans and influence ectopic loci has been reported rarely. We searched in rice transcriptomes for tissue-specific expression of TEs and found them to be regulated developmentally. They often shared sequence homology with co-expressed genes and contained potential microRNA-binding sites, which suggested possible contributions to gene regulation. In fact, we have identified a retrotransposon that is highly transcribed in roots and whose spliced transcript constitutes a target mimic for miR171. miR171 destabilizes mRNAs encoding the root-specific family of SCARECROW-Like transcription factors. We demonstrate that retrotransposon-derived transcripts act as decoys for miR171, triggering its degradation and thus results in the root-specific accumulation of SCARECROW-Like mRNAs. Such transposon-mediated post-transcriptional control of miR171 levels is conserved in diverse rice species.
49 CFR 171.8 - Definitions and abbreviations.
2010-10-01
... chemical reaction between a fuel, such as hydrogen or hydrogen rich gases, alcohols, or hydrocarbons, and... reaction. This may be achieved by methods such as adding an inhibiting chemical, degassing the hazardous... requirements: (1) Has an engineering degree and one year of work experience in cargo tank structural or...
19 CFR 171.51 - Application and definitions.
2010-04-01
... Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...) Controlled substance. “Controlled substance” has the meaning given in 21 U.S.C. 802. (4) Normal and customary... knowledge is sufficient. An established norm, standard, or custom is persuasive but not conclusive or...
76 FR 171 - Paper Clips From China
2011-01-03
... changes, if any, in the supply and demand conditions or business cycle for the Domestic Like Product that... disclosure of business proprietary information (BPI) under an administrative protective order (APO) and APO..., a U.S. or foreign trade or business association, or another interested party (including an...
Gender | Page 171 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
As an engine of economic growth, private enterprise plays an important role in ... In helping developing countries pursue private sector development strategies that ... supported by IDRC is laying the groundwork for more inclusive growth.
Search Results | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Survey on the Use of Mobile Telephone for Micro and Small Business Development in ... (ICTs) have become key factors driving social and economic advancement. ... Microfinance and Information and Communication Technologies : HIVOS ...
Performance study of Philips digital silicon photomultiplier coupled to scintillating crystals
International Nuclear Information System (INIS)
Liu, Z.; Pizzichemi, M.; Paganoni, M.; Auffray, E.; Lecoq, P.
2016-01-01
Silicon photomultipliers (SiPMs) and scintillators are often arranged in the shape of arrays in Positron Emission Tomography (PET) systems. Digital SiPMs provide signal readout in single photon avalanche diode (SPAD) level. From the photon count rate measurement of each SPAD cell of digital SiPM, we found that the output scintillating photons distribute in an area larger than the scintillator physical coupling area. Taking advantage of the possibility to enable/disable individual cells of the digital SiPM, a group of Lutetium-yttrium oxyorthosilicate (LYSO) crystals with different dimensions coupled to a digital SiPM was used to study the influence of using different SiPM active area on the number of photons detected, energy resolution and coincidence time resolution (CTR). For the same crystal coupled to the digital SiPM, the larger the active area of digital SiPM, the higher the number of photons detected. The larger active area of the digital SiPM also results in a better energy resolution after saturation correction. The best energy resolution full width half maximum (FWHM) obtained for the 2×2×5mm 3 , 2×2×10 mm 3 , 2×2×15mm 3 , 2×2×20mm 3 LYSO crystals was 10.7%, 11.6%, 12.1%, 12.5%, respectively. For crystals with different cross sections coupled to the digital SiPM, we found that the larger the cross section of coupling area, the more photons were detected and thus a better energy resolution was obtained. The CTR of crystals fully wrapped with Teflon or without wrapping was measured by positioning two identical crystals facing each other. A larger area of digital SiPM improves the CTR and the CTR reaches the plateau when the active area is larger than 2.2×2.2mm 2 with both two configurations of wrapping. The best CTR value for the 2×2×5mm 3 , 2×2×10mm 3 , 2×2×15mm 3 , 2×2×20mm 3 LYSO crystals was 128.9 ps, 148.4 ps, 171.6 ps, 177.9 ps, respectively. The measurements performed lead us to conclude that optimising the coupling between crystal
2011-05-13
... Zhongbao Metal Manufactured Co., Ltd.; (9) Zhejiang Lucky Cloud Hanger Co., Ltd.; (10) Ningbo Dasheng... Metal Manufactured Co., Ltd....... 1.71 Zhejiang Lucky Cloud Hanger Co., Ltd 1.71 Ningbo Dasheng Hanger... disclosed under APO in accordance with 19 CFR 351.305, which continues to govern business proprietary...
Final Report: Scintillator Materials for Medical Applications, December 1, 1997 - November 30, 1999
International Nuclear Information System (INIS)
Lempicki, A.; Brecher, C.; Wojtowicz, A.J.; Szupryczynski, P.
2000-01-01
From the very beginning of our program we regarded the understanding of the scintillation mechanism as our primary mission. If in addition this understanding could lead to the discovery of a new material, so much the better. When we began this work some nine years ago, the theoretical basis for the scintillation phenomenon was in disarray. The initial and final steps were reasonably well characterized, but there was no consensus on the crucial intermediate, the transfer of energy from the lattice to the emitting center. In the over 40 publications that resulted from this program, we demonstrated that despite the highly insulating nature of the hosts and the great magnitude of the band gap, the primary means of transport is through mobile charge carriers and their sequential capture by the emitting center. Although radical at the time, this picture is now generally accepted throughout the field. Subsequently, we also recognized the critical role that trapping centers localized at lattice defects can play in the process, not merely as passive sources of loss but as active participants in the kinetics. In this sense shallow traps can wreak more havoc than deep ones, impeding the rate by which carriers can reach the emitting centers and seriously slowing the resulting decay. And we established low-temperature thermoluminescence as a comprehensive tool for quantizing these effects. As for new and better materials, our work also had an impact. We were among the first to recognize the potential of LuAlO 3 (lutetium aluminum perovskite, or LuAP) as a detector for PET applications. Although this material has not supplanted LuSiO 5 (lutetium oxysilicate, or LSO) in terms of light output or absence of afterglow, LuAP still exhibits by far the highest figure of merit (light output divided by decay time) of any scintillator material currently known. Our work has also bought into stark view the dismaying realization of just how improbable it is that a material will ever be found
Separation device of radio lanthanides (DISER)
International Nuclear Information System (INIS)
Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.
2008-01-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and
Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)
Energy Technology Data Exchange (ETDEWEB)
Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com
2008-07-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-08-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Energy Technology Data Exchange (ETDEWEB)
Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.
2016-08-21
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Directory of Open Access Journals (Sweden)
Hideo Honma
2012-10-01
Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.
2013-09-09
... Electronics Corporation, 1 Sharp Plaza, Mahwah, NJ 07495. Sony Computer Entertainment, Inc., 1-7-1 Konan... Boulevard, 2nd Floor, Foster City, CA 94404. Sony Corporation, 1-7-1 Konan, Minato-ku, Tokyo 108-0075, Japan. Sony Corporation of America, 550 Madison Avenue, Floor 27, New York, NY 10022-3211. Sony Electronics...
77 FR 15529 - Revision of Fee Schedules; Fee Recovery for Fiscal Year 2012
2012-03-15
... and 171 Revision of Fee Schedules; Fee Recovery for Fiscal Year 2012; Proposed Rule #0;#0;Federal... REGULATORY COMMISSION 10 CFR Parts 170 and 171 [NRC-2011-0207] RIN 3150-AJ03 Revision of Fee Schedules; Fee..., inspection, and annual fees charged to its applicants and licensees. The proposed amendments are necessary to...
76 FR 14747 - Revision of Fee Schedules; Fee Recovery for Fiscal Year 2011
2011-03-17
... 171 Revision of Fee Schedules; Fee Recovery for Fiscal Year 2011; Proposed Rule #0;#0;Federal Register... COMMISSION 10 CFR Parts 170 and 171 RIN 3150-AI93 [NRC-2011-0016] Revision of Fee Schedules; Fee Recovery for... fees charged to its applicants and licensees. The proposed amendments are necessary to implement the...
76 FR 72082 - Miscellaneous Administrative Changes
2011-11-22
... the 2008 administrative rule. Revise Table Formatting Error in 10 CFR Part 171 The table in paragraph (c) of Sec. 171.16 is missing a colon and a hard return that would separate the heading... subsequent list item, ``35 to 500 employees.'' The formatting errors are corrected, adding a colon after the...
Zhang, X.; Beynen, A.C.
1992-01-01
Female weanling rats were fed diets with soybean protein, casein or cod meal at 171, 342 or 513 mmol nitrogen/100 g for 3 wk. The diets were isonitrogenous and balanced for fat, cholesterol, calcium, magnesium and phosphorus. Cod meal feeding at 171 and 342 mmol nitrogen/100 g diet produced lower
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan
2011-01-01
Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011
Mitic, Milos; Brkic, Zeljka; Lukic, Iva; Adzic, Miroslav
2017-08-30
Accumulating evidence strongly suggest that impaired glucocorticoid receptor (GR) signaling is involved in stress-related mood disorders, and nominate GR as a potential target for antidepressants (ADs). It is known that different classes of ADs affects the GR action via modifying its phosphorylation, while the mechanism through which ADs alter GR phosphorylation targeted by GSK3β, a kinase modulated via serotonin neurotransmission, are unclear. On this basis, we investigated whether GSK3β-GR signaling could be a convergence point of fluoxetine action on brain function and behavior, by examining its effect on GSK3β targeted-GR phosphorylation on threonine 171 (pGR171), and expression of GR-regulated genes in the hippocampus of female and male rats exposed to chronic isolation stress. Stress induced sex-specific GSK3β-targeted phosphorylation of pGR171 in the nucleus of the hippocampus of stressed animals. Namely, while in females stress triggered coupled action of GSK3β-pGR171 signaling, in males changes in pGR171 levels did not correspond to GSK3β activity. On the other hand, fluoxetine managed to up-regulate this pathway in sex-unbiased manner. Furthermore, fluoxetine reverted stress-induced changes in most of the analyzed genes in males, CRH, 5-HT1a and p11, while in females its effect was limited to CRH. These data further suggest that pGR171 signaling affects cellular localization of GR in response to chronic stress and fluoxetine in both sexes. Collectively, our results describe a novel convergence point between GR signaling and GSK3β pathway in rat hippocampus in response to stress and fluoxetine in both sexes and its involvement in fluoxetine-regulated brain function in males. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
O'Connell, A.M.; Keeling, F.; Given, M.; Logan, M.; Lee, M.J.
2008-01-01
Historically, fine-needle aspiration cytology (FNAC) has varying sensitivity, specificity and accuracy in the diagnosis of abdominal lesions with a high insufficient sampling rate. We compared 20-G fine-needle trucut biopsy (FNTB) with FNAC results in the biopsy of solid abdominal tumours. A retrospective review of 171 (128x 20-G FNTB and 43x FNAC) ultrasound-guided biopsies of abdominal tumours on 157 patients (male : female 85:72, mean age 61.25 years) were carried out. One hundred and seventy-one biopsies were carried out: liver 109, pancreas 19, lumph node 10, omentum 5, right iliac fossa mass 6, adrenal 6 and others 16. An average of 2.06 and 1.97 passes (range 1-4) were carried out per FNTB and FNAC, respectively. A definitive diagnosis was made in 122/128 biopsies (95.3%) and 32/43 biopsies (74.4%) for FNTB and FNAC, respectively. Diagnoses consisted of metastatic liver disease (74/171), pancreatic adenocarcinoma (10/171), lymphoma (8/171) and others (33/171) and benign (29/171). No significant complications occurred in either group. The sensitivity, specificity, positive predictive value, negative predictive value and accuracy were 87, 100, 100, 50, 84.4 and 93.1, 100, 100, 60, 71.4 for FNTB and FNAC, respectively. A greater and more consistent positive diagnosis rate is yielded by 20-G FNTB (95.3%) that FNAC (74.4%). The diagnostic accuracy of FNTB is 84.4% cmopared with 69.8% for FNAC. A greater insufficient sampling rate occurs with FNAC (25.6%) than with FNTB (4.7%). For abdominal biopsy, 20-G FNTB needles have a much higher yield than FNAC with no increase in complications. FNTB is the preferred choice, particularly where cytological assistance at the time of biopsy is unavailable.
78 FR 60928 - Request To Amend a License To Export High-Enriched Uranium
2013-10-02
... NUCLEAR REGULATORY COMMISSION Request To Amend a License To Export High-Enriched Uranium Pursuant... manufacture HEU The Netherlands. National Nuclear Security Uranium uranium (17.1 targets in France... export from 9.4 kg of U-235 contained in 10.1 kg uranium to a new cumulative total of 17.1 kg of U-235...
What do we know about mass ejection in B Supergiant Stars?
Czech Academy of Sciences Publication Activity Database
Haucke, M.; Tomić, S.; Cidale, L.S.; Kraus, Michaela; Aret, A.
2016-01-01
Roč. 58, č. 1 (2016), s. 171-173 E-ISSN 1669-9521 R&D Projects: GA ČR(CZ) GA14-21373S Institutional support: RVO:67985815 Keywords : stars * early-type * supergian Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www. astronomia argentina.org.ar/b58/2016baaa...58...171H.pdf
40 CFR 421.216 - Pretreatment standards for new sources.
2010-07-01
....171 Selenium 0.380 0.171 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 61.720 27.130 Fluoride 16.210 9.214 (b) Roaster SO2 scrubber. PSNS for the Primary Molybdenum and Rhenium Subcategory Pollutant....377 0.621 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 223.800 98.390 Fluoride 58.770 33.410 (c...
Comparative evaluation of two methods for 172Tm production in nuclear reactors
International Nuclear Information System (INIS)
Cohen, I.M.; Hayes, Alejandro; Melcer, Elsa
2016-01-01
A comparative evaluation of two methods for the production of 172 Tm in nuclear reactors is carried out. They are respectively based on two chains of double neutron capture reactions, 170 Er(n,γ) 171 Er(n,γ) 172 Er(β - ) 172 Tm and 170 Er(n,γ) 171 Er(β - ) 171 Tm(n,γ) 172 Tm, and a chain of triple neutron capture: 169 Tm(n,γ) 170 Tm(n,γ) 71 Tm(n,γ) 172 Tm. Theoretical considerations with respect to both ways of production are formulated and the mathematical equation are solved. Experiments of irradiation of Er 2 O 3 and Tm 2 O 3 were performed. Advantages and drawbacks of both methods are discussed. (author)
Czech Academy of Sciences Publication Activity Database
Starý, Petr; Kavallieratos, N. G.; Petrović, A.; Žikić, V.; Rakhshani, E.; Tomanović, S.; Tomanović, Ž.; Havelka, Jan
2014-01-01
Roč. 14, č. 1 (2014), article number 171 ISSN 1536-2442 Grant - others:Ministry of Education, Science, and Technological Development of the Republic of Serbia(RS) 173006 Institutional support: RVO:60077344 Keywords : Aphis fabae * Impatiens glandulifera * Lysiphlebus Subject RIV: EG - Zoology Impact factor: 1.025, year: 2014 http://jinsectscience.oxfordjournals.org/content/14/1/171
Talbot, Pauline; Radziwill-Bienkowska, Joanna M; Kamphuis, Jasper B J; Steenkeste, Karine; Bettini, Sarah; Robert, Véronique; Noordine, Marie-Louise; Mayeur, Camille; Gaultier, Eric; Langella, Philippe; Robbe-Masselot, Catherine; Houdeau, Eric; Thomas, Muriel; Mercier-Bonin, Muriel
2018-06-19
Titanium dioxide (TiO 2 ) particles are commonly used as a food additive (E171 in the EU) for its whitening and opacifying properties. However, the risk of gut barrier disruption is an increasing concern because of the presence of a nano-sized fraction. Food-grade E171 may interact with mucus, a gut barrier protagonist still poorly explored in food nanotoxicology. To test this hypothesis, a comprehensive approach was performed to evaluate in vitro and in vivo interactions between TiO 2 and intestinal mucus, by comparing food-grade E171 with NM-105 (Aeroxyde P25) OECD reference nanomaterial. We tested E171-trapping properties of mucus in vitro using HT29-MTX intestinal epithelial cells. Time-lapse confocal laser scanning microscopy was performed without labeling to avoid modification of the particle surface. Near-UV irradiation of E171 TiO 2 particles at 364 nm resulted in fluorescence emission in the visible range, with a maximum at 510 nm. The penetration of E171 TiO 2 into the mucoid area of HT29-MTX cells was visualized in situ. One hour after exposure, TiO 2 particles accumulated inside "patchy" regions 20 µm above the substratum. The structure of mucus produced by HT29-MTX cells was characterized by MUC5AC immunofluorescence staining. The mucus layer was thin and organized into regular "islands" located approximately 20 µm above the substratum. The region-specific trapping of food-grade TiO 2 particles was attributed to this mucus patchy structure. We compared TiO 2 -mediated effects in vivo in rats after acute or sub-chronic oral daily administration of food-grade E171 and NM-105 at relevant exposure levels for humans. Cecal short-chain fatty acid profiles and gut mucin O-glycosylation patterns remained unchanged, irrespective of treatment. Food-grade TiO 2 is trapped by intestinal mucus in vitro but does not affect mucin O-glycosylation and short-chain fatty acid synthesis in vivo, suggesting the absence of a mucus barrier impairment under "healthy gut
International Nuclear Information System (INIS)
Ott, Oliver J.; Lotter, Michael; Fietkau, Rainer; Strnad, Vratislav
2009-01-01
Purpose: To analyze patient-, disease-, and treatment-related factors for their impact on cosmetic outcome (CO) after interstitial multicatheter accelerated partial-breast irradiation (APBI). Patients and Methods: Between April 2001 and January 2005, 171 patients with early breast cancer were recruited in Erlangen for this subanalysis of the German-Austrian APBI phase II-trial. 58% (99/171) of the patients received pulsed-dose-rate (PDR), and 42% (72/171) high-dose-rate (HDR) brachytherapy. Prescribed reference dose for HDR brachytherapy was 32 Gy in eight fractions of 4 Gy, twice daily. Prescribed reference dose in PDR brachytherapy was 49.8 Gy in 83 consecutive fractions of 0.6 Gy each hour. Total treatment time was 3-4 days. Endpoint of this evaluation was the CO, graded as excellent, good, fair, or poor. Patients were divided in two groups with an excellent (n = 102) or nonexcellent (n = 69) cosmetic result. Various factors were analyzed for their impact on excellent CO. Results: The median follow-up time was 52 months (range: 21-91 months). Cosmetic results were rated as excellent in 59.6% (102/171), good in 29.8% (51/171), fair in 9.9% (17/171), and poor in 0.6% (1/171). The initial cosmetic status was significantly worse for the nonexcellent CO group (p = 0.000). The percentage of patients who received PDR brachytherapy APBI was higher in the nonexcellent CO group (68.1% vs. 51%; p = 0.026). Acute toxicity was higher in the nonexcellent CO group (24.6% vs. 12.7%; p = 0.045). Furthermore, the presence of any late toxicity was found to be associated with a worse cosmetic result (65.2% vs. 18.6%; p = 0.000). In detail, the appearance of skin hyperpigmentation (p 0.034), breast tissue fibrosis (p = 0.000), and telangiectasia (p = 0.000) had a negative impact on CO. Conclusion: The initial, surgery-associated cosmetic status, brachytherapy modality, and the presence of acute and late toxicities were found to have an impact on overall CO. Our data have proven that
Liu, G; Gelboin, H V; Myers, M J
1991-02-01
The role of P450 IA2 in the hydroxylation of acetanilide was examined using an inhibitory monoclonal antibody (MAb) 1-7-1 and vaccinia cDNA expression producing murine P450 IA1 (mIA1), murine P450 IA2 (mIA2), or human P450 IA2 (hIA2). Acetanilide hydroxylase (AcOH) activity was measured using an HPLC method with more than 500-fold greater sensitivity than previously described procedures. This method, which does not require the use of radioactive acetanilide, was achieved by optimizing both the gradient system and the amount of enzyme needed to achieve detection by uv light. MAb 1-7-1 inhibits up to 80% of the AcOH activity in both rat liver microsomes and cDNA expressed mouse and human P450 IA2. MAb 1-7-1, which recognizes both P450 IA1 and P450 IA2, completely inhibits the aryl hydrocarbon hydroxylase (AHH) activity of cDNA expressed in IA1. The inhibition of only 80% of the AHH activity present in MC liver microsomes by MAb 1-7-1 suggests that additional P450 forms are contributing to the overall AHH activity present in methylcholanthrene (MC)-liver microsomes as MAb 1-7-1 almost completely inhibits the AHH activity of expressed mIA1. Maximal inhibition of IA2 by 1-7-1 results in an 80% decrease in acetanilide hydroxylase activity in both liver microsomes and expressed mouse and human IA2. The capacity of MAb 1-7-1 to produce identical levels of inhibition of acetanilide hydroxylase activity in rat MC microsomes (80%) and in expressed mouse (81%) and human P450 IA2 (80%) strongly suggests that P450 IA2 is the major and perhaps the only enzyme responsible for the metabolism of acetanilide. These results demonstrate the complementary utility of monoclonal antibodies and cDNA expression for defining the contribution of specific P450 enzymes to the metabolism of a given substrate. This complementary approach allows for a more precise determination of the inhibitory capacity of MAb with respect to the metabolic capacity of the target P450.
Bettini, Sarah; Boutet-Robinet, Elisa; Cartier, Christel; Coméra, Christine; Gaultier, Eric; Dupuy, Jacques; Naud, Nathalie; Taché, Sylviane; Grysan, Patrick; Reguer, Solenn; Thieriet, Nathalie; Réfrégiers, Matthieu; Thiaudière, Dominique; Cravedi, Jean-Pierre; Carrière, Marie; Audinot, Jean-Nicolas; Pierre, Fabrice H; Guzylack-Piriou, Laurence; Houdeau, Eric
2017-01-20
Food-grade titanium dioxide (TiO 2 ) containing a nanoscale particle fraction (TiO 2 -NPs) is approved as a white pigment (E171 in Europe) in common foodstuffs, including confectionary. There are growing concerns that daily oral TiO 2 -NP intake is associated with an increased risk of chronic intestinal inflammation and carcinogenesis. In rats orally exposed for one week to E171 at human relevant levels, titanium was detected in the immune cells of Peyer's patches (PP) as observed with the TiO 2 -NP model NM-105. Dendritic cell frequency increased in PP regardless of the TiO 2 treatment, while regulatory T cells involved in dampening inflammatory responses decreased with E171 only, an effect still observed after 100 days of treatment. In all TiO 2 -treated rats, stimulation of immune cells isolated from PP showed a decrease in Thelper (Th)-1 IFN-γ secretion, while splenic Th1/Th17 inflammatory responses sharply increased. E171 or NM-105 for one week did not initiate intestinal inflammation, while a 100-day E171 treatment promoted colon microinflammation and initiated preneoplastic lesions while also fostering the growth of aberrant crypt foci in a chemically induced carcinogenesis model. These data should be considered for risk assessments of the susceptibility to Th17-driven autoimmune diseases and to colorectal cancer in humans exposed to TiO 2 from dietary sources.
African Journals Online (AJOL)
Items 151 - 171 of 171 ... Vol 3, No 1 (2009), Supplementation of Graded Levels of Wheat Bran to Intact and Castrated Afar Sheep Fed Urea Treated Tef Straw: Effects on Feed Intake ... Vol 2, No 2 (2008), The Effect of Inclusion Rate of Cooked and Sun-dried Fish Offal Meal on Feed Intake, Growth and Feed Efficiency of Rhode ...
The interpretation of the amended RAF Act 56 of 1996 and the ...
African Journals Online (AJOL)
The RAF Amendment Act 19 of 2005 came into effect on 1 August 2008 and sections 17(1) and 17(1A) introduced the concept of “serious injury”. This entails that a third-party claimant who wishes to claim compensation for non-patrimonial loss suffered after a motor-vehicle accident has to prove that his or her injury is ...
Asymptotic behaviour of solutions to a system of Schrödinger equations
Czech Academy of Sciences Publication Activity Database
Carvajal, X.; Gamboa, P.; Nečasová, Šárka; Nguyen, H. H.; Vero, O.
2017-01-01
Roč. 2017, č. 171 (2017), s. 1-23 ISSN 1072-6691 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : coupled Schrodinger system * energy conservation * global solution * growth of solutions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.954, year: 2016 https://ejde.math.txstate.edu/Volumes/2017/171/abstr.html
Lighting Study Security System Modifications
1978-05-01
I7, 7 ,177 uo~ 6w4, 7~% 4 1 :, 0 b17 1 7AS, ti19 1537 " 1 7Ž7 1 4bd 7c6 sP113 -oC-b 4I4 14, ൙ j 0 I ? I I I 1 ,io i .Ž - 3?b A 1 . 1 I t...113 j7 171k ~ 1 e~ 3 1 171~ tD 40 4’j 1 1 -0’ r17 171t d~7 In. -’Ao ?I M .4 P1 ro 4 3e" 34*v t 1~ -1 73- 1 - Itfi 3CI7 4e (.,4~?~~. 3 1i jlý A4 3 e b
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)
2017-01-21
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography
Energy Technology Data Exchange (ETDEWEB)
O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com
2015-07-01
Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.
International Nuclear Information System (INIS)
Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun
2017-01-01
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl
International Nuclear Information System (INIS)
Ovchar, L.A.; Poluehktov, N.S.
1980-01-01
The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru
Current trends in scintillator detectors and materials
International Nuclear Information System (INIS)
Moses, W.W.
2002-01-01
The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency
International Nuclear Information System (INIS)
Kanias, G.D.
1985-01-01
Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)
Energy Technology Data Exchange (ETDEWEB)
Zhang, Qian [College of Chemical Engineering, HuaQiao University, Xiamen 361021 (China); Liang, Xiao [School of Environment and Architecture, University of Shanghai for Science and Technology, Shanghai 200093 (China); Chen, Bor-Yann [Department of Chemical and Materials Engineering, National I-Lan University, 26047, Taiwan (China); Chang, Chang-Tang, E-mail: ctchang@niu.edu.tw [Department of Environmental Engineering, National I-Lan University, 26047, Taiwan (China)
2015-12-01
Highlights: • The degradation pathways of RB5, RB171 and RR198 have been identified. • The favorable bond to be broken under photo degradation was deciphered in this research. • The breakages of the bonds were due to the electron density changes around the bonds. • The hydroxyl radicals as the main oxidized species were confirmed by positive hole trapper and ESR. - Abstract: This study tended to decipher the mechanism of photo degradation of azo dyes, which bond was favorable to be broken for application of wastewater decolorization. That is, from chemical structure perspective, the critical substituents to affect electron donor/acceptor for dye degradation would be identified in this research. The model reactive blacks (RB5), reactive blue 171 (RB171) and reactive red 198 (RR198) were degraded by graphene loaded TiO{sub 2}, indicating how the electron withdrawing and releasing groups affect azo dye degradability. The byproducts and intermediate products were analyzed by ultraviolet–visible spectroscopy (UV–vis), gas chromatography–mass spectrometry (GC–MS) and ion chromatography (IC). Furthermore, the radicals involved in the reaction were found by electron paramagnetic resonance (ESR) to confirm the main oxidized species of hydroxyl radicals rather than the light generated positive holes. The finding revealed that the breakages of the bonds were due to the electron density changes around the bonds. This principle can be applicable not only for RB5 degradation, but also for reactive blue 171 (RB171), reactive red 198 (RR198) and some other textile dyes.
Road Materials and Pavement Design Volume 17(1)
CSIR Research Space (South Africa)
De Beer, Morris
2016-03-01
Full Text Available Materials and Pavement Design Volume 17, 2016 - Issue 1 Editorial Board Page ebi | Published online: 03 Oct 2016 http://dx.doi.org/10.1080/14680629.2016.1244475 Editors-in-Chief Hervé DI BENEDETTO - University of Lyon/ENTPE, Vaulx-en-Velin, France... Andrew Charles COLLOP - De Montfort University, Leicester, UK William G. BUTTLAR - University of Missouri, Urbana-Champaign, USA Editor-in-Chief at Large Jorge B. Sousa - Consulpav, Oeiras, Portugal Associate Editors Morris de Beer - CSIR Built...
48 CFR 217.171 - Multiyear contracts for services.
2010-10-01
... services (e.g., ground maintenance, in-plane refueling, bus transportation, and refuse collection and... installation being closed or realigned under a base closure law as defined in 10 U.S.C. 2667(h)(2); or (C) A... Public Law 105-56 and similar sections in subsequent DoD appropriations acts); or (ii) A cancellation...
What we do | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Equity Gauge Zambia : Enhancing Governance, Equity and Health ... of community organizations, health workers and other actors in the health system. ... China, Far East Asia, India, Kenya, North And Central America, Panama, Peru, South ...
47 CFR 87.171 - Class of station symbols.
2010-10-01
... RLO—VHF omni-range RLS—Surveillance radar RLT—Radionavigation land test RLW—Microwave landing system RNV—Radio Navigation Land/DME RPC—Ramp Control TJ—Aircraft earth station in the Aeronautical Mobile...
What we do | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... Health, Livelihoods and Sustainable Production Systems (Sub-Saharan Africa) ... North And Central America, Panama, Peru, South America, North Of Sahara, ... IDRC supported the development and testing of a reliable and cost-efficient ...
17 CFR 171.24 - Submission of the record.
2010-04-01
... previously served on the party appealing. If the party appealing objects to the materials included or..., at any time, direct that an omission or misstatement be corrected and, if necessary, that a...
40 CFR 80.171 - Product transfer documents (PTDs).
2010-07-01
... (PTDs). (a) Contents. For each occasion when any gasoline refiner, importer, reseller, distributor... or CARB-based certification, or under a certification option which creates an oxygenate or PRC use restriction, then the PTD for the additized product must identify the applicable use restriction. The PTD for...
Sex Discrimination in Employment. Research Report No. 171.
Morris, J. David; Wood, Linda B.
This report examines the status of women and the laws that have been enacted to protect women from discrimination in employment. Written in lay language, it examines employment and occupational statistics for women in the United States and in Kentucky. Following an introduction in Chapter 1, the report presents four chapters surveying the problem,…
What we do | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... sharing our knowledge with policymakers, researchers, and communities around the world;; fostering new talent by offering fellowships and awards; and; putting new knowledge into the hands of those who can use it best to address global challenges. Part of Canada's foreign affairs and development efforts, IDRC invests ...
14 CFR 171.273 - Maintenance and operations requirements.
2010-01-01
... authorized persons. (3) FCC licensing requirements for operations and maintenance personnel. (4) Posting of..., with a maximum corrective maintenance time of not greater than 1.5 hours. This measure applies to... than 1,500 hours. This measure applies to unscheduled outages, out-of-tolerance conditions, and...
14 CFR 171.323 - Fabrication and installation requirements.
2010-01-01
..., using applicable electric and safety codes and Federal Communications Commission (FCC) licensing... time not to exceed 1.5 hours. This measure applies to correction of unscheduled failures of the monitor... measure applies to unscheduled outage, out-of-tolerance conditions, and failures of the monitor...
50 CFR 216.171 - Effective dates and definitions.
2010-10-01
... concern listed in next bullet) found dead or live on shore within a two day period and occurring on same... distress. (2) Shutdown (this definition specifically applies only to the word as used in § 216.174(a)(1... live, in the water animal involved in a USE. ...
Report on INT Program INT-17-1a
Energy Technology Data Exchange (ETDEWEB)
Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Blackmon, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Elster, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Launey, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lee, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Scielzo, N. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-04-19
The purpose of the 5-week program was to bring together physicists from the low-energy nuclear structure and reaction communities to identify avenues for achieving reliable and predictive descriptions of reactions involving nuclei across the isotopic chart. The 4-day embedded workshop focused on connecting theory developments to experimental advances and data needs for astrophysics and other applications.
Dilmi, S.; Saib, S.; Bouarissa, N.
2018-06-01
Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.
International Nuclear Information System (INIS)
Stierman, R.J.
1982-12-01
Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions
Exudate Chemical Profiles Derived from Lespedeza and Other Tallgrass Prairie Plant Species
2017-05-01
Chemical Profiles Derived from Lespedeza and Other Tall- grass Prairie Plant Species. ERDC TN-17-1. Vicksburg, MS: U.S. Army Engineer Re- search and...200-1-52. Washington, DC: U.S. Army Corps of Engineers Headquarters, Civil Works. https://www.wbdg.org/ffc/army-coe/public-works-technical-bulletins...ERDC TN-17-1 May 2017 Approved for public release; distribution is unlimited. Exudate Chemical Profiles Derived from Lespedeza and Other
Athinarayanan, Jegan; Alshatwi, Ali A; Periasamy, Vaiyapuri S; Al-Warthan, Abdulrahman A
2015-02-01
Titanium dioxide (E171) and silicon dioxide (E551) are common additives found in food products, personal-care products, and many other consumer products used in daily life. Recent studies have reported that these food additives (manufactured E171 and E551) contain nanosized particles of less than 100 nm. However, the particle size distribution and morphology of added TiO2 and SiO2 particles are not typically stated on the package label. Furthermore, there is an increasing debate regarding health and safety concerns related to the use of synthetic food additives containing nanosized ingredients in consumer products. In this study, we identified the size and morphology of TiO2 and SiO2 particles in commercially available food products by using transmission electron microscope (TEM). In addition, the in vitro toxicological effects of E171 and E551 on human mesenchymal stem cells (hMSCs), an adult stem cell-based model, were assessed using the MTT assay and a flow cytometry-based JC-1 assay. Our TEM results confirmed the presence of nanoscale ingredients in food products, and the in vitro toxicology results indicated that the nanoscale E171 and E551 ingredients induced dose-dependent cytotoxicity, changes in cellular morphology, and the loss of mitochondrial trans-membrane potential in hMSCs. These preliminary results clearly demonstrated that the nanoscale E171 and E551 particles had adverse effects on hMSCs by inducing oxidative stress-mediated cell death. Accordingly, further studies are needed to identify the specific pathway involved, with an emphasis on differential gene expression in hMSCs. © 2015 Institute of Food Technologists®
A radiographic study of nasopalatine duct cysts
Energy Technology Data Exchange (ETDEWEB)
Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral Radiology, College of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)
1993-02-15
The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.
A radiographic study of nasopalatine duct cysts
International Nuclear Information System (INIS)
Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae
1993-01-01
The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.
Hörsch, Dieter; Ezziddin, Samer; Haug, Alexander; Gratz, Klaus Friedrich; Dunkelmann, Simone; Miederer, Matthias; Schreckenberger, Mathias; Krause, Bernd Joachim; Bengel, Frank M; Bartenstein, Peter; Biersack, Hans-Jürgen; Pöpperl, Gabriele; Baum, R P
2016-05-01
Monocentric and retrospective studies indicate effectiveness of peptide receptor radionuclide therapy targeting somatostatin receptors of neuroendocrine neoplasms. We assessed overall and progression-free survival and adverse events of peptide receptor radionuclide therapy by a multi-institutional, board certified registry with prospective follow-up in five centres in Germany. A total of 450 patients were included and followed for a mean of 24.4 months. Most patients had progressive low- or intermediate grade neuroendocrine neoplasms and 73% were pretreated with at least one therapy. Primary neuroendocrine neoplasms were mainly derived of pancreas (38%), small bowel (30%), unknown primary (19%) or bronchial system (4%). Patients were treated with Lutetium-177 in 54%, with Yttrium-90 in 17% and with both radionuclides in 29%. Overall and progression-free survival was determined with Kaplan-Meier curves and uni-variate log rank test Cox models. Median overall survival of all patients was 59 (95% confidence interval [CI] 49-68.9) months. Overall survival was significantly inferior in the patients treated with Yttrium-90 solely (hazard ratio, 3.22; 95% CI, 1.83-5.64) compared to any peptide receptor radionuclide therapy with Lutetium-177. Grade II (hazard ratio, 2.06; 95% CI, 0.79-5.32) and grade III (hazard ratio, 4.22; 95% CI, 1.41-12.06) neuroendocrine neoplasms had significantly worse overall survival than grade I neuroendocrine neoplasms. Patients with small neuroendocrine neoplasms of small bowel had significantly increased survival (hazard ratio, 0.39; 95% CI, 0.18-0.87) compared to neuroendocrine neoplasms of other locations. Median progression-free survival was 41 (35.9-46.1) months and significantly inferior in patients treated with Yttrium solely (hazard ratio, 2.7; 95% CI, 1.71-4.55). Complete remission was observed in 5.6% of patients, 22.4% had a partial remission, 47.3% were stable and 4% were progressive as best response. Adverse events of bone marrow
Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation
International Nuclear Information System (INIS)
Ramsey, W.G.; Miller, D.; Minichan, R.; Coleman, L.; Schumacher, R.; Hardy, B.; Jones, R.
1994-01-01
Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass
On the nature of emission of the star-gas-dust complex of the W1 radio source
International Nuclear Information System (INIS)
Udal'tsov, V.A.; Kovalenko, A.V.
1982-01-01
The brightness distribution of the radio source W 1 at 102 MHz has been investigated with the 187x384 m radio telescope in Pushchino. It is shown that W 1 is genetically connected with the stellar association Ceph IV as well as with the extended emission nebula GS 285 which consists of numerous nebulae, including two bright ones, Sharpless (S) 171 and NGC 7822. The radio emission of the nebula S 171 is shown to be thermal, and there is no Supernova remnant in it, in contrast with the other authors' suggestion. By two independent methods, the distance to S 171 has been evaluated to be 840 pc. The emission of NGC 7822 is mainly thermal. The extended nebula GS 285 is a thermal source, not a remnant of a Supernova that had exploded in a dense gas - dust medium, as was believed by other authors. Attention is drawn to the wrong identification by many authors of the radio source in the S 171 region with the nebula NGC 7822. It is shown that when measuring the difference of spectral indices of two sources, the calibration error may be eliminated if their calibration at given frequency is made by means of the same source [ru
Directory of Open Access Journals (Sweden)
Wolfgang DIETRICH
2010-10-01
Full Text Available
171a; font-size: 8pt;">El autor refleja la construcción de la música nacional en el proceso del devenir del Estado nacional guatemalteco. Este proceso comienza formalmente a principios del siglo XIX, pero no ha concluido aún. Para el mito del Estado nación y para aquellos que lo utilizan para su proyecto de dominación, es de importancia decisiva que la música nacional se distinga externamente de las músicas expresadas por otras naciones, y para usos internos sirva al proceso de homogeneización nacional. Desde los mediados del siglo XIX la música en Guatemala se utiliza para transmitir ideologías que sirven a la construcción de tal mito. La música vernácula de los pueblos mayas no sigue esta lógica, por lo tanto está considerada inferior o «incorrecta». Para el mito del Estado nación sólo el pueblo como concepto abstracto en su conjunto, y no el grupo concreto e individual, podría entender y valorar la música nacional. Suponiendo esto, la música nacional se convirtió en una herramienta elemental y efectiva del mecanismo represivo de la deculturación.
171a; font-size: 8pt;">
171a; font-size: 8pt;">La marimba entonces funciona como símbolo del Estado nación guatemalteco. Las dictaduras militares, siendo ellas las principales responsables del genocidio contra los mayas, declararon la marimba cromática instrumento nacional. Tras un largo camino de violencia la marimba desindianizada y por lo tanto ladinizada, se convirtió en instrumento nacional. En el período de la violencia, la marimba cromática no cesó de sonar en los sitios nocturnos y en los restaurantes elegantes de la capital
Indian Academy of Sciences (India)
n(n + 1)/2. This can be proved easily in several ways. For example, if 8 denotes the sum of first n natural numbers, then 8 = 1:7=1 i = 1:7=1 (n+ I-i) and therefore. 28 = E7=I(i+n+l-i) = n(n+l) which gives 8 = n(n+. 1)/2. One can also use the principle of mathematical induction to prove the result. Here we present a proof.
Sustainability of rare earth elements chain: from production to food - a review.
Turra, Christian
2018-02-01
Rare earth elements (REE) are a group of chemical elements that include lanthanoids (lanthanum to lutetium), scandium and yttrium. In the last decades, the REE demand in the industry and other areas has increased significantly. In general, REE have shown low concentrations in soils, plants, water and atmosphere, but they may accumulate in such environments due to anthropogenic inputs. In areas where there is REE contamination, the slow accumulation of these elements in the environment could become problematic. Many studies have shown environmental areas contaminated with REE and their toxic effects. Thus, it is important to review, in order to improve the current understanding of these elements in the environment, showing the effects of REE exposure in mining, soil, water, plants and food. Besides, there are few suppliers and a limited quantity of these elements in the world. This paper suggests options to improve the sustainability management of REE chain.
International Nuclear Information System (INIS)
Jarý, V; Mihóková, E; Mareš, J A; Beitlerová, A; Nikl, M; Kurtsev, D; Sidletskiy, O
2014-01-01
We provide a systematic comparison of the scintillation and luminescence properties, including emission mechanisms, of the highly efficient cerium-doped scintillators lutetium-(gadolinium) orthosilicates Lu 2 (SiO 4 )O (LSO), (Lu 1−x Gd x ) 2 (SiO) 4 O(LGSO) and Gd 2 (SiO 4 )O (GSO). Determined characteristics manifest an advantage of LGSO:Ce with respect to both LSO:Ce and GSO:Ce for scintillator applications around room temperature. This is thanks to combined fast decay (faster than both limit compositions) high light yield, similar to that of LSO:Ce (twice higher than GSO:Ce) and low afterglow, similar to that of GSO:Ce (almost two orders of magnitude lower than LSO:Ce). High temperature applications do not, however, seem to be a suitable option for LGSO:Ce due to evidenced thermal ionization of both Ce1 and Ce2 centres above room temperature. (paper)
International Nuclear Information System (INIS)
Romanova, E.Yu.; Bazarov, B.G.; Tushinova, Yu.L.; Fedorov, K.N.; Bazarova, Zh.G.; Klevtsova, R.F.; Glinskaya, L.A.
2007-01-01
Interactions in the ternary system K 2 MoO 4 -Lu 2 (MoO 4 ) 3 -Hf(MoO 4 ) 2 have been studied by X-ray powder diffraction and differential thermal analysis. A new triple (potassium lutetium hafnium) molybdate with the 5 : 1 : 2 stoichiometry has been found. Monocrystals of this molybdate have been grown. Its X-ray diffraction structure has been refined (an X8 APEX automated diffractometer, MoK α radiation, 1960 F(hkl), R = 0.0166). The trigonal unit cell has the following parameters: a = 10.6536(1) A, c = 37.8434(8) A, V=3719.75(9) A, Z = 6, space group R3-bar c. The mixed 3D framework of the structure is built of Mo tetrahedra sharing corners with two independent (Lu,Hf)O 6 octahedra. Two sorts of potassium atoms occupy large framework voids [ru
International Nuclear Information System (INIS)
Finston, H.L.; Williams, E.T.
1976-01-01
There has been significant progress on the project to measure the neutron-capture cross sections of reactor produced radionuclides, in particular, centering on the problems with nuclides such as 22 Na which may have a resonance for thermal-neutron capture. The thermal capture cross section of less than 40 b has been verified for 54 Mn, and cadmium ratios have been determined for 184 Re in the V-11 and V-14 positions in the HFBR. Lutetium has been used as a neutron temperature monitor for the Brookhaven reactors. Preliminary results on the project to determine the effect of chemical state on the branching ratio in 58 Co are reported. Procedures for aerosol collection and analysis by proton-induced x-ray emission (PIXE) are reported. A program to analyze aerosols for polycyclic aromatic hydrocarbons has been initiated. Progress is reported on the experimental verification of the proposed acid-base hypothesis
Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil
International Nuclear Information System (INIS)
Goncalves, P.; Navarro, F.C.; Roveri, C.D.; Bergerman, M.G.
2016-01-01
Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)
Effect on the variation of the moment of inertia in band K=1/2
International Nuclear Information System (INIS)
Liu Yanxin; Yu Shaoying; Inner Mongolia Univ. for Nationalities, Tongliao; Chinese Academy of Sciences, Beijing
2004-01-01
The effect on the variation of the moment of inertia in band 171 Yb[521]1/2 is investigated using the particle number conserving (PNC) method for treating the cranked shell model with monopole and Y 20 quadrupole pairing interactions. The experimental moments of inertia of 171 Yb[521]1/2 (signature α=±1/2) and the blocking effect of proton are reproduced well by the PNC calculation, in which no free parameter is involved. (authors)
Ghosts in the nursery: a case study of the maternal representations of a woman who killed her baby
Directory of Open Access Journals (Sweden)
A Gous
2005-11-01
Full Text Available The maternal representations as described by Stern (1995:171-190 are used in an extreme case to illustrate the link between depression and pathogenic maternal representations. Opsomming Die moedervoorstellings soos dit deur Stern (1995:171-190 beskryf word, word in ‘n ekstreme geval gebruik om die verband tussen depressie en patogene moedervoorstellings aan te toon. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.
DEFF Research Database (Denmark)
Jensen, Ditte Marie; Christophersen, Daniel Vest; Sheykhzade, Majid
2018-01-01
-grade particle exposure on vasomotor function and systemic oxidative stress in an ex vivo study and intragastrically exposed rats.Methods: In an ex vivo study, aorta rings from naive Sprague-Dawley rats were exposed for 30 min to food-grade TiO2 (E171), benchmark TiO2 (Aeroxide P25), food-grade vegetable carbon...... (E153) or benchmark carbon black (Printex 90). Subsequently, the vasomotor function was assessed in wire myographs. In an in vivo study, lean Zucker rats were exposed intragastrically once a week for 10 weeks to vehicle, E171 or E153. Doses were comparable to human daily intake. Vasomotor function...... no differences between groups.Conclusion: Gastrointestinal tract exposure to E171 and E153 was associated with modest albeit statistically significant alterations in the vasocontraction and vasorelaxation responses. Direct particle exposure to aorta rings elicited a similar type of response. The vasomotor...
Gonçalves, A C; Matos, T D; Simões-Teixeira, H R; Pimenta Machado, M; Simão, M; Dias, O P; Andrea, M; Fialho, G; Caria, H
2014-04-01
Low-frequency sensorineural hearing loss (LFSNHL) is an unusual type of HL in which frequencies at 2,000 Hz and below are predominantly affected. Most of the families with LFSNHL carry missense mutations in WFS1 gene, coding for wolframin. A Portuguese patient aged 49, reporting HL since her third decade of life, and also referring tinnitus, was shown to display bilateral moderate LFSNHL after audiological evaluation. Molecular analysis led to the identification of a novel mutation, c.511G>A (p.Asp171Asn), found in heterozygosity in the exon 5 of the WFS1 gene, and changing the aspartic acid at position 171 to an asparagine, in the extracellular N-terminus domain of the wolframin protein. This novel mutation wasn't present either in 200 control chromosomes analyzed or in the hearing proband's half-brother, and it had not been reported in 1000 Genomes, Exome Variant Server, HGMD or dbSNP databases. No mutations were found in GJB2 and GJB6 genes. Multi-alignment of 27 wolframin sequences from mammalian species, against the human wolframin sequence in ConSurf, indicated a conservation score corresponding to 7 in a 1-9 color scale where 9 is conserved and 1 is variable. In addition, the mutation p.Asp171Asn was predicted to be damaging and possibly damaging by SIFT and Polyphen-2, respectively. The auditory phenotype of this patient could thus be due to the novel mutation p.Asp171Asn. Further functional characterization might enable to elucidate in which way the change in the residue 171, as other changes introduced by LFSNHL-associated mutations previously described, leads to this type of HL. Copyright © 2014 Elsevier B.V. All rights reserved.
Jie, Peng; Zhe, Ma; Chengwei, Hua; Huixing, Lin; Hui, Zhang; Chengping, Lu; Hongjie, Fan
2017-01-06
Swine streptococcosis is a significant threat to the Chinese pig industry, and Streptococcus equi ssp. zooepidemicus (SEZ) is one of the major pathogens. SEZ ATCC35246 is a classical virulent strain, while SEZ ST171 is a Chinese attenuated vaccine strain. In this study, we employed stable isotope labeling by amino acids in cell culture and liquid chromatography-mass spectrometry (LC-MS) to determine the differential response of macrophages to infection by these two strains. Eighty-seven upregulated proteins and 135 downregulated proteins were identified. The proteomic results were verified by real-time polymerase chain reaction for 10 chosen genes and Western blotting for three proteins. All differentially abundant proteins were analyzed for their Gene Ontology and Kyoto Encyclopedia of Genes and Genomes annotations. Certain downregulated proteins were associated with immunity functions, and the upregulated proteins were related to cytomembrane and cytoskeleton regulation. The phagocytosis rate and cytokine genes transcription in Raw264.7 cells during SEZ ATCC35246 and ST171 infection were detected to confirm the bioinformatics results. These results showed that different effects on macrophage phagocytosis and cytokine expression might explain the different phenotypes of SEZ ATCC35246 and ST171 infection. This research provided clues to the mechanisms of host immunity responses to SEZ ST171and SEZ ATCC35246, which could identify potential therapy and vaccine development targets.
Bodo, Enrico
2015-09-03
By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).
Energy Technology Data Exchange (ETDEWEB)
Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)
2013-12-15
In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.
International Nuclear Information System (INIS)
Feng Wenlin; Zheng Wenchen; Liu Honggang; Li, X.M.
2011-01-01
Highlights: → We found a energy matrix of 4f 13 ion in cubic crystals and external magnetic field. → Optical and EPR data of Yb 3+ : InP are explained by diagonalizing the energy matrix. → Signs of hyperfine structure constants A( 171 Yb 3+ ) and A( 173 Yb 3+ ) are determined. - Abstract: The complete energy matrix for a 4f 13 ion in cubic crystals and under an external magnetic field is established by means of the irreducible tensor operator and/or equivalent operator methods. By diagonalizing the energy matrix, four optical spectrum band positions and three spin-Hamiltonian parameters [g factor and hyperfine structure constants A( 171 Yb 3+ ) and A( 173 Yb 3+ )] for Yb 3+ in InP semiconductor are calculated together. The calculated results are in good agreement with the experimental values. The signs of hyperfine structure constants A( 171 Yb 3+ ) and A( 173 Yb 3+ ) are determined from the calculations. The results are discussed.
48 CFR 411.171 - Solicitation provisions and contract clauses.
2010-10-01
... provision at 452.211-70, Brand Name or Equal, in solicitations, other than those for construction, where “brand name or equal” purchase descriptions are used. (b) Contracting officers shall insert the clause at..., Attachment to Statement of Work/Specifications, when there are attachments to the description (statement of...
29 CFR 4.171 - “Bona fide” fringe benefits.
2010-07-01
... plans or trusts of the types listed in 26 U.S.C. 401(a) which are disapproved by the Internal Revenue Service as not satisfying the requirements of section 401(a) of the Internal Revenue Code or which do not... expenses incident to employment, incentive or suggestion awards, and recruitment bonuses, as well as tools...
44 CFR 206.171 - Crisis counseling assistance and training.
2010-10-01
... description of the organizational structure of the program, including designation by the Governor of an... assistance based on recommendations of the Regional Administrator and the Secretary; (ii) Obligate funds and... books, documents, papers, and records that pertain to Federal funds, equipment, and supplies received...
26 CFR 1.171-2 - Amortization of bond premium.
2010-04-01
... annual accrual periods. Example 3. Holder uses accrual method of accounting—(i) Facts. The facts are the same as in Example 1 of this paragraph (c) except that A uses an accrual method of accounting. Thus... disbursements method of accounting, and C decides to use annual accrual periods ending on January 15 of each...
AN/GRC-171 Rivet Switch Multichannel UHF/AM Transceiver
1975-03-01
1879CS/LGMG Arellano, Cayetno A Chief, ATC Operations 1879CS/ FFA Capt Rucker, William C. CMSgt McCallum, Duncan Control Tower Chief Contractor...9/* zs L-f-ZO 7s. to ZJ-S’ 59.9s GENERAL PURPOSE FORM AFCS iaoot/io«i . o.^...,«.., ,,,,„ i ,„„„ lIBS^pnnwWWIW^ Bpp ^BWTWRPIP»^ 4.3.15 AN
All projects related to | Page 171 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... Miscellaneous, Natural Resources, Science and Technology, Social Policy ... Greening Small and Medium Enterprises: Its Impact on Competitiveness and ... RESEARCH NETWORKS, RESEARCH CENTRES, Science and Technology ... As countries steadily increase the share and value of knowledge, information, and ...
Potential probiotic of Lactobacillus johnsonii LT171 for chicken ...
African Journals Online (AJOL)
STORAGESEVER
2009-11-02
Nov 2, 2009 ... ISSN 1684–5315 © 2009 Academic Journals. Full Length Research Paper ... ability to the mucus and antibacterial effects against pathogens is the major .... medium consisting of skim milk (1%) and agar (1.5%). Clear zones.
48 CFR 3009.171-5 - Serious felonies prohibiting award.
2010-10-01
... ethics of the business concern; or are of a nature that is inconsistent with the mission of FPS..., including those arising out of a procurement contract, cooperative agreement, grant or other assistance... the integrity or business ethics of the business concern; or is of a nature that is inconsistent with...
49 CFR 171.16 - Detailed hazardous materials incident reports.
2010-10-01
... containing any hazardous material suffers structural damage to the lading retention system or damage that..., explosion or dangerous evolution of heat (i.e., an amount of heat sufficient to be dangerous to packaging or personal safety to include charring of packaging, melting of packaging, scorching of packaging, or other...
Energy Technology Data Exchange (ETDEWEB)
Goncalves, P.; Navarro, F.C.; Roveri, C.D. [Universidade Federal de Alfenas (UNIFAL), MG (Brazil); Bergerman, M.G., E-mail: pattypgpatty@gmail.com [Universidade de Sao Paulo (USP), SP (Brazil)
2016-07-01
Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)
Mengucci, P; Auffray, E; Barucca, G; Cecchi, C; Chipaux, R; Cousson, A; Davì, F; Di Vara, N; Rinaldi, D; Santecchia, E
2015-01-01
Five single crystals of cerium-doped lutetium yttrium oxyorthosilicate (LYSO:Ce) grown by the Czochralski method were submitted to structural characterisation by X-ray (XRD) and neutron (ND) diffraction, scanning (SEM) and transmission (TEM) electron microscopy and energy dispersive microanalysis (EDS). The Ultimate Tensile Strength (UTS), the Young Modulus (YM) and the Light Yield (LY) of the samples were also measured in order to correlate the mechanical and the optical behaviour of the crystals with the characteristics of their microstructure. Two of the samples analysed were also heat treated at 300 °C for 10 h to evidence possible variations induced by the temperature in the optical and mechanical response of the crystals. Results showed that the mean compositional variations evidenced by the structural analyses do not affect the mechanical and optical behaviour of the samples. On the contrary, the thermal treatment could induce the formation of coherent spherical particles (size 10 to 15 nm), not unifo...
International Nuclear Information System (INIS)
Bolivar, S.L.; Hensley, W.K.; Van Haaften, I.J.; Pirtle, J.; George, W.E.; Gallimore, D.; Apel, C.; Hansel, J.
1980-07-01
This report contains uranium analyses for 1251 water samples and multielement analyses for 1536 sediment samples. Sediments were analyzed for uranium and thorium as well as aluminum, antimony, barium, beryllium, bismuth, cadmium, calcium, cerium, cesium, chlorine, chromium, cobalt, copper, dysprosium, europium, gold, hafnium, iron, lanthanum, lead, lithium, lutetium, magnesium, manganese, nickel, niobium, potassium, rubidium, samarium, scandium, silver, sodium, strontium, tantalum, terbium, tin, titanium, tungsten, vanadium, ytterbium, and zinc. Water samples were initially analyzed for uranium by fluorometry. All water samples containing more than 40 ppB uranium were reanalyzed by delayed-neutron counting (DNC). All sediments were analyzed for uranium by DNC. Other elemental concentrations in sediments were determined by neutron activation analysis for 31 elements, by x-ray fluorescence for 9 elements, and by arc-source emission spectrography for 2 elements. Analytical results for sediments are reported as parts per million. Descriptions of procedures used for analysis of water and sediment samples as well as analytical precisions and detection limits are given
Performance study of Philips digital silicon photomultiplier coupled to scintillating crystals
Liu, Z.; Auffray, E.; Lecoq, P.; Paganoni, M.
2016-01-01
Silicon photomultipliers (SiPMs) and scintillators are often arranged in the shape of arrays in Positron Emission Tomography (PET) systems. Digital SiPMs provide signal readout in single photon avalanche diode (SPAD) level. From the photon count rate measurement of each SPAD cell of digital SiPM, we found that the output scintillating photons distribute in an area larger than the scintillator physical coupling area. Taking advantage of the possibility to enable/disable individual cells of the digital SiPM, a group of Lutetium-yttrium oxyorthosilicate (LYSO) crystals with different dimensions coupled to a digital SiPM was used to study the influence of using different SiPM active area on the number of photons detected, energy resolution and coincidence time resolution (CTR). For the same crystal coupled to the digital SiPM, the larger the active area of digital SiPM, the higher the number of photons detected. The larger active area of the digital SiPM also results in a better energy resolution after saturation...
International Nuclear Information System (INIS)
Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.
2000-01-01
This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate α-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained ∼ 1(wt)% of the alpha-emitting isotope 244 Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain 244 Cm, 241 Am, or 249 Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms
Scandium, yttrium and the lanthanide metals
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
The hydroxide and oxide phases that exist for scandium(III) include scandium hydroxide, which likely has both amorphous and crystalline forms, ScOOH(s), and scandium oxide. This chapter presents the data selected for the stability constants of the polymeric hydrolysis species of scandium at zero ionic strength. The behaviour of yttrium, and the lanthanide metals, in the environment is largely dependent on their solution equilibria. Hydrolysis and other complexation reactions of yttrium and the lanthanide metals are important in the disposal of nuclear waste. The trivalent lanthanide metals include lanthanum(III) through lutetium(III). A number of studies have reported a tetrad effect for the geochemical behaviour of the lanthanide series, including stability constants and distribution coefficients. The solubility of many of the lanthanide hydroxide phases has been studied at fixed ionic strength. In studying the hydrolysis of cerium(IV), a number of studies have utilised oxidation-reduction reactions in determining the relevant stability constants.
First ionization potential of the heaviest actinide lawrencium, element 103
Directory of Open Access Journals (Sweden)
Sato Tetsuya K.
2016-01-01
Full Text Available The first ionization potential (IP1 of element 103, lawrencium (Lr, has been successfully determined for the first time by using a newly developed method based on a surface ionization process. The measured IP1 value is 4.9630.080.07 eV. This value is the smallest among those of actinide elements and is in excellent agreement with the value of 4.963(15 eV predicted by state-of-the-art relativistic calculations also performed in this work. Our results strongly support that the Lr atom has an electronic configuration of [Rn]7s25f147p11/2, which is influenced by strong relativistic effects. The present work provides a reliable benchmark for theoretical calculations and also opens the way for studies on atomic properties of heavy elements with atomic number Z > 100. Moreover, the present achievement has triggered a controversy on the position of lutetium (Lu and Lr in the Periodic Table of Elements.
Eppard, Elisabeth; de la Fuente, Ana; Mohr, Nicole; Allmeroth, Mareli; Zentel, Rudolf; Miederer, Matthias; Pektor, Stefanie; Rösch, Frank
2018-02-27
In this work, the in vitro and in vivo stabilities and the pharmacology of HPMA-made homopolymers were studied by means of radiometal-labeled derivatives. Aiming to identify the fewer amount and the optimal DOTA-linker structure that provides quantitative labeling yields, diverse DOTA-linker systems were conjugated in different amounts to HPMA homopolymers to coordinate trivalent radiometals Me(III)* = gallium-68, scandium-44, and lutetium-177. Short linkers and as low as 1.6% DOTA were enough to obtain labeling yields > 90%. Alkoxy linkers generally exhibited lower labeling yields than alkane analogues despite of similar chain length and DOTA incorporation rate. High stability of the radiolabel in all examined solutions was observed for all conjugates. Labeling with scandium-44 allowed for in vivo PET imaging and ex vivo measurements of organ distribution for up to 24 h. This study confirms the principle applicability of DOTA-HPMA conjugates for labeling with different trivalent metallic radionuclides allowing for diagnosis and therapy.
Studies on sampling and homogeneous dual readout calorimetry with meta-crystals
Mavromanolakis, G; Lecoq, P
2011-01-01
The meta-crystals concept is an approach that consists of using both undoped and properly doped heavy crystal fibers of identical material as the active medium of a calorimeter. The undoped fibers behave as Cherenkov radiators while the doped ones behave as scintillators. A dual readout calorimeter can be built with its sensitive volume composed of a mixture of both types of crystals. In addition if the calorimeter is adequately finely segmented it can also function as a particle flow calorimeter at the same time. In this way one could possibly combine the advantages of both the particle flow concept and the dual readout scheme. We discuss the approach of dual readout calorimetry with meta-crystals made of Lutetium Aluminium Garnet (LuAG). We brie fly present studies on the material development and first testbeam activities and then focus on performance expectation studies based on simulation. We discuss in more detail the results from generic systematic scannings of the design parameters of a dual readout ca...
Luminescent lanthanide reporters: new concepts for use in bioanalytical applications
International Nuclear Information System (INIS)
Vuojola, Johanna; Soukka, Tero
2014-01-01
Lanthanides represent the chemical elements from lanthanum to lutetium. They intrinsically exhibit some very exciting photophysical properties, which can be further enhanced by incorporating the lanthanide ion into organic or inorganic sensitizing structures. A very popular approach is to conjugate the lanthanide ion to an organic chromophore structure forming lanthanide chelates. Another approach, which has quickly gained interest, is to incorporate the lanthanide ions into nanoparticle structures, thus attaining improved specific activity and a large surface area for biomolecule immobilization. Lanthanide-based reporters, when properly shielded from the quenching effects of water, usually express strong luminescence emission, multiple narrow emission lines covering a wide wavelength range, and exceptionally long excited state lifetimes enabling time-gated luminescence detection. Because of these properties, lanthanide-based reporters have found widespread applications in various fields of life. This review focuses on the field of bioanalytical applications. Luminescent lanthanide reporters and assay formats utilizing these reporters pave the way for increasingly sensitive, simple, and easily automated bioanalytical applications. (topical review)
Energy Technology Data Exchange (ETDEWEB)
Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.
2000-04-21
This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate {alpha}-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained {approximately} 1(wt)% of the alpha-emitting isotope {sup 244}Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain {sup 244}Cm, {sup 241}Am, or {sup 249}Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms.
ORF Alignment: NC_006322 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 12 PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 171 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCS...HCGGSGQL Sbjct: 1 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 60 ...
ORF Alignment: NC_006270 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 12 PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 171 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCS...HCGGSGQL Sbjct: 1 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 60 ...
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available th = 129 ... Query: 171 RKRAEEVANENREKYQKLFHMLPIGISITDAHGDILEANCQFAEMVGARRIQPESWRKLP 230 ... RKRAEEVANENREKYQKLFHMLPIGISITDAH...GDILEANCQFAEMVGARRIQPESWRKLP Sbjct: 1 ... RKRAEEVANENREKYQKLFHMLPIGISITDAH
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 231 ... Query: 171 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 230 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL
ORF Alignment: NC_003901 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KIVEYTTREAFWDLYKPGCDEHLVLHKIRKVPAFVKELDFVACDEDT 60 ... Query: 135 IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL 171 ... ... ... IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL Sbjct: 121 IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL 157
Weapons Storage Area Survey of Munitions Storage Igloos at Medina Annex, San Antonio, Texas
2013-11-13
Attachment 2 Contaminants of Concern 1. General. Early nuclear weapons used polonium -beryllium (Po-Be) initiators to generate neutrons during the... foods . b. Compositions. Figure 2-1 is a histogram of key isotopic mixtures of uranium by mass. The composition for DU is a moderately depleted...200 199 230 210 255 286 Min = 171 6 258 193 243 199 188 196 171 212 190 210 207 223 203 211 214 237 257 Median = 209 A B C D E F G H I J K L M N O P Q
Overview of recent results from the WEGA stellarator
Czech Academy of Sciences Publication Activity Database
Otte, M.; Laqua, H.P.; Chlechowitz, E.; Marsen, S.; Preinhaelter, Josef; Stange, T.; Rodatos, A.; Urban, Jakub; Zhang, D.
2012-01-01
Roč. 57, č. 2 (2012), 171-175 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] R&D Projects: GA ČR GA202/08/0419; GA MŠk 7G09042 Institutional research plan: CEZ:AV0Z20430508 Keywords : magnetic confinement * supra-thermal particles * electron Bernstein waves * Stellarator * WEGA * ECRH Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012 http://www.nukleonika.pl/www/back/full/vol57_2012/v57n2p171f.pdf
ORF Alignment: NC_003277 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KWAIVEESKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEF 60 ... Query: 504 PDKAWIND...TILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 554 ... PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN Sbjct: 121 PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 171
ORF Alignment: NC_006855 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KWAIVEESKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEF 60 ... Query: 504 PDKAWIND...TILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 554 ... PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN Sbjct: 121 PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 171
Scintillation properties of selected oxide monocrystals activated with Ce and Pr
Wojtowicz, Andrzej J.; Drozdowski, Winicjusz; Wisniewski, Dariusz; Lefaucheur, Jean-Luc; Galazka, Zbigniew; Gou, Zhenhui; Lukasiewicz, Tadeusz; Kisielewski, Jaroslaw
2006-01-01
In the last 10-15 years there has been a significant effort toward development of new, more efficient and faster materials for detection of ionizing radiation. A growing demand for better scintillator crystals for detection of 511 keV gamma particles has been due mostly to recent advances in modern imaging systems employing positron emitting radionuclides for medical diagnostics in neurology, oncology and cardiology. While older imaging systems were almost exclusively based on BGO and NaI:Tl crystals the new systems, e.g., ECAT Accel, developed by Siemens/CTI, are based on recently discovered and developed LSO (Lu 2SiO 5:Ce, Ce-activated lutetium oxyorthosilicate) crystals. Interestingly, despite very good properties of LSO, there still is a strong drive toward development of new scintillator crystals that would show even better performance and characteristics. In this presentation we shall review spectroscopic and scintillator characterization of new complex oxide crystals, namely LSO, LYSO, YAG, LuAP (LuAlO 3, lutetium aluminate perovskite) and LuYAP activated with Ce and Pr. The LSO:Ce crystals have been grown by CTI Inc (USA), LYSO:Ce, LuAP:Ce and LuYAP:Ce crystals have been grown by Photonic Materials Ltd., Scotland (PML is the only company providing large LuAP:Ce crystals on a commercial scale), while YAG:Pr and LuAP:Pr crystals have been grown by Institute of Electronic Materials Technology (Poland). All these crystals have been characterized at Institute of Physics, N. Copernicus University (Poland). We will review and compare results of measurements of radioluminescence, VUV spectroscopy, scintillation light yields, scintillation time profiles and low temperature thermoluminescence performed on these crystals. We will demonstrate that all experiments clearly indicate that there is a significant room for improvement of LuAP, LuYAP and YAG. While both Ce-activated LSO and LYSO perform very well, we also note that LuYAP:Ce, LuAP:Ce and YAG:Pr offer some
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available bjct: 1 ... HLEGQDDVELHYIVTMFVDIKGSTRLNLLLDLHDAFYVKNRILQAAIDVVRSLDGHPHRL 60 ... Query: 201 GDDGEVLWGRYGHGNVCEVTAQGLHVDC...ASKLQGKASSNHIMMGGNVTQYI 251 ... GDDGEVLWGRYGHGNVCEVTAQGLHVDCASKLQGKASSNHIMMGGNVTQYI Sbjct: 121 GDDGEVLWGRYGHGNVCEVTAQGLHVDCASKLQGKASSNHIMMGGNVTQYI 171
Aflatoxin B1 Degradation by a Pseudomonas Strain
Directory of Open Access Journals (Sweden)
Lancine Sangare
2014-10-01
Full Text Available Aflatoxin B1 (AFB1, one of the most potent naturally occurring mutagens and carcinogens, causes significant threats to the food industry and animal production. In this study, 25 bacteria isolates were collected from grain kernels and soils displaying AFB1 reduction activity. Based on its degradation effectiveness, isolate N17-1 was selected for further characterization and identified as Pseudomonas aeruginosa. P. aeruginosa N17-1 could degrade AFB1, AFB2 and AFM1 by 82.8%, 46.8% and 31.9% after incubation in Nutrient Broth (NB medium at 37 °C for 72 h, respectively. The culture supernatant of isolate N17-1 degraded AFB1 effectively, whereas the viable cells and intra cell extracts were far less effective. Factors influencing AFB1 degradation by the culture supernatant were investigated. Maximum degradation was observed at 55 °C. Ions Mn2+ and Cu2+ were activators for AFB1 degradation, however, ions Mg2+, Li+, Zn2+, Se2+, Fe3+ were strong inhibitors. Treatments with proteinase K and proteinase K plus SDS significantly reduced the degradation activity of the culture supernatant. No degradation products were observed based on preliminary LC-QTOF/MS analysis, indicating AFB1 was metabolized to degradation products with chemical properties different from that of AFB1. The results indicated that the degradation of AFB1 by P. aeruginosa N17-1 was enzymatic and could have a great potential in industrial applications. This is the first report indicating that the isolate of P. aeruginosa possesses the ability to degrade aflatoxin.
Impact of food grade and nano-TiO2 particles on a human intestinal community.
Dudefoi, William; Moniz, Kristy; Allen-Vercoe, Emma; Ropers, Marie-Hélène; Walker, Virginia K
2017-08-01
Titanium dioxide (TiO 2 ) nanoparticles (NPs) are used as an additive (E171 or INS171) in foods such as gum, candy and puddings. To address concerns about the potential hazardous effects of ingested NPs, the toxicity of these food-grade NPs was investigated with a defined model intestinal bacterial community. Each titania preparation (food-grade TiO 2 formulations, E171-1 and E171-6a) was tested at concentrations equivalent to those found in the human intestine after sampling 1-2 pieces of gum or candy (100-250 ppm). At the low concentrations used, neither the TiO 2 food additives nor control TiO 2 NPs had an impact on gas production and only a minor effect on fatty acids profiles (C16:00, C18:00, 15:1 w5c, 18:1 w9c and 18:1 w9c, p < 0.05). DNA profiles and phylogenetic distributions confirmed limited effects on the bacterial community, with a modest decrease in the relative abundance of the dominant Bacteroides ovatus in favor of Clostridium cocleatum (-13% and +14% respectively, p < 0.05). Such minor shifts in the treated consortia suggest that food grade and nano-TiO 2 particles do not have a major effect on human gut microbiota when tested in vitro at relevant low concentrations. However, the cumulative effects of chronic TiO 2 NP ingestion remain to be tested. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.
2014-01-01
Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014
ORF Alignment: NC_003076 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available abidopsis thaliana] ... Length = 101 ... Query: 112 EKSIVVYFTSLRVVRPTFEACKSVT...SILHSFPVRIDERDLSMDASFSTELQRIFGKDQNQ 171 ... EKSIVVYFTSLRVVRPTFEACKSVTSILHSFPVRIDERDLSMDASFSTELQRIFGKD...QNQ Sbjct: 1 ... EKSIVVYFTSLRVVRPTFEACKSVTSILHSFPVRIDERDLSMDASFSTELQRIFGKDQNQ 60 ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available FATMYAAHGVGLAANQVGEAVRVFVYD Sbjct: 1 ... VRPLGLLGDPVLHARCAEVTDFGPELAALVEDLFATMYAAHGVGLAANQVGEAVRVFVYD 60 ... Query: 171 TVRGTGFFARC...LQHECDHLEGRVYADRLTGRRHRKLMRQVAR 212 ... TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR Sbjct: 121 TVRGTGFFARCLQHECDHLEGRVYADRLTGRRHRKLMRQVAR 162
African Journals Online (AJOL)
DR. AMIN
45.3. 2.31 (dd, J = 7.5, 12.8). CH2. 9. 70.7. 5.62 m. CH. 10. 122.9. 5.09 m. CH. 11. 131.2. -. C. 12. 25.5. 1.71 s. CH3. 13. 27.8. 1.30 s. CH3. 14. 16.8. 1.59 s. CH3. 15. 18.2. 1.70 s. CH3. CH3CO. 171.4. -. CH3. CH3CO. 20.2. 1.89 s. CH3. Organisms. Concentrations of seed extracts (mg/ml). 2.5. 5. 10. 20. 25. 50. 100. 200. E.coli.
International Nuclear Information System (INIS)
Chalfant, G.G.
1984-12-01
The PuO 2 cask or 5320-3 cask is designed for shipment of americium or plutonium by surface transportation modes. The cask design was physically tested to demonstrate that it met the criteria specified in US ERDA Manual Chapter 0529, dated 12/21/76, which invokes Title 10 Code of Federal Regulations, Part 71 (10 CFR 71) ''Packaging of Radioactive Materials for Transport,'' and Title 49 CFR Parts 171.179 ''Hazardous Materials Regulations.'' (US DOE Order 4580.1A, Chapter III, superseded manual chapter 0529 effective May 1981, but it retained the same 10 CFR 71 and 49 CFR 171-179 references
A cladding-pumped, tunable holmium doped fiber laser.
Simakov, Nikita; Hemming, Alexander; Clarkson, W Andrew; Haub, John; Carter, Adrian
2013-11-18
We present a tunable, high power cladding-pumped holmium doped fiber laser. The laser generated >15 W CW average power across a wavelength range of 2.043 - 2.171 μm, with a maximum output power of 29.7 W at 2.120 μm. The laser also produced 18.2 W when operating at 2.171 µm. To the best of our knowledge this is the highest power operation of a holmium doped laser at a wavelength >2.15 µm. We discuss the significance of background losses and fiber design for achieving efficient operation in holmium doped fibers.
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DMSLNFSAFSDVLSP Sbjct: 1 ... PFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMSLNFSAFSDVLSP 60 ... Query: 145 WAGQCKPPPASEAN...LPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP 195 ... WAGQCKPPPASEANLPRLV...LAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP Sbjct: 121 WAGQCKPPPASEANLPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP 171
ORF Alignment: NC_002663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IAQKVGEEGVETALAATVKDKAETICEAA 171 ... LSKLERLIASRKGADPESSYTAQLYAKGTKRIAQKVGEEGVETALAATVKDKAETICEAA Sbjct: 1 ... LSKLERLIASRKGADPESSYTAQLYAKGTKRIAQKVGEEGVETALAATVKDKAETICEAA 60 ... ...sphoribosyl-ATP pyrophosphatase (PRA-PH)] ... Length = 84 ... Query: 112 LSKLERLIASRKGADPESSYTAQLYAKGTKR
40 CFR 171.4 - Standards for certification of commercial applicators.
2010-07-01
... ultimate use of many commodities as food and feed. Practical knowledge is required concerning soil and... shall demonstrate practical knowledge of the principles and practices of pest control and safe use of... apply various formulations of pesticides, solutions, and gases, together with a knowledge of which...
People’s Republic of China Scientific Abstracts, Number 171
1977-07-07
products by using newly-hatched silkworm larvae ( Bombyx mori ) as the test insects. Comparisons have been made with different varieties öf~the...English-language sources are transcribed or reprinted, with the original phrasing and other characteristics retained. Headlines, editorial reports...following the last line of a brief, indicate how the original information was processed. Where no processing indicator is given, the infor- mation was
49 CFR 171.14 - Transitional provisions for implementing certain requirements.
2010-10-01
... hazardous material prior to October 1, 1991; (iii) Is marked “Inhalation Hazard” if appropriate, in... poisonous by inhalation for which the packaging was authorized under the requirements of part 172 or part.... (h) The proper shipping name “Gasohol gasoline mixed with ethyl alcohol, with not more than 20...
171_Abdussalam et al.,_PATTERN OF UTILISATION OF OGTT THE ...
African Journals Online (AJOL)
user pc
2017-12-02
Dec 2, 2017 ... estimated to be about 4.7% and is projected increase to about 5.5% by the year 2030 (Sha. 2010). According to the Global Burden of Dise. Study, there was ... burden of t important non communicable disease may proba ... 2.2 million deaths by predisposing individuals to ot .... with DM (Barr, 2002). HbA1c is ...
26 CFR 1.171-3 - Special rules for certain bonds.
2010-04-01
... disbursements method of accounting, and E decides to use annual accrual periods ending on March 1 of each year... any bond premium among the accrual periods by reference to the equivalent fixed rate debt instrument... remaining term of the instrument. The holder also allocates any bond premium among the accrual periods by...
171 Adoption of Enriched Local Complementary Food in Osun State ...
African Journals Online (AJOL)
User
2012-01-24
Jan 24, 2012 ... blended with legumes to give the protein portion of the diet (Lartey et al. 1999). Often such foods are introduced to mothers, made available and methods of preparation are taught in either hospital during antenatal care or in the communities. Adoption of innovation is defined as a point of decision to make ...
30 CFR 206.171 - What definitions apply to this subpart?
2010-07-01
... United States or who holds title subject to Federal restriction against alienation. Indian tribe means... restriction against alienation. Lease means any contract, profit-share arrangement, joint venture, or other...
ORF Alignment: NC_006351 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Burkholderia pseudomallei K96243] ... Length = 171 ... Query: 20 ... KSVLRSAHTSTGRAESTAEHSWRLCLMA...ITLADELPGLDMLKVLKMCVIHDLGEALRGDV 79 ... KSVLRSAHTSTGRAESTAEHSWRLCLMAITLADE...LPGLDMLKVLKMCVIHDLGEALRGDV Sbjct: 15 ... KSVLRSAHTSTGRAESTAEHSWRLCLMAITLADELPGLDMLKVLKMCVIHDLGEALRGDV 74 ... Query
ORF Alignment: NC_006349 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Burkholderia pseudomallei K96243] ... Length = 171 ... Query: 58 ... KSVLRSAHTSTGRAESTAEHSWRLCLMA...ITLADELPGLDMLKVLKMCVIHDLGEALRGDV 117 ... KSVLRSAHTSTGRAESTAEHSWRLCLMAITLAD...ELPGLDMLKVLKMCVIHDLGEALRGDV Sbjct: 15 ... KSVLRSAHTSTGRAESTAEHSWRLCLMAITLADELPGLDMLKVLKMCVIHDLGEALRGDV 74 ... Quer
Gain-of-function KCNJ6 Mutation in a Severe Hyperkinetic Movement Disorder Phenotype.
Horvath, Gabriella A; Zhao, Yulin; Tarailo-Graovac, Maja; Boelman, Cyrus; Gill, Harinder; Shyr, Casper; Lee, James; Blydt-Hansen, Ingrid; Drögemöller, Britt I; Moreland, Jacqueline; Ross, Colin J; Wasserman, Wyeth W; Masotti, Andrea; Slesinger, Paul A; van Karnebeek, Clara D M
2018-05-29
Here, we describe a fourth case of a human with a de novo KCNJ6 (GIRK2) mutation, who presented with clinical findings of severe hyperkinetic movement disorder and developmental delay, similar to the Keppen-Lubinsky syndrome but without lipodystrophy. Whole-exome sequencing of the patient's DNA revealed a heterozygous de novo variant in the KCNJ6 (c.512T>G, p.Leu171Arg). We conducted in vitro functional studies to determine if this Leu-to-Arg mutation alters the function of GIRK2 channels. Heterologous expression of the mutant GIRK2 channel alone produced an aberrant basal inward current that lacked G protein activation, lost K + selectivity and gained Ca 2+ permeability. Notably, the inward current was inhibited by the Na + channel blocker QX-314, similar to the previously reported weaver mutation in murine GIRK2. Expression of a tandem dimer containing GIRK1 and GIRK2(p.Leu171Arg) did not lead to any currents, suggesting heterotetramers are not functional. In neurons expressing p.Leu171Arg GIRK2 channels, these changes in channel properties would be expected to generate a sustained depolarization, instead of the normal G protein-gated inhibitory response, which could be mitigated by expression of other GIRK subunits. The identification of the p.Leu171Arg GIRK2 mutation potentially expands the Keppen-Lubinsky syndrome phenotype to include severe dystonia and ballismus. Our study suggests screening for dominant KCNJ6 mutations in the evaluation of patients with severe movement disorders, which could provide evidence to support a causal role of KCNJ6 in neurological channelopathies. Copyright © 2018. Published by Elsevier Ltd.
Chuang, Wang; Geng-sheng, Jiao; Lei, Peng; Bao-lin, Zhu; Ke-zhi, Li; Jun-long, Wang
2018-06-01
The surface of nano-silicon dioxide (nano-SiO2) particles was modified by small molecular coupling agent KH-560 and macromolecular coupling agent SEA-171, respectively, to change the surface activity and structure. The modified nano-SiO2 was then used for reinforcing cyanate ester resin (CE). Influences of the content of nano-SiO2 and the interfacial structure over the thermal and frictional properties of nano-SiO2/CE composites were investigated. The mechanism of the surface modification of silicon dioxide by KH-560 and SEA-171 was discussed. The experimental results show that the addition of coupling agents increased the interfacial bonding between nano-SiO2 particles and the CE resin so that the heat resistance and friction properties of the composites were improved. After surface treatment of nano-SiO2 by SEA-171, the thermal decomposition temperature of the 3.0 wt% nano-SiO2/CE composites increased nearly by 75 °C and the frictional coefficient was reduced by 25% compared with that of the pure CE, and the wear resistance increased by 77%.
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available cans SC5314] ... Length = 315 ... Query: 51 ... LSALCKTPPSIVRTRNGRDYRRGNFLGEGGFARCFQMKDASGQIYAAKTVAKASIKNEK...T 110 ... LSALCKTPPSIVRTRNGRDYRRGNFLGEGGFARCFQMKDASGQIYAAKTVAKASIKNEKT Sbj...ct: 9 ... LSALCKTPPSIVRTRNGRDYRRGNFLGEGGFARCFQMKDASGQIYAAKTVAKASIKNEKT 68 ... Query: 171 FFMVQIVGAIKYLHSRRVIHRDLK
Development of a High Precision Axial 3-D PET for Brain Imaging
Bolle, E; Casella, C; Chesi, E; Clinthorne, N; Cochran, E; De Leo, R; Dissertori, G; Djambazov, L; Honscheid, K; Huh, S; Johnson, I; Joram, C; Kagan, H; Lacasta, C; Lustermann, W; Meddi, F; Nappi, E; Nessi-Tedaldi, F; Oliver, J F; Pauss, F; Rafecas, M; Renker, D; Rudge, A; Schinzel, D; Schneider, T; Séguinot, J; Smith, S; Solevi, P; Stapnes, S; Vilardi, I; Weilhammer, P
2009-01-01
We describe a PET device based on a novel method to extract the coordinates of the interaction point of the 511 keV γ rays from 100 mm long and thin LYSO (Lutetium Yttrium OxyorthoSilicate) scintillator bars, positioned axially in the tomograph. The coordinate along the hit crystal is measured by using a hodoscope of Wave Length Shifting (WLS) plastic strips mounted perpendicularly to each plane of scintillators. As photodetectors, new Geiger mode Avalanche PhotoDetectors (G-APDs) with integrated electronics are being used to detect both the hit crystal in a block (x and y coordinates) and the interaction point in the crystal (z coordinate) through the light escaping from the crystal and transmitted to the WLS strips. In this way, the γ interaction point can be determined with a spatial resolution of few cubic millimeters down to a minimum deposited energy of about 50 keV, resulting in a volumetric precision very close to the limits imposed by the physics of the positron annihilation. The method allows to i...
de Jesus Morales Ramírez, Angel; Hernández, Margarita García; Murillo, Antonieta García; de Jesús Carrillo Romo, Felipe; Palmerin, Joel Moreno; Velazquez, Dulce Yolotzin Medina; Jota, María Luz Carrera
2013-01-01
Lu2O3:Eu3+ transparent, high density, and optical quality thin films were prepared using the sol-gel dip-coating technique, starting with lutetium and europium nitrates as precursors and followed by hydrolysis in an ethanol-ethylene glycol solution. Acetic acid and acetylacetonate were incorporated in order to adjust pH and as a sol stabilizer. In order to increment the thickness of the films and orient the structure, F127 Pluronic acid was incorporated during the sol formation. Structural, morphological, and optical properties of the films were investigated for different F127/Lu molar ratios (0–5) in order to obtain high optical quality films with enhanced thickness compared with the traditional method. X-ray diffraction (XRD) shows that the films present a highly oriented cubic structure beyond 1073 K for a 3-layer film, on silica glass substrates. The thickness, density, porosity, and refractive index evolution of the films were investigated by means of m-lines microscopy along with the morphology by scanning electron microscope (SEM) and luminescent properties. PMID:28809336
Coffey, David; Diez-Ferrer, José Luis; Serrate, David; Ciria, Miguel; de la Fuente, César; Arnaudas, José Ignacio
2015-09-03
High-density magnetic storage or quantum computing could be achieved using small magnets with large magnetic anisotropy, a requirement that rare-earth iron alloys fulfill in bulk. This compelling property demands a thorough investigation of the magnetism in low dimensional rare-earth iron structures. Here, we report on the magnetic coupling between 4f single atoms and a 3d magnetic nanoisland. Thulium and lutetium adatoms deposited on iron monolayer islands pseudomorphically grown on W(110) have been investigated at low temperature with scanning tunneling microscopy and spectroscopy. The spin-polarized current indicates that both kind of adatoms have in-plane magnetic moments, which couple antiferromagnetically with their underlying iron islands. Our first-principles calculations explain the observed behavior, predicting an antiparallel coupling of the induced 5d electrons magnetic moment of the lanthanides with the 3d magnetic moment of iron, as well as their in-plane orientation, and pointing to a non-contribution of 4f electrons to the spin-polarized tunneling processes in rare earths.
Energy Technology Data Exchange (ETDEWEB)
Alva S, H.; Murrieta, T.; Ruiz T, C.; Brandan, M. E.; Martinez D, A.; Rodriguez V, M., E-mail: halva@fisica.unam.m [UNAM, Instituto de Fisica, Circuito de la Investigacion Cientifica s/n, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)
2010-07-01
During the past 4 years, the Medical Physics and Dosimetry Group at the Physics Institute, UNAM, has developed a positron emission tomography prototype for small-animal imaging (micro PET). The system is composed of pix elated, cerium-doped lutetium yttrium oxy orthosilicate scintillation crystal arrays coupled to position-sensitive photomultiplier tubes. Detector electronic signals are processed by nuclear instrumentation modules and are digitized by a multichannel data acquisition board. The tomographic reconstruction is performed by filtered backprojection from a set of distortion- and nonuniformity- corrected projections taken at different angles. In this work, the reconstructed spatial resolution was evaluated from the line spread function with a mean value of 2.36 +- 0.44 mm. In addition, the first metabolic studies of 30 g, healthy mice, injected with {sup 1}8{sup F} labeled fluorodeoxyglucose and sodium fluoride are reported. They display normal glucose uptake and skeletal structure, respectively. The micro PET can be a useful tool for radiation detector physics research and its applications in nuclear medicine. (Author)
Spectroscopy and laser test emission in Tm3+ : BaYLuF8 single crystal
Parisi, D.; Veronesi, S.; Volpi, A.; Gemmi, M.; Tonelli, M.; Cassanho, A.; Jenssen, H. P.
2014-01-01
A novel laser material BaYLuF8 (BYLF), doped with 12 at% of Tm3+, has been grown and optically investigated, in order to evaluate its potential performances as a 2 µm laser. The BYLF crystal is interesting mainly because indications are that the mixed crystal would be sturdier than BaY2F8 (BYF). The addition of lutetium would improve the thermo-mechanical properties of the host. Absorption, fluorescence and lifetime measurements have been performed in the temperature range 10-300 K focusing on the 3H4 and 3F4 manifolds, those involved in the laser scheme at 2 µm. The Stark sublevels structure of Tm3+ up to the 1D2 manifold has been figured out. Diode-pumped CW laser emission at 2 µm has been achieved obtaining a slope efficiency of about 28% with respect to the absorbed power, by pumping along the Z-axis. A maximum output power of 240 mW was achieved by pumping along the favourable Y-axis, with an incident power of about 800 mW.
Directory of Open Access Journals (Sweden)
Mondal Nagendra
2009-01-01
Full Text Available This study presents Monte Carlo Simulation (MCS results of detection efficiencies, spatial resolutions and resolving powers of a time-of-flight (TOF PET detector systems. Cerium activated Lutetium Oxyorthosilicate (Lu 2 SiO 5 : Ce in short LSO, Barium Fluoride (BaF 2 and BriLanCe 380 (Cerium doped Lanthanum tri-Bromide, in short LaBr 3 scintillation crystals are studied in view of their good time and energy resolutions and shorter decay times. The results of MCS based on GEANT show that spatial resolution, detection efficiency and resolving power of LSO are better than those of BaF 2 and LaBr 3 , although it possesses inferior time and energy resolutions. Instead of the conventional position reconstruction method, newly established image reconstruction (talked about in the previous work method is applied to produce high-tech images. Validation is a momentous step to ensure that this imaging method fulfills all purposes of motivation discussed by reconstructing images of two tumors in a brain phantom.
Transparent Lu 2 O 3 :Eu ceramics by sinter and HIP optimization
Seeley, Z. M.; Kuntz, J. D.; Cherepy, N. J.; Payne, S. A.
2011-09-01
Evolution of porosity and microstructure was observed during densification of lutetium oxide ceramics doped with europium (Lu 2O 3:Eu) fabricated via vacuum sintering and hot isostatic pressing (HIP'ing). Nano-scale starting powder was uniaxially pressed and sintered under high vacuum at temperatures between 1575 and 1850 °C to obtain densities ranging between 94% and 99%, respectively. Sintered compacts were then subjected to 200 MPa argon gas at 1850 °C to reach full density. Vacuum sintering above 1650 °C led to rapid grain growth prior to densification, rendering the pores immobile. Sintering between 1600 and 1650 °C resulted in closed porosity yet a fine grain size to allow the pores to remain mobile during the subsequent HIP'ing step, resulting in a fully-dense highly transparent ceramic without the need for subsequent air anneal. Light yield performance was measured and Lu 2O 3:Eu showed ˜4 times higher light yield than commercially used scintillating glass indicating that this material has the potential to improve the performance of high energy radiography devices.
AX-PET A novel PET detector concept with full 3D reconstruction
Braem, A; Séguinot, J; Dissertori, G; Djambazov, L; Lustermann, W; Nessi-Tedaldi, F; Pauss, F; Schinzel, D; Solevi, P; Lacasta, C; Oliver, J F; Rafecas, M; De Leo, R; Nappi, E; Vilardi, I; Chesi, E; Cochran, E; Honscheid, K; Kagan, H; Rudge, A; Smith, S; Weilhammer, P; Johnson, I; Renker, D; Clinthorne, N; Huh, S; Bolle, E; Stapnes, S; Meddi, F
2009-01-01
We describe the concept and first experimental tests of a novel 3D axial Positron Emission Tomography (PET) geometry. It allows for a new way of measuring the interaction point in the detector with very high precision. It is based on a matrix of long Lutetium-Yttrium OxyorthoSilicate (LYSO) crystals oriented in the axial direction, each coupled to one Geiger Mode Avalanche Photodiode (G-APD) array. To derive the axial coordinate, Wave Length Shifter (WLS) strips are mounted orthogonally and interleaved between the crystals. The light from the WLS strips is read by custom-made G-APDs. The weighted mean of the signals in the WLS strips has proven to give very precise axial resolution. The achievable resolution along the three axes is mainly driven by the dimensions of the LYSO crystals and WLS strips. This concept is inherently free of parallax errors. Furthermore, it will allow identification of Compton interactions in the detector and for reconstruction of a fraction of them, which is expected to enhance imag...
First-principles study of rare-earth (RE) cobaltites (RE=Nd,Sm,Gd,Dy,Er,Lu)
Topsakal, M.; Wentzcovitch, R. M.
2014-12-01
The lanthanide series of the periodic table comprises 15 members ranging from Lanthanum (La) to Lutetium (Lu). Although they are more abundant than silver, and some of them are more abundant than lead, they are known as rare-earth (RE) elements. The "rare" in their name refers to the difficulty of obtaining the pure elements, not to their abundances in nature. They are never found as free metals in the Earth's crust and do not exist as pure minerals. Using first-principles plane-wave calculations, we investigate the structural and electronic properties of rare-earth cobaltites (RECoO3). Structurally consistent Hubbard U treatment was shown to essential for proper description of strongly correlated cobalt-d electrons. We successfully capture the experimentally observed structural trends and give first-principles insights on interesting phenomena related with the cobalt spin state change. It was demonstrated that increase of crystal-field splitting energy between eg-t2g orbitals and shrinking of unoccupied σ*-bonding eg bands are responsible for the increase of onset spin-state transition temperature along the series.
Use of tetracycline as complexing agent in radiochemical separations
International Nuclear Information System (INIS)
Saiki, M.; Nastasi, M.J.C.; Lima, F.W.
1981-01-01
The use of the antibiotic agent tetracycline (TC) for analytical purposes in solvent extraction procedures is presented. Individual extraction curves for the lanthanides, zinc, scandium, uranium, thorium, neptunium and protactinium were obtained. Separation of those elements from one another, and of uranium from selenium, bromine, antimony, barium, tantalum and tungsten was carried out. In all cases benzyl alcohol was the diluent used to dissolve tetracycline hydrochloride. Sodium chloride was used as supporting electrolyte for the lanthanide separations and sodium perchlorate for the other elements mentioned. Stability or formation constants for the lanthanide complexes as well as for thorium complex with tetracycline were determined by using the methods of average number of ligands, the limiting value (for thorium), the two parameters and the weighted least squares. For the lanthanides, the stability constants of the complexes Ln(TC) 3 go from 9.35+-0.22 for lanthanum up to 10.84+-0.11 for lutetium. For the Th(TC) 4 complex the formation constant is equal to 24.6+-0.3. Radioisotopes of the respective elements were used as tracers for the determinations. (author)
International Nuclear Information System (INIS)
Lelental, M.; Romanofsky, H.J.
1992-01-01
This patent describes a process which comprises forming a mixed rare earth alkaline earth copper oxide layer on a substrate and converting the mixed rare earth alkaline earth copper oxide layer to an electrically conductive layer. It comprises crystalline R 1 A 2 C 3 oxide phase by heating in the presence of oxygen, wherein rare earth and R is in each instance chosen from among yttrium, lanthanum, samarium, europium, gadolinium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium and alkaline earth and A is in each instance chosen from among calcium, strontium and barium, characterized in that a crystalline R 2 A 1 C 1 oxide phase is first formed as a layer on the substrate and the crystalline R 1 A 2 C 3 oxide phase is formed over the crystalline R 2 A 1 C 1 oxide phase by coating a mixed rare earth alkaline earth copper oxide on the crystalline R 2 A 1 C 1 oxide phase and heating the mixed rare earth alkaline earth copper oxide to a temperature of at least 1000 degrees C
Effects of Photonic Crystals on the Light Output of Heavy Inorganic Scintillators
Knapitsch, Arno; Fabjan, Christian W; Leclercq, Jean-Louis; Letartre, Xavier; Mazurczyk, Radoslaw; Lecoq, Paul
2013-01-01
Photonic crystals (PhCs) are optical materials which can affect the propagation of light in multiple ways. In recent years PhCs contributed to major technological developments in the field of semiconductor lasers, light emitting diodes and photovoltaic applications. In our case we are investigating the capabilities of photonic crystal slabs with the aim to improve the performance of heavy inorganic scintillators. To study the combination of scintillators and PhCs we use a Monte-Carlo program to simulate the light propagation inside a scintillator and a rigorous coupled wave analysis (RCWA) framework to analyse the optical PhC properties. The simulations show light output improvements of a wide range of scintillating materials due to light scattering effects of the PhC slabs. First samples have been produced on top of 1.2 × 2.6 × 5 mm LSO (cerium-doped Lutetium Oxyorthosilicate, Lu_2SiO_5:Ce^3+) scintillators using electron beam lithography and reactive ion etching (RIE). Our samples show a 30-60% light outp...
Energy Technology Data Exchange (ETDEWEB)
Brown, David C., E-mail: DBrown@snakecreeklasers.com [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States); McMillen, Colin D.; Moore, Cheryl; Kolis, Joseph W. [Department of Chemistry and Center for Optical Materials Science and Engineering Technologies, Clemson University, Clemson, SC 29634-0973 (United States); Envid, Victoria [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States)
2014-04-15
We have investigated the hydrothermal growth of, and spectrally characterized, the lutetium based laser materials Nd:LuAG, Yb:LuAG, and Yb:Lu{sub 2}O{sub 3}. Absorption cross-section data are presented for Nd:LuAG at 83, 175, and 295 K. Absorption cross-section data was also obtained for Yb:LuAG at 83, 175, and 295 K; the 295 K data was used to generate emission cross-sections using the method of reciprocity. For Yb:Lu{sub 2}O{sub 3}, we present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity. -- Highlights: • We present spectral properties for hydrothermally-grown laser crystals. • Absorption cross-section data are presented for Nd:LuAG and Yb:LuAG at 83, 175, and 295 K. • Emission cross-sections are presented for Yb:LuAG at 295 K derived by reciprocity. • We present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity for the laser material Yb:Lu{sub 2}O{sub 3}.
International Nuclear Information System (INIS)
Richard, B.
2012-01-01
The good knowledge of nuclear data, input parameters for the neutron transport calculation codes, is necessary to support the advances of the nuclear industry. The purpose of this work is to bring pertinent information regarding the nuclear data integral validation process. Reactivity worth measurements have been performed on the Caliban reactor, they concern four materials of interest for the nuclear industry: gold, lutetium, plutonium and uranium 238. Experiments which have been conducted in order to improve the characterization of the core are also described and discussed, the latter are necessary to the good interpretation of reactivity worth measurements. The experimental procedures are described with their associated uncertainties, measurements are then compared to numerical results. The methods used in numerical calculations are reported, especially the multigroup cross sections generation for deterministic codes. The modeling of the experiments is presented along with the associated uncertainties. This comparison led to an interpretation concerning the qualification of nuclear data libraries. Discrepancies are reported, discussed and justify the need of such experiments. (author) [fr
Progress in the development of LuAlO$_{3}$ based scintillators
Belsky, A; Lecoq, P; Dujardin, C; Garnier, N; Canibano, H; Pédrini, C; Petrosian, A
2000-01-01
LuAlO/sub 3/:Ce/sup 3+/ (LuAP) and Lu/sub x/Y/sub 1/-xAlO/sub 3/:Ce /sup 3+/ (LuYAP) crystals are used as scintillation materials for positron emission tomography. The actual study of these scintillators develops in three directions: (i) growth of large size LuAP crystals with stable properties, (ii) the relationship between the composition of LuYAP crystals and scintillation properties, and (iii) scintillation mechanisms in lutetium compounds. After improving of growth conditions a large size samples (length >40 mm) have been prepared. Crystals show a good correlation between growth parameters, light yield and transmission spectra. We studied a series of samples with calibrated size (2*2*10 mm3) and compare the light yield with standard BGO and LSO samples. Mixed crystals with composition of 0.6
Progress in the development of LuAlO3 based scintillators
Belsky, A; Lecoq, P; Dujardin, C; Garnier, N; Canibano, H; Pédrini, C; Petrosian, A
2000-01-01
LuAlO3:Ce3+ (LuAP) and LuxY1-xAlO3:Ce3+ (LuYAP) crystals are the promote scintillation materials for Positron Emission Tomography. Actual study of these scintillators develops in the tree directions: (i) growth of large size LuAP crystals with stable properties, (ii) relationship between composition of LuYAP crystals and scintillation properties, and (iii) scintillation mechanisms in lutetium compounds. After improving of growth conditions a large size samples (length greater than 40 mm) have been prepared. Crystals show a good correlation between growth parameters, light yield and transmission spectra. We performed a series of samples with calibrated size (2x2x10 mm3) and compare the light yield with a standard BGO and LSO samples. Mixed crystals with composition of 0.6 less than x less than 0.8 show a significant increase of light yield. We suggest that the short order clusterisation in mixed crystals may by playing an important role in governing the scintillation efficiency. In order to clarify the scintil...
Czech Academy of Sciences Publication Activity Database
Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin
2016-01-01
Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016
Denoyer, Aurelie
La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.
Pourmirza, Ali Asghr; Nasab, Fershteh Sadeghi; Zadeh, Abas Hossein
2007-08-01
The efficacy of acetone vapors against carefully aged eggs of Plodia interpunctella (Hubner) at 17+/-1 and 27+/-1 degrees C at different dosage levels of acetone over various exposure times was determined. Acetone was found to be toxic to Indian meal moth eggs. Considerable variation in the susceptibility of different age groups of eggs was apparent in the fiducial limits of the LD50 values. An inverse relationship between LD50 values and exposure times was observed in age groups of tested eggs. At 27+/-1 degrees C and 24 h exposure period, eggs aged 1-2 day-old were more tolerant to acetone than other age groups, followed by 0-1 day-old, 2-3 day-old and 3-4 day-old eggs. A similar pattern of susceptibility of eggs was observed at 72 h exposure. In all bioassays, eggs exposed to higher dosages of acetone developed at smaller rate. This was significant for the eggs, which were exposed to the highest dosage for 24 h. Increasing the temperature from 17+/-1 to 27+/-1 degrees C greatly increased the efficacy of acetone. At 27+/-1 degrees C eggs of P. interpunctella were killed by less than one-third of the dosage required for control at 17+/-1 degrees C. Acetone achieved 50% mortality with a dosage of 82.76 mg L(-1) in 1-2 day-old eggs at 27+/-1 degrees C. At this temperature hatching was retarded and greatly diminished when eggs aged 1-2 day-old were exposed to 80 mg L(-1) of acetone for the 24 h exposure period. There was no evidence of a hatch delay longer than the time spent under vapors for eggs exposed at 17+/-1 or 27+/-1 degrees C, indicating that some development must have occurred under fumigation.
Landry, Marie L; Ferguson, David; Topal, Jeffrey
2014-01-01
Simplexa Clostridium difficile universal direct PCR, a real-time PCR assay for the detection of the C. difficile toxin B (tcdB) gene using the 3M integrated cycler, was compared with a two-step algorithm which includes the C. Diff Chek-60 glutamate dehydrogenase (GDH) antigen assay followed by cytotoxin neutralization. Three hundred forty-two liquid or semisolid stools submitted for diagnostic C. difficile testing, 171 GDH antigen positive and 171 GDH antigen negative, were selected for the study. All samples were tested by the C. Diff Chek-60 GDH antigen assay, cytotoxin neutralization, and Simplexa direct PCR. Of 171 GDH-positive samples, 4 were excluded (from patients on therapy or from whom duplicate samples were obtained) and 88 were determined to be true positives for toxigenic C. difficile. Of the 88, 67 (76.1%) were positive by the two-step method and 86 (97.7%) were positive by PCR. Seventy-nine were positive by the GDH antigen assay only. Of 171 GDH antigen-negative samples, none were positive by PCR. One antigen-negative sample positive by the cytotoxin assay only was deemed a false positive based on chart review. Simplexa C. difficile universal direct PCR was significantly more sensitive for detecting toxigenic C. difficile bacteria than cytotoxin neutralization (P = 0.0002). However, most PCR-positive/cytotoxin-negative patients did not have clear C. difficile disease. The estimated cost avoidance provided by a more rapid molecular diagnosis was outweighed by the cost of isolating and treating PCR-positive/cytotoxin-negative patients. The costs, clinical consequences, and impact on nosocomial transmission of treating and/or isolating patients positive for toxigenic C. difficile by PCR but negative for in vivo toxin production merit further study.
Optimization of Parameters for Semiempirical Methods 2. Applications
1989-01-01
173.0 184.6 11.6 15.5 3.4 i CsH, 2-Ethylisopropyl (+) 156.0 171.9 15.9 25.6 10.5 i C5111 Neopentyl (+) 188.0 171.8 -16.2 -6.4 -21.5 t CH, 2...Dimethyl peroxide -30.1 -34.1 -4.0 1.8 3.1 f C2H 60 2 Ethylene glycol ..................... -93.9 -95.2 -1.3 -12.2 -13.6 f C30 2 Carbon suboxide...fluoridate -215.1 -222.9 -7.8 53.8 78.4 g C&H14PO2F Neopentyl methylphosphono- fluoridate .......................... -224.2 -226.6 -2.4 70.4 87.8 g POF2 POF
Synchrotron far-infrared spectroscopy of the two lowest fundamental modes of 1,1-difluoroethane
Wong, Andy; Thompson, Christopher D.; Appadoo, Dominique R. T.; Plathe, Ruth; Roy, Pascale; Manceron, Laurent; Barros, Joanna; McNaughton, Don
2013-08-01
The far-infrared (FIR) spectrum (50-600 cm-1) of 1,1-difluoroethane was recorded using the high-resolution infrared AILES beamline at the Soleil synchrotron. A ro-vibrational assignment was performed on the lowest wavenumber, low intensity 181 0 and 171 0 modes, yielding band centres of 224.241903 (10) cm-1 and 384.252538 (13) cm-1, respectively. A total of 965 and 2031 FIR transitions were assigned to the 181 0 and 171 0 fundamentals, respectively. Previously measured pure rotational transitions from the upper states were included into the respective fits to yield improved rotational and centrifugal distortion constants. The 182 1 hot band was observed within the fundamental band, with 369 FIR transitions assigned and co-fitted with the fundamental to give a band centre of 431.956502 (39) cm-1 for ν 18 = 2. The 182 0 overtone was observed with 586 transitions assigned and fitted to give a band centre of 431.952763 (23) cm-1 for ν 18 = 2. The difference in energy is attributed to a torsional splitting of 0.003740 (45) cm-1 in the ν 18 = 2 state. Two hot bands originating from the ν 18 = 1 and ν 17 = 1 states were observed within the 171 0 fundamental.
Pyrolysis kinetics and thermal behavior of waste sawdust biomass using thermogravimetric analysis.
Mishra, Ranjeet Kumar; Mohanty, Kaustubha
2018-03-01
The present study reports pyrolysis behavior of three waste biomass using thermogravimetric analysis to determine kinetic parameters at five different heating rates. Physiochemical characterization confirmed that these biomass have the potential for fuel and energy production. Pyrolysis experiments were carried out at five different heating rates (5-25 °C min -1 ). Five model-free methods such as Kissinger-Akahira-Sunose (KAS), Ozawa-Flynn-Wall (OFW), Friedman, Coats-Redfern, and distributed activation energy (DAEM) were used to calculate the kinetic parameters. The activation energy was found to be 171.66 kJ mol -1 , 148.44 kJ mol -1 , and 171.24 kJ mol -1 from KAS model; 179.29 kJ mol -1 , 156.58 kJ mol -1 , and 179.47 kJ mol -1 from OFW model; 168.58 kJ mol -1 , 181.53 kJ mol -1 , and 184.61 kJ mol -1 from Friedman model; and 206.62 kJ mol -1 , 171.63 kJ mol -1 , and 160.45 kJ mol -1 from DAEM model for PW, SW, AN biomass respectively. The calculated kinetic parameters are in good agreement with other reported biomass. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Chatal, J.F.; Douillard, J.Y.; Kremer, M.; Curtet, C.; Le Mevel, B.; Fumoleau, P.; Bourdoiseau, M.
1983-01-01
Two monoclonal antibodies, 17-1A and 19-9, with recognized human gastrointestinal cancers in cell cultures, were labeled with iodine 131 for immunoscintigraphic application. With the intact 131 I-17-1A antibody, 21 out of 35 (60%) primary or secondary colorectal cancer sites were visualized, whereas all 21 nonepitheliomatous colic cancer sites or noncolic cancer sites were negative. With F(ab') 2 fragments of the 19-9 antibody, 18 out of 27 (67%) colorectal cancer sites were positive. With both radioantibodies, the bestly contrasted tumor images were late, 4 to 5 days after injection. A study with paired-label technique, associating a specific iodine-131-labeled antibody with a non-specific iodine-125-labeled immunoglobulin, demonstrated, that tumor uptake was indeed specific for the 17-1A or 19-9 antibody in tumor and normal colon fragments obtained during operations on 4 patients. A preliminary prospective study showed that only immunoscintigraphy was able to confirm and localize a recurrence of rectal cancer in one patient. A larger series will be necessary to validate the clinical benefit of the technique, as compared with the results of other diagnostic techniques, before immunoscintigraphy can be proposed for routine clinical use [fr
Kinematic viscosity of liquid Al-Cu alloys
International Nuclear Information System (INIS)
Konstantinova, N Yu; Popel, P S
2008-01-01
Temperature dependences of kinematic viscosity n of liquid Al 100-x -Cu x alloys (x = 0.0, 10.0, 17.1, 25.0, 32.2, 40.0 and 50.0 at.%) were measured. A technique based on registration of the period and the decrement of damping of rotating oscillations of a cylindrical crucible with a melt was used. Viscosity was calculated in low viscous liquids approximation. Measurements were carried out in vacuum in crucibles of BeO with a temperature step of 30 deg. C and isothermal expositions of 10 to 15 minutes during both heating up to 1100-1250 deg. C and subsequent cooling. We have discovered branching of heating and cooling curves v(T) (hysteresis of viscosity) below temperatures depending on the copper content: 950 deg. C at 10 and 17.1 at.% Cu, 1050 deg. C at 25 and 40 at.% Cu, 850 deg. C at 32.2 at.% Cu. For samples with 10 and 17.1 at.% Cu the cooling curve 'returns' to the heating one near 700 deg. C. An abnormally high spreading of results at repeated decrement measurements was fixed at heating of the alloy containing 50 at.% Cu above 1000 deg. C. During subsequent cooling the effect disappeared. Isotherms of kinematic viscosity have been fitted for several temperatures
Terauchi, Yuki; Kim, Yoon-Kyung; Tanaka, Takumi; Nanatani, Kei; Takahashi, Toru; Abe, Keietsu
2017-07-01
Aspergillus oryzae hydrophobin RolA adheres to the biodegradable polyester polybutylene succinate-co-adipate (PBSA) and promotes PBSA degradation by interacting with A. oryzae polyesterase CutL1 and recruiting it to the PBSA surface. In our previous studies, we found that positively charged amino acid residues (H32, K34) of RolA and negatively charged residues (E31, D142, D171) of CutL1 are important for the cooperative ionic interaction between RolA and CutL1, but some other charged residues in the triple mutant CutL1-E31S/D142S/D171S are also involved. In the present study, on the basis of the 3D-structure of CutL1, we hypothesized that D30 is also involved in the CutL1-RolA interaction. We substituted D30 with serine and performed kinetic analysis of the interaction between wild-type RolA and the single mutant CutL1-D30S or quadruple mutant CutL1-D30S/E31S/D142S/D171S by using quartz crystal microbalance. Our results indicate that D30 is a novel residue involved in the ionic interaction between RolA and CutL1.
Search Results | Page 18 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2015-06-30
Results 171 - 180 of 1368 ... Embedding Open Data Practice: Developing Indicators on the Institutionalization of Open Data Practice in Two African Governments. Published date. June 30, 2015. Papers. LOCAL GOVERNMENT ...
2013-04-12
... requirement concerning attainment and reasonable further progress (as defined in section 171), or any other... violation, primarily because there is no existing air quality violation. EPA, in essence, continues to...
Paleopatologie na kostech medvědů (Ursus deningeri) z jeskyně "Za hájovnou", Javořičský kras.
Czech Academy of Sciences Publication Activity Database
Nývltová Fišáková, Miriam
2006-01-01
Roč. 8, - (2006), s. 167-171 ISSN 1803-1404 Institutional research plan: CEZ:AV0Z80010507 Keywords : Pleistocene * pathology, palaeonthology * vertebrate, bear Subject RIV: AC - Archeology, Anthropology, Ethnology
48 CFR 3009.171-4 - Determination of ownership, control, or operation.
2010-10-01
... of a business concern, including Chief Financial Officer, Chief Operating Officer, or Chief... for the contracting officer to refuse making contract award to the business concern. (b) Any financial... following types of roles or interests with respect to the business concern: (1) Director or officer...
22 CFR 171.34 - Request for an accounting of record disclosures.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Request for an accounting of record disclosures... disclosures. (a) How made. Except where accountings of disclosures are not required to be kept, as set forth... individual. This accounting shall contain the date, nature, and purpose of each disclosure as well as the...
26 CFR 1.501(c)(17)-1 - Supplemental unemployment benefit trusts.
2010-04-01
... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Supplemental unemployment benefit trusts. 1.501(c... Supplemental unemployment benefit trusts. (a) Requirements for qualification. (1) A supplemental unemployment... the purpose of providing supplemental unemployment compensation benefits (as defined in section 501(c...
75 FR 61520 - National Council on the Arts 171st Meeting
2010-10-05
... Markusen, Director of the Project on Regional and Industrial Economics at the University of Minnesota's..., it becomes necessary for the Council to discuss non-public commercial or financial information of...
Clinics in diagnostic imaging (171). Caecal volvulus with underlying intestinal malrotation.
Ooi, Su Kai Gideon; Tan, Tien Jin; Ngu, James Chi Yong
2016-11-01
A 46-year-old Chinese woman with a history of cholecystectomy and appendicectomy presented to the emergency department with symptoms of intestinal obstruction. Physical examination revealed central abdominal tenderness but no clinical features of peritonism. Plain radiography of the abdomen revealed a grossly distended large bowel loop with the long axis extending from the right lower abdomen toward the epigastrium, and an intraluminal air-fluid level. These findings were suspicious for an acute caecal volvulus, which was confirmed on subsequent contrast-enhanced computed tomography (CT) of the abdomen and pelvis. CT demonstrated an abnormal positional relationship between the superior mesenteric vein and artery, indicative of an underlying intestinal malrotation. This case highlights the utility of preoperative imaging in establishing the diagnosis of an uncommon cause of bowel obstruction. It also shows the importance of recognising the characteristic imaging features early, so as to ensure appropriate and expedient management, thus reducing patient morbidity arising from complications. Copyright: © Singapore Medical Association.
42 CFR 416.171 - Determination of payment rates for ASC services.
2010-10-01
... relative value units under § 414.22(b)(5)(i)(B) of this subchapter multiplied by the conversion factor... applicable conversion factor and the relative payment weight established under § 416.167(b), unless otherwise indicated in this section. (1) Conversion factor for CY 2008. CMS calculates a conversion factor so that...
Baloch, A H; Khosa, A N; Bangulzai, N; Sadia, H; Ahmed, M; Khan, F; Jan, M; Tareen, M; Kakar, M H; Shuja, J; Naseeb, H K; Ahmad, J
2016-01-01
Invasive lobular carcinoma (ILC) is the second most common type of breast cancer accounting for 5%-15% of all the breast cancer cases. The present study was performed on 171 breast cancer patients from Balochistan registered in CENAR (Center for Nuclear Medicine and Radiotherapy), Quetta. Written consent was obtained from the patients. The history of the disease was taken from the patients, and the patients' enrollment files were retrieved. Of the 171 patients, 5 (2.96%) were diagnosed with ILC with tumor Grade II, and stage of the cancer reported was Grade III in all the 5 patients affected with ILC. ILC is the second most common type of breast cancer diagnosed with comparatively lower grade but almost reported infiltrating.
1974-06-01
HTLUIII »171 • «171 • unui i ■-coici i ■ «mnti • •m<i»i • UTLtlll :—i t<*i • %’»< ’ MUSI 11-COlOl 11 ««•11171 • «imciTi . «tuen fltl...ICnillC COMR ICIOMI n» IMIT KMTH INO «J NO MUSI TUIMM IM «III • tlill/OlIl MlltOM •III • OI«m MIIMM •Kl • tltl MIIMM irnctT...ll«l*IWIIl • «Uli mt iMiT iwmiM to rot«, H» M» VCHIOI I Mllll • MHIKlll Muti • Mini MUSI • Mnsi<oiti MINI • MUSI MUM • Mllll-OKil MIMI
Generalization of Samuelson's inequality and location of eigenvalues
Indian Academy of Sciences (India)
Department of Mathematics, H. P. University, Shimla 171 005, India ... Refinements, extensions and applications of such inequalities have been studied ..... Samuelson inequality with extensions and applications in statistics and matrix theory,.
Search Results | Page 18 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 171 - 180 of 439 ... Information and Communication Technologies for Development in the Middle ... and communication technology (ICT) to human, social and economic ... Understanding Think Tank-University Relationships in South Asia.
Comparison of regeneration efficiency of strong base anion exchangers fouled by iron and humic acids
Czech Academy of Sciences Publication Activity Database
Kus, P.; Kunesova, K.; Šlouf, Miroslav
2014-01-01
Roč. 49, č. 15 (2014), s. 2352-2357 ISSN 0149-6395 Institutional support: RVO:61389013 Keywords : regeneration * iron * fouling Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.171, year: 2014
Biological effect of the magnetic resonance on fruit flies, drosophila melanogaster
International Nuclear Information System (INIS)
Restrepo, Ana; Angel Karen; Lopez P, Monica; Sanabria, Ana I; Lopez, Maria I
1992-01-01
This article describes an investigation in which fruit flies, D. Melanogaster of the white and vestigial strains, were exposed to a magnetic resonance field for 171 hours, to determine possible genetic alterations
Feromony v integrované ochraně rostlin . IV. Obaleči na vinicích
Czech Academy of Sciences Publication Activity Database
Hrdý, Ivan
-, č. 4 (2006), s. 169-171 ISSN 0044-4812 Institutional research plan: CEZ:AV0Z40550506 Keywords : pheromones * Eupoecilia ambiguella * Lobesia botrana Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Pražskij lingvističeskij kružok i jevrazijstika
Czech Academy of Sciences Publication Activity Database
Savický, Nikolaj
2011-01-01
Roč. 80, 2/3 (2011), s. 171-173 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : linguistic geography * physical geograpfy * language union * interdisciplinarity Subject RIV: AI - Linguistics
Food Desert Census Tract Polygons, Region 9, 2000, US EPA Region 9
U.S. Environmental Protection Agency — Census Tract Data - Census 2000 This data layer represents Census 2000 demographic data derived from the PL94-171 redistricting files and SF3. Census geographic...
Natural Resource Management Index (NRMI), 2009 Release
National Aeronautics and Space Administration — The Natural Resource Management Index (NRMI), 2009 Release is a composite index for 171 countries derived from the average of four proximity-to-target indicators for...