Seeking the epoch of maximum luminosity for dusty quasars

International Nuclear Information System (INIS)

Vardanyan, Valeri; Weedman, Daniel; Sargsyan, Lusine

2014-01-01

Infrared luminosities νL ν (7.8 μm) arising from dust reradiation are determined for Sloan Digital Sky Survey (SDSS) quasars with 1.4 3 with maximum luminosity νL ν (7.8 μm) ≳ 10 47 erg s –1 ; luminosity functions show one quasar Gpc –3 having νL ν (7.8 μm) > 10 46.6 erg s –1 for all 2 quasars first reached their maximum luminosity has not yet been identified at any redshift below 5. The most ultraviolet luminous quasars, defined by rest frame νL ν (0.25 μm), have the largest values of the ratio νL ν (0.25 μm)/νL ν (7.8 μm) with a maximum ratio at z = 2.9. From these results, we conclude that the quasars most luminous in the ultraviolet have the smallest dust content and appear luminous primarily because of lessened extinction. Observed ultraviolet/infrared luminosity ratios are used to define 'obscured' quasars as those having >5 mag of ultraviolet extinction. We present a new summary of obscured quasars discovered with the Spitzer Infrared Spectrograph and determine the infrared luminosity function of these obscured quasars at z ∼ 2.1. This is compared with infrared luminosity functions of optically discovered, unobscured quasars in the SDSS and in the AGN and Galaxy Evolution Survey. The comparison indicates comparable numbers of obscured and unobscured quasars at z ∼ 2.1 with a possible excess of obscured quasars at fainter luminosities.

Is 1146+111B, C a lensed quasar or a quasar pair

International Nuclear Information System (INIS)

Huchra, J.P.

1986-01-01

It has been speculated that the quasar pair 1146+B, C are two bright images of a single quasar produced by a gravitational lens. The author reports additional observations of these objects, made with an ultraviolet-sensitive spectrograph on the Multiple Mirror Telescope. The ultraviolet spectra of the two quasars are different. There are also different velocity shifts between the quasars as measured by the C III] and Mg II lines. Although it is impossible to rule out the lensing hypothesis, these observations increase the probability that these objects are just two quasars at nearly the same redshift. (author)

Probing black hole accretion in quasar pairs at high redshift

Science.gov (United States)

Vignali, C.; Piconcelli, E.; Perna, M.; Hennawi, J.; Gilli, R.; Comastri, A.; Zamorani, G.; Dotti, M.; Mathur, S.

2018-06-01

Models and observations suggest that luminous quasar activity is triggered by mergers, so it should preferentially occur in the most massive primordial dark matter haloes, where the frequency of mergers is expected to be the highest. Since the importance of galaxy mergers increases with redshift, we identify the high-redshift Universe as the ideal laboratory for studying dual AGN. Here, we present the X-ray properties of two systems of dual quasars at z = 3.0-3.3 selected from the SDSS DR6 at separations of 6-8 arcsec (43-65 kpc) and observed by Chandra for ≈65 ks each. Both members of each pair are detected with good photon statistics to allow us to constrain the column density, spectral slope and intrinsic X-ray luminosity. We also include a recently discovered dual quasar at z = 5 (separation of 21 arcsec, 136 kpc) for which XMM-Newton archival data allow us to detect the two components separately. Using optical spectra we derived bolometric luminosities, BH masses and Eddington ratios that were compared to those of luminous SDSS quasars in the same redshift ranges. We find that the brighter component of both quasar pairs at z ≈ 3.0-3.3 has high luminosities compared to the distribution of SDSS quasars at similar redshift, with J1622A having an order magnitude higher luminosity than the median. This source lies at the luminous end of the z ≈ 3.3 quasar luminosity function. While we cannot conclusively state that the unusually high luminosities of our sources are related to their having a close companion, for J1622A there is only a 3 per cent probability that it is by chance.

Probing black hole accretion in quasar pairs at high redshift

Science.gov (United States)

Vignali, C.; Piconcelli, E.; Perna, M.; Hennawi, J.; Gilli, R.; Comastri, A.; Zamorani, G.; Dotti, M.; Mathur, S.

2018-03-01

Models and observations suggest that luminous quasar activity is triggered by mergers, so it should preferentially occur in the most massive primordial dark matter haloes, where the frequency of mergers is expected to be the highest. Since the importance of galaxy mergers increases with redshift, we identify the high-redshift Universe as the ideal laboratory for studying dual AGN. Here we present the X-ray properties of two systems of dual quasars at z=3.0-3.3 selected from the SDSS DR6 at separations of 6-8 arcsec (43-65 kpc) and observed by Chandra for ≈65 ks each. Both members of each pair are detected with good photon statistics to allow us to constrain the column density, spectral slope and intrinsic X-ray luminosity. We also include a recently discovered dual quasar at z=5 (separation of 21″, 136 kpc) for which XMM-Newton archival data allow us to detect the two components separately. Using optical spectra we derived bolometric luminosities, BH masses and Eddington ratios that were compared to those of luminous SDSS quasars in the same redshift ranges. We find that the brighter component of both quasar pairs at z ≈ 3.0-3.3 has high luminosities compared to the distribution of SDSS quasars at similar redshift, with J1622A having an order magnitude higher luminosity than the median. This source lies at the luminous end of the z ≈ 3.3 quasar luminosity function. While we cannot conclusively state that the unusually high luminosities of our sources are related to their having a close companion, for J1622A there is only a 3% probability that it is by chance.

The Quasar Fraction in Low-Frequency Selected Complete Samples and Implications for Unified Schemes

Science.gov (United States)

Willott, Chris J.; Rawlings, Steve; Blundell, Katherine M.; Lacy, Mark

2000-01-01

Low-frequency radio surveys are ideal for selecting orientation-independent samples of extragalactic sources because the sample members are selected by virtue of their isotropic steep-spectrum extended emission. We use the new 7C Redshift Survey along with the brighter 3CRR and 6C samples to investigate the fraction of objects with observed broad emission lines - the 'quasar fraction' - as a function of redshift and of radio and narrow emission line luminosity. We find that the quasar fraction is more strongly dependent upon luminosity (both narrow line and radio) than it is on redshift. Above a narrow [OII] emission line luminosity of log(base 10) (L(sub [OII])/W) approximately > 35 [or radio luminosity log(base 10) (L(sub 151)/ W/Hz.sr) approximately > 26.5], the quasar fraction is virtually independent of redshift and luminosity; this is consistent with a simple unified scheme with an obscuring torus with a half-opening angle theta(sub trans) approximately equal 53 deg. For objects with less luminous narrow lines, the quasar fraction is lower. We show that this is not due to the difficulty of detecting lower-luminosity broad emission lines in a less luminous, but otherwise similar, quasar population. We discuss evidence which supports at least two probable physical causes for the drop in quasar fraction at low luminosity: (i) a gradual decrease in theta(sub trans) and/or a gradual increase in the fraction of lightly-reddened (0 approximately quasar luminosity; and (ii) the emergence of a distinct second population of low luminosity radio sources which, like M8T, lack a well-fed quasar nucleus and may well lack a thick obscuring torus.

SDSS J1254+0846: A BINARY QUASAR CAUGHT IN THE ACT OF MERGING

International Nuclear Information System (INIS)

Green, Paul J.; Cox, Thomas J.; Aldcroft, Thomas L.; Myers, Adam D.; Barkhouse, Wayne A.; Mulchaey, John S.; Bennert, Vardha N.

2010-01-01

We present the first luminous, spatially resolved binary quasar that clearly inhabits an ongoing galaxy merger. SDSS J125455.09+084653.9 and SDSS J125454.87+084652.1 (SDSS J1254+0846 hereafter) are two luminous z = 0.44 radio-quiet quasars, with a radial velocity difference of just 215 km s -1 , separated on the sky by 21 kpc in a disturbed host galaxy merger showing obvious tidal tails. The pair was targeted as part of a complete sample of binary quasar candidates with small transverse separations drawn from SDSS DR6 photometry. We present follow-up optical imaging which shows broad, symmetrical tidal arm features spanning some 75 kpc at the quasars' redshift. Previously, the triggering of two quasars during a merger had only been hypothesized but our observations provide strong evidence of such an event. SDSS J1254+0846, as a face-on, pre-coalescence merger hosting two luminous quasars separated by a few dozen kpc, provides a unique opportunity to probe quasar activity in an ongoing gas-rich merger. Numerical modeling suggests that the system consists of two massive disk galaxies prograde to their mutual orbit, caught during the first passage of an active merger. This demonstrates rapid black hole growth during the early stages of a merger between galaxies with pre-existing bulges. Neither of the two luminous nuclei show significant intrinsic absorption by gas or dust in our optical or X-ray observations, illustrating that not all merging quasars will be in an obscured, ultraluminous phase. We find that the Eddington ratio for the fainter component B is rather normal, while for the A component L/L Edd is quite (>3σ) high compared to quasars of similar luminosity and redshift, possibly evidence for strong merger-triggered accretion. More such mergers should be identifiable at higher redshifts using binary quasars as tracers.

High-redshift quasars in the Cold Dark Matter cosmogony

International Nuclear Information System (INIS)

Efstathiou, G.; Rees, M.J.

1988-01-01

The relationship between high-redshift quasars and the epoch of galaxy formation in the Cold Dark Matter (CDM) cosmogony is investigated. Luminous quasars could only form after galactic sized systems had collapsed. A constant comoving density of luminous quasars between z = 2 and z = 4 is compatible with the CDM model if quasars are short-lived and radiate at about the Eddington limit. However, according to the CDM model the abundance of high-luminosity quasars must decline exponentially at higher redshifts. Even if all protogalaxies form quasars, and about 1 per cent of the baryons within a protogalaxy collapse into a compact object, a steep fall in the density of quasars with L > 10 47 erg s -1 at redshifts z ≥ 5. The existence of a 'cut-off' in the quasar numbers at high redshift could therefore supply an important test of the CDM theory. (author)

Mass Functions of the Active Black Holes in Distant Quasars from the Large Bright Quasar Survey, the Bright Quasar Survey, and the Color-Selected Sample of the SDSS Fall Equatorial Stripe

DEFF Research Database (Denmark)

Vestergaard, Marianne; Osmer, Patrick S.

2009-01-01

We present mass functions of distant actively accreting supermassive black holes residing in luminous quasars discovered in the Large Bright Quasar Survey, the Bright Quasar Survey, and the Fall Equatorial Stripe of the Sloan Digital Sky Survey (SDSS). The quasars cover a wide range of redshifts (0...... functions at similar redshifts based on the SDSS Data Release 3 quasar catalog presented by Vestergaard et al. We see clear evidence of cosmic downsizing in the comoving space density distribution of active black holes in the LBQS sample alone. In forthcoming papers, further analysis, comparison......, and discussion of these mass functions will be made with other existing black hole mass functions, notably that based on the SDSS DR3 quasar catalog. We present the relationships used to estimate the black hole mass based on the MgII emission line; the relations are calibrated to the Hbeta and CIV relations...

Clustering of quasars in a wide luminosity range at redshift 4 with Subaru Hyper Suprime-Cam Wide-field imaging

Science.gov (United States)

He, Wanqiu; Akiyama, Masayuki; Bosch, James; Enoki, Motohiro; Harikane, Yuichi; Ikeda, Hiroyuki; Kashikawa, Nobunari; Kawaguchi, Toshihiro; Komiyama, Yutaka; Lee, Chien-Hsiu; Matsuoka, Yoshiki; Miyazaki, Satoshi; Nagao, Tohru; Nagashima, Masahiro; Niida, Mana; Nishizawa, Atsushi J.; Oguri, Masamune; Onoue, Masafusa; Oogi, Taira; Ouchi, Masami; Schulze, Andreas; Shirasaki, Yuji; Silverman, John D.; Tanaka, Manobu M.; Tanaka, Masayuki; Toba, Yoshiki; Uchiyama, Hisakazu; Yamashita, Takuji

2018-01-01

We examine the clustering of quasars over a wide luminosity range, by utilizing 901 quasars at \\overline{z}_phot˜ 3.8 with -24.73 Strategic Program (HSC-SSP) S16A Wide2 date release and 342 more luminous quasars at 3.4 Digital Sky Survey that fall in the HSC survey fields. We measure the bias factors of two quasar samples by evaluating the cross-correlation functions (CCFs) between the quasar samples and 25790 bright z ˜ 4 Lyman break galaxies in M1450 < -21.25 photometrically selected from the HSC dataset. Over an angular scale of 10.0" to 1000.0", the bias factors are 5.93+1.34-1.43 and 2.73+2.44-2.55 for the low- and high-luminosity quasars, respectively, indicating no significant luminosity dependence of quasar clustering at z ˜ 4. It is noted that the bias factor of the luminous quasars estimated by the CCF is smaller than that estimated by the auto-correlation function over a similar redshift range, especially on scales below 40.0". Moreover, the bias factor of the less-luminous quasars implies the minimal mass of their host dark matter halos is 0.3-2 × 1012 h-1 M⊙, corresponding to a quasar duty cycle of 0.001-0.06.

Eight New Luminous z > 6 Quasars Selected via SED Model Fitting of VISTA, WISE and Dark Energy Survey Year 1 Observations

Energy Technology Data Exchange (ETDEWEB)

Reed, S.L.; et al.

2017-01-17

We present the discovery and spectroscopic confirmation with the ESO NTT and Gemini South telescopes of eight new 6.0 < z < 6.5 quasars with z$_{AB}$ < 21.0. These quasars were photometrically selected without any star-galaxy morphological criteria from 1533 deg$^{2}$ using SED model fitting to photometric data from the Dark Energy Survey (g, r, i, z, Y), the VISTA Hemisphere Survey (J, H, K) and the Wide-Field Infrared Survey Explorer (W1, W2). The photometric data was fitted with a grid of quasar model SEDs with redshift dependent Lyman-{\\alpha} forest absorption and a range of intrinsic reddening as well as a series of low mass cool star models. Candidates were ranked using on a SED-model based $\\chi^{2}$-statistic, which is extendable to other future imaging surveys (e.g. LSST, Euclid). Our spectral confirmation success rate is 100% without the need for follow-up photometric observations as used in other studies of this type. Combined with automatic removal of the main types of non-astrophysical contaminants the method allows large data sets to be processed without human intervention and without being over run by spurious false candidates. We also present a robust parametric redshift estimating technique that gives comparable accuracy to MgII and CO based redshift estimators. We find two z $\\sim$ 6.2 quasars with HII near zone sizes < 3 proper Mpc which could indicate that these quasars may be young with ages < 10$^6$ - 10$^7$ years or lie in over dense regions of the IGM. The z = 6.5 quasar VDESJ0224-4711 has J$_{AB}$ = 19.75 is the second most luminous quasar known with z > 6.5.

Exploratory X-ray Monitoring of z>4 Radio-Quiet Quasars

Science.gov (United States)

Shemmer, Ohad

2017-09-01

We propose to extend our exploratory X-ray monitoring project of some of the most distant radio-quiet quasars by obtaining one snapshot observation per Cycle for each of four sources at z>4. Combining these observations with six available X-ray epochs per source will provide basic temporal information over rest-frame timescales of 3-5 yr. We are supporting this project with Swift monitoring of luminous radio-quiet quasars at z=1.3-2.7 to break the L-z degeneracy and test evolutionary scenarios of the central engine in active galactic nuclei. Our ultimate goal is to provide a basic assessment of the X-ray variability properties of luminous quasars at the highest accessible redshifts that will serve as the benchmark for X-ray variability studies of such sources with future X-ray missions.

Subaru High-z Exploration of Low-Luminosity Quasars (SHELLQs). III. Star formation properties of the host galaxies at z ≳ 6 studied with ALMA

Science.gov (United States)

Izumi, Takuma; Onoue, Masafusa; Shirakata, Hikari; Nagao, Tohru; Kohno, Kotaro; Matsuoka, Yoshiki; Imanishi, Masatoshi; Strauss, Michael A.; Kashikawa, Nobunari; Schulze, Andreas; Silverman, John D.; Fujimoto, Seiji; Harikane, Yuichi; Toba, Yoshiki; Umehata, Hideki; Nakanishi, Kouichiro; Greene, Jenny E.; Tamura, Yoichi; Taniguchi, Akio; Yamaguchi, Yuki; Goto, Tomotsugu; Hashimoto, Yasuhiro; Ikarashi, Soh; Iono, Daisuke; Iwasawa, Kazushi; Lee, Chien-Hsiu; Makiya, Ryu; Minezaki, Takeo; Tang, Ji-Jia

2018-04-01

We present our ALMA Cycle 4 measurements of the [C II] emission line and the underlying far-infrared (FIR) continuum emission from four optically low-luminosity (M1450 > -25) quasars at z ≳ 6 discovered by the Subaru Hyper Suprime Cam (HSC) survey. The [C II] line and FIR continuum luminosities lie in the ranges L_[C II] = (3.8-10.2)× 108 L_{⊙} and LFIR = (1.2-2.0) × 1011 L_{⊙}, which are at least one order of magnitude smaller than those of optically-luminous quasars at z ≳ 6. We estimate the star formation rates (SFRs) of our targets as ≃ 23-40 M_{⊙} yr-1. Their line and continuum-emitting regions are marginally resolved, and found to be comparable in size to those of optically-luminous quasars, indicating that their SFR or likely gas mass surface densities (key controlling parameter of mass accretion) are accordingly different. The L_[C II]/L_FIR ratios of the hosts, ≃ (2.2-8.7) × 10-3, are fully consistent with local star-forming galaxies. Using the [C II] dynamics, we derived their dynamical masses within a radius of 1.5-2.5 kpc as ≃ (1.4-8.2) × 1010 M_{⊙}. By interpreting these masses as stellar ones, we suggest that these faint quasar hosts are on or even below the star-forming main sequence at z ˜ 6, i.e., they appear to be transforming into quiescent galaxies. This is in contrast to the optically-luminous quasars at those redshifts, which show starburst-like properties. Finally, we find that the ratios of black hole mass to host galaxy dynamical mass of most of the low-luminosity quasars, including the HSC ones, are consistent with the local value. The mass ratios of the HSC quasars can be reproduced by a semi-analytical model that assumes merger-induced black hole host galaxy evolution.

The Discovery of a Luminous Z=5.80 Quasar from the Sloan Digital Sky Survey

Science.gov (United States)

Fan, Xiaohui; White, Richard L.; Davis, Marc; Becker, Robert H.; Strauss, Michael A.; Haiman, Zoltan; Schneider, Donald P.; Gregg, Michael D.; Gunn, James E.; Knapp, G. R.; Lupton, Robert H.; Anderson, John E., Jr.; Anderson, Scott F.; Annis, James; Bahcall, Neta A.; Boroski, William N.; Brunner, Robert J.; Chen, Bing; Connolly, Andrew J.; Csabai, István; Doi, Mamoru; Fukugita, Masataka; Hennessy, G. S.; Hindsley, Robert B.; Ichikawa, Takashi; Ivezić, Željko; Loveday, Jon; Meiksin, Avery; McKay, Timothy A.; Munn, Jeffrey A.; Newberg, Heidi Jo; Nichol, Robert; Okamura, Sadanori; Pier, Jeffrey R.; Sekiguchi, Maki; Shimasaku, Kazuhiro; Stoughton, Chris; Szalay, Alexander S.; Szokoly, Gyula P.; Thakar, Aniruddha R.; Vogeley, Michael S.; York, Donald G.

2000-09-01

We present observations of SDSSp J104433.04-012502.2, a luminous quasar at z=5.80 discovered from Sloan Digital Sky Survey (SDSS) multicolor imaging data. This object was selected as an i'-band dropout object, with i*=21.8+/-0.2 and z*=19.2+/-0.1. It has an absolute magnitude M1450=-27.2 (H0=50 km s-1 Mpc-1, q0=0.5). The spectrum shows a strong and broad Lyα emission line, strong Lyα forest absorption lines with a mean continuum decrement DA=0.91 and a Lyman limit system at z=5.72. The spectrum also shows strong O I and Si IV emission lines similar to those of quasars at zuniverse is already highly ionized at z~5.8. Using a high-resolution spectrum in the Lyα forest region, we place a conservative upper limit on the optical depth because of the Gunn-Peterson effect of τUniversity of California, and NASA, and was made possible by the generous financial support of the W. M. Keck Foundation.

Eight new luminous z ≥ 6 quasars discovered via SED model fitting of VISTA, WISE and Dark Energy Survey Year 1 observations

International Nuclear Information System (INIS)

Reed, S. L.; McMahon, R. G.; Martini, P.; Banerji, M.; Auger, M.

2017-01-01

Here, we present the discovery and spectroscopic confirmation with the European Southern Observatory New Technology Telescope (NTT) and Gemini South telescopes of eight new, and the rediscovery of two previously known, 6.0 < z < 6.5 quasars with zAB < 21.0. These quasars were photometrically selected without any morphological criteria from 1533 deg2 using spectral energy distribution (SED) model fitting to photometric data from Dark Energy Survey (g, r, i, z, Y), VISTA Hemisphere Survey (J, H, K) and Wide-field Infrared Survey Explorer (W1, W2). The photometric data were fitted with a grid of quasar model SEDs with redshift-dependent Ly α forest absorption and a range of intrinsic reddening as well as a series of low-mass cool star models. Candidates were ranked using an SED-model-based χ2-statistic, which is extendable to other future imaging surveys (e.g. LSST and Euclid). Our spectral confirmation success rate is 100 per cent without the need for follow-up photometric observations as used in other studies of this type. Combined with automatic removal of the main types of non-astrophysical contaminants, the method allows large data sets to be processed without human intervention and without being overrun by spurious false candidates. We also present a robust parametric redshift estimator that gives comparable accuracy to Mg ii and CO-based redshift estimators. We find two z ~6.2 quasars with H ii near zone sizes ≤3 proper Mpc that could indicate that these quasars may be young with ages ≲ 10 6 -10 7 years or lie in over dense regions of the IGM. The z = 6.5 quasar VDES J0224–4711 has JAB = 19.75 and is the second most luminous quasar known with z ≥ 6.5.

Exploratory X-ray monitoring of luminous radio-quiet quasars at high redshift: Initial results

Energy Technology Data Exchange (ETDEWEB)

Shemmer, Ohad; Stein, Matthew S. [Department of Physics, University of North Texas, Denton, TX 76203 (United States); Brandt, W. N.; Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Paolillo, Maurizio [Dipartimento di Scienze Fisiche, Università Federico II di Napoli, via Cinthia 6, I-80126 Napoli (Italy); Kaspi, Shai [School of Physics and Astronomy and the Wise Observatory, Tel Aviv University, Tel Aviv 69978 (Israel); Vignali, Cristian [Dipartimento di Astronomia, Università degli studi di Bologna, via Ranzani 1, I-40127 Bologna (Italy); Lira, Paulina [Departamento de Astronomia, Universidad de Chile, Camino del Observatorio 1515, Santiago (Chile); Gibson, Robert R., E-mail: ohad@unt.edu [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States)

2014-03-10

We present initial results from an exploratory X-ray monitoring project of two groups of comparably luminous radio-quiet quasars (RQQs). The first consists of four sources at 4.10 ≤ z ≤ 4.35, monitored by Chandra, and the second is a comparison sample of three sources at 1.33 ≤ z ≤ 2.74, monitored by Swift. Together with archival X-ray data, the total rest-frame temporal baseline spans ∼2-4 yr and ∼5-13 yr for the first and second group, respectively. Six of these sources show significant X-ray variability over rest-frame timescales of ∼10{sup 2}-10{sup 3} days; three of these also show significant X-ray variability on rest-frame timescales of ∼1-10 days. The X-ray variability properties of our variable sources are similar to those exhibited by nearby and far less luminous active galactic nuclei (AGNs). While we do not directly detect a trend of increasing X-ray variability with redshift, we do confirm previous reports of luminous AGNs exhibiting X-ray variability above that expected from their luminosities, based on simplistic extrapolation from lower luminosity sources. This result may be attributed to luminous sources at the highest redshifts having relatively high accretion rates. Complementary UV-optical monitoring of our sources shows that variations in their optical-X-ray spectral energy distribution are dominated by the X-ray variations. We confirm previous reports of X-ray spectral variations in one of our sources, HS 1700+6416, but do not detect such variations in any of our other sources in spite of X-ray flux variations of up to a factor of ∼4. This project is designed to provide a basic assessment of the X-ray variability properties of RQQs at the highest accessible redshifts that will serve as a benchmark for more systematic monitoring of such sources with future X-ray missions.

Discovery of γ-ray Emission from the Strongly Lobe-dominated Quasar 3C 275.1

Science.gov (United States)

Liao, Neng-Hui; Xin, Yu-Liang; Li, Shang; Jiang, Wei; Liang, Yun-Feng; Li, Xiang; Zhang, Peng-Fei; Chen, Liang; Bai, Jin-Ming; Fan, Yi-Zhong

2015-07-01

We systematically analyze the 6 year Fermi/Large Area Telescope (LAT) data on lobe-dominated quasars (LDQs) in the complete LDQ sample from the Revised third Cambridge Catalogue of Radio Sources (3CRR) survey and report the discovery of high-energy γ-ray emission from 3C 275.1. The γ-ray emission of 3C 207 is confirmed and significant variability of the light curve is identified. We do not find statistically significant γ-ray emission from other LDQs. 3C 275.1 is the known γ-ray quasar with the lowest core dominance parameter (i.e., R = 0.11). We also show that both the northern radio hotspot and parsec jet models can reasonably reproduce the γ-ray data. The parsec jet model, however, is favored by the potential γ-ray variability on a timescale of months. We suggest that some dimmer γ-ray LDQs will be detected in the future and LDQs could contribute non-ignorably to the extragalactic γ-ray background.

FIRST-2MASS RED QUASARS: TRANSITIONAL OBJECTS EMERGING FROM THE DUST

International Nuclear Information System (INIS)

Glikman, Eilat; Urrutia, Tanya; Lacy, Mark; Djorgovski, S. George; Mahabal, Ashish; Myers, Adam D.; Ross, Nicholas P.; Petitjean, Patrick; Ge, Jian; Schneider, Donald P.; York, Donald G.

2012-01-01

We present a sample of 120 dust-reddened quasars identified by matching radio sources detected at 1.4 GHz in the Faint Images of the Radio Sky at Twenty Centimeters survey with the near-infrared Two Micron All Sky Survey catalog and color-selecting red sources. Optical and/or near-infrared spectroscopy provide broad wavelength sampling of their spectral energy distributions that we use to determine their reddening, characterized by E(B – V). We demonstrate that the reddening in these quasars is best described by Small-Magellanic-Cloud-like dust. This sample spans a wide range in redshift and reddening (0.1 ∼< z ∼< 3, 0.1 ∼< E(B – V) ∼< 1.5), which we use to investigate the possible correlation of luminosity with reddening. At every redshift, dust-reddened quasars are intrinsically the most luminous quasars. We interpret this result in the context of merger-driven quasar/galaxy co-evolution where these reddened quasars are revealing an emergent phase during which the heavily obscured quasar is shedding its cocoon of dust prior to becoming a 'normal' blue quasar. When correcting for extinction, we find that, depending on how the parent population is defined, these red quasars make up ∼< 15%-20% of the luminous quasar population. We estimate, based on the fraction of objects in this phase, that its duration is 15%-20% as long as the unobscured, blue quasar phase.

Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

DEFF Research Database (Denmark)

Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.

2003-01-01

INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...

Eight new luminous z ≥ 6 quasars discovered via SED model fitting of VISTA, WISE and Dark Energy Survey Year 1 observations

Science.gov (United States)

Reed, S. L.; McMahon, R. G.; Martini, P.; Banerji, M.; Auger, M.; Hewett, P. C.; Koposov, S. E.; Gibbons, S. L. J.; Gonzalez-Solares, E.; Ostrovski, F.; Tie, S. S.; Abdalla, F. B.; Allam, S.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Buckley-Geer, E.; Burke, D. L.; Carnero Rosell, A.; Carrasco Kind, M.; Carretero, J.; da Costa, L. N.; DePoy, D. L.; Desai, S.; Diehl, H. T.; Doel, P.; Evrard, A. E.; Finley, D. A.; Flaugher, B.; Fosalba, P.; Frieman, J.; García-Bellido, J.; Gaztanaga, E.; Goldstein, D. A.; Gruen, D.; Gruendl, R. A.; Gutierrez, G.; James, D. J.; Kuehn, K.; Kuropatkin, N.; Lahav, O.; Lima, M.; Maia, M. A. G.; Marshall, J. L.; Melchior, P.; Miller, C. J.; Miquel, R.; Nord, B.; Ogando, R.; Plazas, A. A.; Romer, A. K.; Sanchez, E.; Scarpine, V.; Schubnell, M.; Sevilla-Noarbe, I.; Smith, R. C.; Sobreira, F.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Tucker, D. L.; Walker, A. R.; Wester, W.

2017-07-01

We present the discovery and spectroscopic confirmation with the European Southern Observatory New Technology Telescope (NTT) and Gemini South telescopes of eight new, and the rediscovery of two previously known, 6.0 VISTA Hemisphere Survey (J, H, K) and Wide-field Infrared Survey Explorer (W1, W2). The photometric data were fitted with a grid of quasar model SEDs with redshift-dependent Ly α forest absorption and a range of intrinsic reddening as well as a series of low-mass cool star models. Candidates were ranked using an SED-model-based χ2-statistic, which is extendable to other future imaging surveys (e.g. LSST and Euclid). Our spectral confirmation success rate is 100 per cent without the need for follow-up photometric observations as used in other studies of this type. Combined with automatic removal of the main types of non-astrophysical contaminants, the method allows large data sets to be processed without human intervention and without being overrun by spurious false candidates. We also present a robust parametric redshift estimator that gives comparable accuracy to Mg II and CO-based redshift estimators. We find two z ˜ 6.2 quasars with H II near zone sizes ≤3 proper Mpc that could indicate that these quasars may be young with ages ≲ 106-107 years or lie in over dense regions of the IGM. The z = 6.5 quasar VDES J0224-4711 has JAB = 19.75 and is the second most luminous quasar known with z ≥ 6.5.

Extended Emission-Line Regions: Remnants of Quasar Superwinds?

Science.gov (United States)

Fu, Hai; Stockton, Alan

2009-01-01

We give an overview of our recent integral-field-unit spectroscopy of luminous extended emission-line regions (EELRs) around low-redshift quasars, including new observations of five fields. Previous work has shown that the most luminous EELRs are found almost exclusively around steep-spectrum radio-loud quasars, with apparently disordered global velocity fields, and little, if any, morphological correlation with either the host galaxy or the radio structure. Our new observations confirm and expand these results. The EELRs often show some clouds with velocities exceeding 500 km s-1, ranging up to 1100 km s-1, but the velocity dispersions, with few exceptions, are in the 30-100 km s-1 range. Emission-line ratios show that the EELRs are clearly photoionized by the quasars. Masses of the EELRs range up to 1010Msun. Essentially all of the EELRs show relatively low metallicities, and they are associated with quasars that, in contrast to most, show similarly low metallicities in their broad-line regions. The two objects in our sample that do not have classical double-lobed radio morphologies (3C 48, with a compact-steep-spectrum source; Mrk 1014, radio quiet, but with a weak compact-steep-spectrum source) are the only ones that appear to have recent star formation. While some of the less luminous EELRs may have other origins, the most likely explanation for those in our sample is that they are examples of gas swept out of the host galaxy by a large-solid-angle blast wave accompanying the production of the radio jets. The triggering of the quasar activity is almost certainly the result of the merger of a gas-rich galaxy with a massive, gas-poor galaxy hosting the supermassive black hole. Based in part on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the

Optical spectral properties of active galactic nuclei and quasars

International Nuclear Information System (INIS)

Yee, H.K.C.

1981-01-01

Four separate investigations dealing with the properties of optical continuum and emission-lines of active galactic nuclei (AGN) and quasars are presented. Multichannel scans of 3CR radio galaxies are decomposed by using a two-component model-an elliptical galaxy and a power-law nonthermal component. It is found that there is a strong correlation between the luminosity of the power-law component and the strength of the Balmer emission-lines. In most cases, by extrapolating to the Lyman continuum, the power-law models derived provide enough ionizing radiation to account for the Balmer line strengths. Extending the study of radio galaxies to include Seyfert galaxies and quasars, it is found that there is a strong continuity between broad-line AGN's and quasars in terms of similarities in the correlations between line luminosities and nonthermal continuum luminosity. Next, a study of the variability of absolute optical energy distribution and emission-lines of the N-galaxies 3C382 and 3C390.3 is made. Lastly, a preliminary study of surface photometry of Markarian Seyfert galaxies are presented. It is found that the properties of the underlying galaxies such as scale-length and surface brightness of the disk, color, and total brightness, do not depart systematically from those of luminous normal spiral galaxies

The unprecedented optica outburst of the quasar 3C 454.3

Czech Academy of Sciences Publication Activity Database

Villata, M.; Raiteri, C.M.; Balonek, T.J.; Aller, M.F.; Jorstad, S.G.; Kurtanidze, O.M.; Nicastro, F.; Nilsson, K.; Aller, H.D.; Arai, A.; Arkharov, A.; Bach, U.; Benítez, E.; Berdyugin, A.; Buemi, C.S.; Böttcher, M.; Carosati, D.; Casas, R.; Caulet, A.; Chen, W.P.; Chiang, P.-S.; Chou, Y.; Ciprini, S.; Coloma, J.M.; Di Rico, G.; Díaz, C.; Efimova, N.V.; Forsyth, C.; Frasca, A.; Fuhrmann, L.; Gadway, B.; Gupta, S.; Hagen-Thorn, V.A.; Harvey, J.; Heidt, J.; Hernandez-Toledo, H.; Hroch, F.; Hu, C.-P.; Hudec, René; Ibrahimov, M.A.; Imada, A.; Kamata, M.; Kato, T.; Katsuura, M.; Konstantinova, T.; Kopatskaya, E.; Kotaka, D.; Kovalev, Y.Y.; Kovalev, Yu.A.; Krichbaum, T.P.; Kubota, K.; Kurosaki, M.; Lanteri, L.; Larionov, V.M.; Larionova, L.; Laurikainen, E.; Lee, C.-U.; Leto, P.; Lähteenmäki, A.; López-Cruz, O.; Marilli, E.; Marscher, A.P.; McHardy, I.M.; Mondal, S.; Mullan, B.; Napoleone, N.; Nikolashvili, M.G.; Ohlert, J.M.; Postnikov, S.; Pursimo, T.; Ragni, M.; Ros, J.A.; Sadakane, K.; Sadun, A.C.; Savolainen, T.; Sergeeva, E.A.; Sigua, L.A.; Sillanpää, A.; Sixtová, L.; Sumitomo, N.; Takalo, L.O.; Teräsranta, H.; Tornikoski, M.; Trigilio, C.; Umana, G.; Volvach, A.; Voss, B.; Wortel, S.

2006-01-01

Roč. 453, č. 3 (2006), s. 817-822 ISSN 0004-6361 R&D Projects: GA AV ČR IAA3003206 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxies * quasar s * jets Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.971, year: 2006

Star Formation in Dusty Quasars

Science.gov (United States)

Lumsden, Stuart; Croom, Scott

2012-04-01

Quasar mode feedback is thought to be a crucial ingredient in galaxy formation for luminous merging and star-bursting systems at high redshift. The energy from the active nucleus should cause significant gas outflows, reducing the available free gas reservoir for future star formation. It is currently unknown which observational state best corresponds to the stage at which this "blowout" should occur. We intend to test one possible source population for this transition phase, by studying the molecular gas content in a small, statistically complete sample of 3 K-band selected reddened quasars from the AUS survey. All lie in the redshift range 2quasar activity in typical galaxies, where we also expect the bulk of the stars for form as well.

Effect of undetected gravitational lenses on statistical measures of quasar evolution

International Nuclear Information System (INIS)

Turner, E.L.

1980-01-01

Brightness amplifications by undetected gravitational lenses could be responsible in part for the apparent evolution of quasars, particularly for those which appear to be of high luminosity. It is shown that values of Vover-bar/over-barVover-bar/sub M/> or =0.6 and number-magnitude slopes > or =0.9 need not necessarily imply source density evolution if lensing events are common. Quasar samples which are defined by flux limits and minimum luminosities will preferentially include gravitational lens systems. Even if lensing events are quite rare, a large fraction of the lensed quasars will appear more luminous than the most luminous unlensed quasar

GNIRS-DQS: A Gemini Near Infrared Spectrograph Distant Quasar Survey

Science.gov (United States)

Matthews, Brandon; Shemmer, Ohad; Brotherton, Michael S.; Andruchow, Ileana; Boroson, Todd A.; Brandt, W. Niel; Cellone, Sergio; Ferrero, Gabriel; Gallagher, Sarah; Green, Richard F.; Hennawi, Joseph F.; Lira, Paulina; Myers, Adam D.; Plotkin, Richard; Richards, Gordon T.; Runnoe, Jessie; Schneider, Donald P.; Shen, Yue; Strauss, Michael A.; Willott, Chris J.; Wills, Beverley J.

2018-06-01

We describe an ongoing three-year Gemini survey, launched in 2017, that will obtain near-infrared spectroscopy of 416 Sloan Digital Sky Survey (SDSS) quasars between redshifts of 1.5 and 3.5 in the ~1.0-2.5 μm band. These spectra will cover critical diagnostic emission lines, such as Mg II, Hβ, and [O III], in each source. This project will more than double the existing inventory of near-infrared spectra of luminous quasars at these redshifts, including the era of fast quasar growth. Additional rest frame ultraviolet coverage of at least the C IV emission line is provided by the SDSS spectrum of each source. We will utilize the spectroscopic inventory to determine the most accurate and precise quasar black hole masses, accretion rates, and redshifts, and use the results to derive improved prescriptions for UV-based proxies for these parameters. The improved redshifts will establish velocities of quasar outflows that interact with the host galaxies, and will help constrain how imprecise distance estimates bias quasar clustering measurements. Furthermore, our measurements will facilitate a more complete understanding of how the rest-frame UV-optical spectral properties depend on redshift and luminosity, and test whether the physical properties of the quasar central engine evolve over cosmic time. We will make our data immediately available to the public, provide reduced spectra via a dedicated website, and produce a catalog of measurements and fundamental quasar properties.

Discovery of 16 New z  ∼ 5.5 Quasars: Filling in the Redshift Gap of Quasar Color Selection

Energy Technology Data Exchange (ETDEWEB)

Yang, Jinyi; Wu, Xue-Bing; Wang, Feige; Yang, Qian; Yue, Minghao; Wang, Shu; Li, Zefeng [Department of Astronomy, School of Physics, Peking University, Beijing 100871 (China); Fan, Xiaohui; Jiang, Linhua [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Bian, Fuyan [Research School of Astronomy and Astrophysics, Australian National University, Weston Creek, ACT 2611 (Australia); McGreer, Ian D.; Green, Richard; Ding, Jiani [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Yi, Weimin [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Dye, Simon [School of Physics and Astronomy, Nottingham University, University Park, Nottingham, NG7 2RD (United Kingdom); Lawrence, Andy [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh, EH9 3HJ (United Kingdom)

2017-04-01

We present initial results from the first systematic survey of luminous z  ∼ 5.5 quasars. Quasars at z ∼ 5.5, the post-reionization epoch, are crucial tools to explore the evolution of intergalactic medium, quasar evolution, and the early super-massive black hole growth. However, it has been very challenging to select quasars at redshifts 5.3 ≤ z ≤ 5.7 using conventional color selections, due to their similar optical colors to late-type stars, especially M dwarfs, resulting in a glaring redshift gap in quasar redshift distributions. We develop a new selection technique for z ∼ 5.5 quasars based on optical, near-IR, and mid-IR photometric data from Sloan Digital Sky Survey (SDSS), UKIRT InfraRed Deep Sky Surveys—Large Area Survey (ULAS), VISTA Hemisphere Survey (VHS), and Wide Field Infrared Survey Explorer . From our pilot observations in the SDSS-ULAS/VHS area, we have discovered 15 new quasars at 5.3 ≤ z ≤ 5.7 and 6 new lower redshift quasars, with SDSS z band magnitude brighter than 20.5. Including other two z ∼ 5.5 quasars already published in our previous work, we now construct a uniform quasar sample at 5.3 ≤ z ≤ 5.7, with 17 quasars in a ∼4800 square degree survey area. For further application in a larger survey area, we apply our selection pipeline to do a test selection by using the new wide field J-band photometric data from a preliminary version of the UKIRT Hemisphere Survey (UHS). We successfully discover the first UHS selected z ∼ 5.5 quasar.

OUTFLOW AND HOT DUST EMISSION IN HIGH-REDSHIFT QUASARS

International Nuclear Information System (INIS)

Wang, Huiyuan; Xing, Feijun; Wang, Tinggui; Zhou, Hongyan; Zhang, Kai; Zhang, Shaohua

2013-01-01

Correlations of hot dust emission with outflow properties are investigated, based on a large z ∼ 2 non-broad absorption line quasar sample built from the Wide-field Infrared Survey and the Sloan Digital Sky Survey data releases. We use the near-infrared slope and the infrared to UV luminosity ratio to indicate the hot dust emission relative to the emission from the accretion disk. In our luminous quasars, these hot dust emission indicators are almost independent of the fundamental parameters, such as luminosity, Eddington ratio and black hole mass, but moderately dependent on the blueshift and asymmetry index (BAI) and FWHM of C IV lines. Interestingly, the latter two correlations dramatically strengthen with increasing Eddington ratio. We suggest that, in high Eddington ratio quasars, C IV regions are dominated by outflows so the BAI and FWHM (C IV) can reliably reflect the general properties and velocity of outflows, respectively. In low Eddington ratio quasars, on the other hand, C IV lines are primarily emitted by virialized gas so the BAI and FWHM (C IV) become less sensitive to outflows. Therefore, the correlations for the highest Eddington ratio quasars are more likely to represent the true dependence of hot dust emission on outflows and the correlations for the entire sample are significantly diluted by the low Eddington ratio quasars. Our results show that an outflow with a large BAI or velocity can double the hot dust emission on average. We suggest that outflows either contain hot dust in themselves or interact with the dusty interstellar medium or torus

Radio continuum observations of the quasar-galaxy pair 3C 232-NGC 3067

International Nuclear Information System (INIS)

Haxthausen, E.; Carilli, C.; Vangorkom, J.H.

1990-01-01

The quasar-galaxy pair 3C 232-NGC 3067 is well known to show absorption by gas associated with the foreground galaxy against the background quasar (see Stocke et al. this volume). Observations by Carilli, van Gorkom, and Stocke (Nature 338, 134, 1989) found that the absorbing gas is located in a long tail of gas which extends from the galaxy toward the quasar and beyond (in projection). Though the HI observations of NGC 3067 indicate that the galaxy has been severely disturbed, there is no obvious candidate in the field which could cause such a disturbance, leading to the conclusion that the system has undergone a recent merger. The radio continuum observations of this system were designed to study the nature of this highly disturbed galaxy. New continuum observations confirm the notion that NGC 3067 is a highly disturbed system, and, in particular, the notion that the western half of the galaxy extends only 1/2 as far in radius as the eastern half. This disturbance must have occurred recently, since the galactic rotation would smooth out the observed asymmetry in about 10(exp 8) years. Researchers are left with the problem that there are no obvious candidates which could have caused such a disturbance

Discovery of a Color-selected Quasar at z = 5.50.

Science.gov (United States)

Stern; Spinrad; Eisenhardt; Bunker; Dawson; Stanford; Elston

2000-04-20

We present observations of RD J030117+002025, a quasar at z=5.50 discovered from deep, multicolor, ground-based observations covering 74 arcmin2. This is the most distant quasar or active galaxy currently known. The object was targeted as an R-band dropout, with RAB>26.3 (3 sigma limit in a 3&arcsec; diameter region), IAB=23.8, and zAB=23.4. The Keck/Low-Resolution Imaging Spectrometer spectrum shows broad Lyalpha/N v lambda1240 emission and sharp absorption decrements from the highly redshifted hydrogen forests. The fractional continuum depression due to the Lyalpha forest is DA=0.90. RD J030117+002025 is the least luminous high-redshift quasar known (MB approximately -22.7).

Seeing the Unseen: MIR Spectroscopic Constraints on Quasar Big Blue Bumps

Science.gov (United States)

Gallagher, Sarah; Hines, Dean; Leighly, Karen; Ogle, Patrick; Richards, Gordon

2008-03-01

The IRS on Spitzer offers an exciting opportunity for detailed, mid-infrared spectroscopy of z~2 quasars for the first time. This epoch, sampling the peak of the quasar luminosity evolution, is particularly important for understanding the nature of quasar activity in the most massive galaxies. We aim to use this powerful tool to constrain the shape and power of the far-ultraviolet through soft-X-ray ionizing continuum of luminous quasars. Though these so-called `big blue bumps' dominate the power of quasar spectral energy distributions, they are largely unobservable as a result of hydrogen opacity in the Universe. However, we can determine the properties of the big blue bump by studying emission lines from ions in the coronal line region that emit in the mid-infrared and are created by those same energetic and elusive photons. We propose deep, high quality IRS observations of 5 luminous quasars with a range of HeII emission properties to investigate the mid-infrared spectral region in depth and constrain the shape of the ionizing continuum in each quasar. In addition, these high S/N spectra will provide templates for interpreting lower resolution, lower S/N IRS spectra.

RESOLVED DUST EMISSION IN A QUASAR AT z = 3.65

International Nuclear Information System (INIS)

Clements, D. L.; Babbedge, T.; Rowan-Robinson, M.; Petitpas, G.; Farrah, D.; Hatziminaoglou, E.; Perez-Fournon, I.; Hernan-Caballero, Antonio; Castro-RodrIguez, Nieves; Lonsdale, C.; Surace, J.; Franceschini, A.; Wilkes, B. J.; Smith, H.

2009-01-01

We present submillimeter observations of the z= 3.653 quasar SDSS 160705+533558 together with data in the optical and infrared. The object is unusually bright in the far-IR and submillimeter with an IR luminosity of ∼10 14 L sun . We ascribe this luminosity to a combination of active galactic nucleus (AGN) and starburst emission, with the starburst forming stars at a rate of a few thousand solar masses per year. Submillimeter Array imaging observations with a resolution ∼1'' show that the submillimeter (850 μm) emission is extended on scales of 10- 35 kpc and is offset from the optical position by ∼10 kpc. This morphology is dissimilar to that found in submillimeter galaxies, which are generally unresolved or marginally resolved on arcsecond scales, or submillimeter-luminous AGNs where the AGN lies at the peak of the submillimeter or molecular emission. The simplest explanation is that the object is in the early stages of a merger between a gas-rich galaxy, which hosts the starburst, and a gas-poor AGN-host galaxy, which is responsible for the quasar emission. It is also possible that jet-induced star formation might contribute to the unusual morphology.

Space density of optically-selected type 2 quasars

OpenAIRE

Reyes, Reinabelle; Zakamska, Nadia L.; Strauss, Michael A.; Green, Joshua; Krolik, Julian H.; Shen, Yue; Richards, Gordon; Anderson, Scott; Schneider, Donald

2008-01-01

Type 2 quasars are luminous active galactic nuclei (AGN) whose central regions are obscured by large amounts of gas and dust. In this paper, we present a catalog of type 2 quasars from the Sloan Digital Sky Survey (SDSS), selected based on their optical emission lines. The catalog contains 887 objects with redshifts z < 0.83; this is six times larger than the previous version and is by far the largest sample of type 2 quasars in the literature. We derive the [OIII]5008 luminosity function for...

Fast Molecular Outflows in Luminous Galaxy Mergers: Evidence for Quasar Feedback from Herschel

Science.gov (United States)

Veilleux, S.; Melendez, M.; Sturm, E.; Garcia-Carpio, J.; Fischer, J.; Gonzalez-Alfonso, E.; Contursi, A.; Lutz, D.; Poglitsch, A.; Davies, R.;

A DEEP XMM-NEWTON OBSERVATION OF THE QUASAR 3C 287

International Nuclear Information System (INIS)

Salvesen, G.; Miller, J. M.; Cackett, E.; Siemiginowska, A.

2009-01-01

We report on an XMM-Newton observation of the z = 1.055 quasar and Gigahertz Peaked Spectrum (GPS) source 3C 287. Our 62.3 ks observation provides an exceptional X-ray view of a prominent member of this important subclass of active galactic nuclei (AGNs). The X-ray spectra of 3C 287 are consistent with a simple absorbed power law with a spectral index of Γ = 1.72 ± 0.02. Our fits imply a bolometric luminosity of L = 5.8 ± 0.2 x 10 45 erg s -1 over the 0.3-10.0 keV band; this gives a mass lower limit of M BHmin ≥ 4.6 x 10 7 M sun assuming X-rays contribute 10% of the bolometric luminosity and radiation at the Eddington limit. Iron emission lines are common in the X-ray spectra of many AGNs, but the observed spectra appear to rule out strong emission lines in 3C 287. The simple power-law spectrum and the absence of strong emission lines may support a picture where our line of sight intersects a relativistic jet. Milliarcsecond radio imaging of 3C 287 appears to support this interpretation. We discuss our results in the context of different AGNs subclasses and the possibility that GPS sources harbor newly formed black hole jets.

Image of the Quasar 3C 273 Taken by the High Energy Astronomy Observatory (HEAO)-2

Science.gov (United States)

1979-01-01

This image is an observation of Quasar 3C 273 by the High Energy Astronomy Observatory (HEAO)-2/Einstein Observatory. It reveals the presence of a new source (upper left) with a red shift that indicates that it is about 10 billion light years away. Quasars are mysterious, bright, star-like objects apparently located at the very edge of the visible universe. Although no bigger than our solar system, they radiate as much visible light as a thousand galaxies. Quasars also emit radio signals and were previously recognized as x-ray sources. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2 was designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center.

What are quasars. 3. ed.

International Nuclear Information System (INIS)

Dautcourt, G.

1982-01-01

The subject is covered under the following headings: gigantic explosions in galaxies, the puzzle of far radio sources, all records are broken, the quasar light - a messenger from the far past, the radio mantle of quasars, where do spectral lines originate, mysterious absorption, restless quasars, quasars as infrared sources, what is the gist of the matter, was Einstein wrong, when is a quasar no quasar, quasars and cosmology, youthful escapades of a galaxy, and once again the red shift

Bulk Comptonization: new hints from the luminous blazar 4C+25.05

Science.gov (United States)

Kammoun, E. S.; Nardini, E.; Risaliti, G.; Ghisellini, G.; Behar, E.; Celotti, A.

2018-01-01

Blazars are often characterized by a spectral break at soft X-rays, whose origin is still debated. While most sources show a flattening, some exhibit a blackbody-like soft excess with temperatures of the order of ∼0.1 keV, similar to low-luminosity, non-jetted Seyferts. Here, we present the analysis of the simultaneous XMM-Newton and NuSTAR observations of the luminous flat-spectrum radio quasar 4C+25.05 (z = 2.368). The observed 0.3-30 keV spectrum is best described by the sum of a hard X-ray power law (Γ = 1.38_{-0.03}^{+0.05}) and a soft component, approximated by a blackbody with kT_BB = 0.66_{-0.04}^{+0.05} keV (rest frame). If the spectrum of 4C+25.05 is interpreted in the context of bulk Comptonization by cold electrons of broad-line region photons emitted in the direction of the jet, such an unusual temperature implies a bulk Lorentz factor of the jet of Γbulk ∼ 11.7. Bulk Comptonization is expected to be ubiquitous on physical grounds, yet no clear signature of it has been found so far, possibly due to its transient nature and the lack of high-quality, broad-band X-ray spectra.

Gemini long-slit observations of luminous obscured quasars: Further evidence for an upper limit on the size of the narrow-line region

International Nuclear Information System (INIS)

Hainline, Kevin N.; Hickox, Ryan C.; Greene, Jenny E.; Myers, Adam D.; Zakamska, Nadia L.; Liu, Guilin; Liu, Xin

2014-01-01

We examine the spatial extent of the narrow-line regions (NLRs) of a sample of 30 luminous obscured quasars at 0.4 < z < 0.7 observed with spatially resolved Gemini-N GMOS long-slit spectroscopy. Using the [O III] λ5007 emission feature, we estimate the size of the NLR using a cosmology-independent measurement: the radius where the surface brightness falls to 10 –15 erg s –1 cm –2 arcsec –2 . We then explore the effects of atmospheric seeing on NLR size measurements and conclude that direct measurements of the NLR size from observed profiles are too large by 0.1-0.2 dex on average, as compared to measurements made to best-fit Sérsic or Voigt profiles convolved with the seeing. These data, which span a full order of magnitude in IR luminosity (log (L 8 μm /erg s –1 ) = 44.4-45.4), also provide strong evidence that there is a flattening of the relationship between NLR size and active galactic nucleus luminosity at a seeing-corrected size of ∼7 kpc. The objects in this sample have high luminosities which place them in a previously under-explored portion of the size-luminosity relationship. These results support the existence of a maximal size of the NLR around luminous quasars; beyond this size, there is either not enough gas or the gas is over-ionized and does not produce enough [O III] λ5007 emission.

A cosmic web filament revealed in Lyman-α emission around a luminous high-redshift quasar.

Science.gov (United States)

Cantalupo, Sebastiano; Arrigoni-Battaia, Fabrizio; Prochaska, J Xavier; Hennawi, Joseph F; Madau, Piero

2014-02-06

Simulations of structure formation in the Universe predict that galaxies are embedded in a 'cosmic web', where most baryons reside as rarefied and highly ionized gas. This material has been studied for decades in absorption against background sources, but the sparseness of these inherently one-dimensional probes preclude direct constraints on the three-dimensional morphology of the underlying web. Here we report observations of a cosmic web filament in Lyman-α emission, discovered during a survey for cosmic gas fluorescently illuminated by bright quasars at redshift z ≈ 2.3. With a linear projected size of approximately 460 physical kiloparsecs, the Lyman-α emission surrounding the radio-quiet quasar UM 287 extends well beyond the virial radius of any plausible associated dark-matter halo and therefore traces intergalactic gas. The estimated cold gas mass of the filament from the observed emission-about 10(12.0 ± 0.5)/C(1/2) solar masses, where C is the gas clumping factor-is more than ten times larger than what is typically found in cosmological simulations, suggesting that a population of intergalactic gas clumps with subkiloparsec sizes may be missing in current numerical models.

Space Density Of Optically-Selected Type II Quasars From The SDSS

Science.gov (United States)

Reyes, Reinabelle; Zakamska, N. L.; Strauss, M. A.; Green, J.; Krolik, J. H.; Shen, Y.; Richards, G. T.

2007-12-01

Type II quasars are luminous Active Galactic Nuclei (AGN) whose central regions are obscured by large amounts of gas and dust. In this poster, we present a catalog of 887 type II quasars with redshifts z<0.83 from the Sloan Digital Sky Survey (SDSS), selected based on their emission lines, and derive the 1/Vmax [OIII] 5007 luminosity function from this sample. Since some objects may not be included in the sample because they lack strong emission lines, the derived luminosity function is only a lower limit. We also derive the [OIII] 5007 luminosity function for a sample of type I (broad-line) quasars in the same redshift range. Taking [OIII] 5007 luminosity as a tracer of intrinsic luminosity in both type I and type II quasars, we obtain lower limits to the type II quasar fraction as a function of [OIII] 5007 luminosity, from L[OIII] = 108.3 to 1010 Lsun, which roughly correspond to bolometric luminosities of 1044 to 1046 erg/s.

A CONSTRAINT ON QUASAR CLUSTERING AT z = 5 FROM A BINARY QUASAR

International Nuclear Information System (INIS)

McGreer, Ian D.; Fan, Xiaohui; Eftekharzadeh, Sarah; Myers, Adam D.

2016-01-01

We report the discovery of a quasar pair at z = 5 separated by 21″. Both objects were identified as quasar candidates using simple color selection techniques applied to photometric catalogs from the Canada–France–Hawaii Telescope (CFHT) Legacy Survey (CFHTLS). Spectra obtained with the MMT present no discernible offset in redshift between the two objects; on the other hand, there are clear differences in the emission line profiles and in the multiwavelength spectral energy distributions that strongly disfavor the hypothesis that they are gravitationally lensed images of a single quasar. Both quasars are surprisingly bright given their proximity (a projected separation of ∼135 kpc), with i = 19.4 and i = 21.4. Previous measurements of the luminosity function demonstrate that luminous quasars are extremely rare at z = 5; the existence of this pair suggests that quasars have strong small-scale clustering at high redshift. Assuming a real-space correlation function of the form ξ(r) ∝ (r/r 0 ) −2 , this discovery implies a correlation length of r 0 ≳ 20h −1 Mpc, consistent with a rapid strengthening of quasar clustering at high redshift as seen in previous observations and predicted by theoretical models where feedback effects are inefficient at shutting down black hole growth at high redshift

A CONSTRAINT ON QUASAR CLUSTERING AT z = 5 FROM A BINARY QUASAR

Energy Technology Data Exchange (ETDEWEB)

McGreer, Ian D.; Fan, Xiaohui [Steward Observatory, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Eftekharzadeh, Sarah; Myers, Adam D., E-mail: imcgreer@as.arizona.edu [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States)

2016-03-15

We report the discovery of a quasar pair at z = 5 separated by 21″. Both objects were identified as quasar candidates using simple color selection techniques applied to photometric catalogs from the Canada–France–Hawaii Telescope (CFHT) Legacy Survey (CFHTLS). Spectra obtained with the MMT present no discernible offset in redshift between the two objects; on the other hand, there are clear differences in the emission line profiles and in the multiwavelength spectral energy distributions that strongly disfavor the hypothesis that they are gravitationally lensed images of a single quasar. Both quasars are surprisingly bright given their proximity (a projected separation of ∼135 kpc), with i = 19.4 and i = 21.4. Previous measurements of the luminosity function demonstrate that luminous quasars are extremely rare at z = 5; the existence of this pair suggests that quasars have strong small-scale clustering at high redshift. Assuming a real-space correlation function of the form ξ(r) ∝ (r/r{sub 0}){sup −2}, this discovery implies a correlation length of r{sub 0} ≳ 20h{sup −1} Mpc, consistent with a rapid strengthening of quasar clustering at high redshift as seen in previous observations and predicted by theoretical models where feedback effects are inefficient at shutting down black hole growth at high redshift.

MODERATE C IV ABSORBER SYSTEMS REQUIRE 1012 M☉ DARK MATTER HALOS AT z ∼ 2.3: A CROSS-CORRELATION STUDY OF C IV ABSORBER SYSTEMS AND QUASARS IN SDSS-III BOSS DR9

International Nuclear Information System (INIS)

Vikas, Shailendra; Wood-Vasey, W. Michael; Lundgren, Britt; Ross, Nicholas P.; Myers, Adam D.; AlSayyad, Yusra; York, Donald G.; Schneider, Donald P.; Brinkmann, J.; Bizyaev, Dmitry; Brewington, Howard; Malanushenko, Elena; Malanushenko, Viktor; Oravetz, Daniel; Pan, Kaike; Snedden, Stephanie; Ge, Jian; Muna, Demitri; Pâris, Isabelle; Petitjean, Patrick

2013-01-01

We measure the two-point cross-correlation function of C IV absorber systems and quasars, using spectroscopic data from the Sloan Digital Sky Survey III Baryon Oscillation Spectroscopic Survey (BOSS; Data Release 9). The 19,701 quasars and 6149 C IV ''moderate'' absorbers, 0.28 Å 2 and represent a factor of two increase in sample size over previous investigations. We find a correlation scale length and slope of the redshift-space cross-correlation function of s 0 = 8.46 ± 1.24 Mpc, γ = 1.68 ± 0.19, in the redshift-space range 10 0 = 7.76 ± 2.80 Mpc, γ = 1.74 ± 0.21. We measure the combined quasar and C IV bias to be b QSO b C I V = 8.81 ± 2.28. Using an estimate of b QSO from the quasar auto-correlation function we find b CIV = 2.38 ± 0.62. This b CIV implies that EW > 0.28 Å C IV absorbers at z ∼ 2.3 are typically found in dark matter halos that have masses ≥10 11.3 -10 13.4 M ☉ at that redshift. The complete BOSS sample will triple the number of both quasars and absorption systems and increase the power of this cross-correlation measurement by a factor of two.

On the Role of the Environments and Star Formation for Quasar Activity

International Nuclear Information System (INIS)

Bettoni, Daniela; Falomo, Renato; Kotilainen, Jari K.; Karhunen, Kalle

2017-01-01

We investigate the host galaxy and environment properties of a sample of 400 low z (<0.5) quasars that were imaged in the SDSS Stripe82. We can detect and study the properties of the host galaxy for more than 75% of the data sample. We discover that quasar are mainly hosted in luminous galaxies of absolute magnitude M * − 3 < M(R) < M *1 and that in the quasar environments the galaxy number density is comparable to that of inactive galaxies of similar luminosities. For these quasars we undertake also a study in u,g,r,i, and z SDSS bands and again we discover that the mean colors of the quasar host galaxy it is not very different with respect to the values of the sample of inactive galaxies. For a subsample of low z sources the imaging study is complemented by spectroscopy of quasar hosts and of close companion galaxies. This study suggests that the supply and cause of the nuclear activity depends only weakly on the local environment of quasars. Contrary to past suggestions, for low redshift quasar there is a very modest connection between recent star formation and the nuclear activity.

On the Role of the Environments and Star Formation for Quasar Activity

Directory of Open Access Journals (Sweden)

Daniela Bettoni

2017-11-01

Full Text Available We investigate the host galaxy and environment properties of a sample of 400 low z (<0.5 quasars that were imaged in the SDSS Stripe82. We can detect and study the properties of the host galaxy for more than 75% of the data sample. We discover that quasar are mainly hosted in luminous galaxies of absolute magnitude M* − 3 < M(R < M*1 and that in the quasar environments the galaxy number density is comparable to that of inactive galaxies of similar luminosities. For these quasars we undertake also a study in u,g,r,i, and z SDSS bands and again we discover that the mean colors of the quasar host galaxy it is not very different with respect to the values of the sample of inactive galaxies. For a subsample of low z sources the imaging study is complemented by spectroscopy of quasar hosts and of close companion galaxies. This study suggests that the supply and cause of the nuclear activity depends only weakly on the local environment of quasars. Contrary to past suggestions, for low redshift quasar there is a very modest connection between recent star formation and the nuclear activity.

On the Role of the Environments and Star Formation for Quasar Activity

Energy Technology Data Exchange (ETDEWEB)

Bettoni, Daniela; Falomo, Renato [INAF - Osservatorio Astronomico di Padova, Padua (Italy); Kotilainen, Jari K. [Finnish Centre for Astronomy with ESO (FINCA), University of Turku, Turku (Finland); Tuorla Observatory, Department of Physics and Astronomy, University of Turku, Turku (Finland); Karhunen, Kalle, E-mail: daniela.bettoni@oapd.inaf.it [Tuorla Observatory, Department of Physics and Astronomy, University of Turku, Turku (Finland)

2017-11-16

We investigate the host galaxy and environment properties of a sample of 400 low z (<0.5) quasars that were imaged in the SDSS Stripe82. We can detect and study the properties of the host galaxy for more than 75% of the data sample. We discover that quasar are mainly hosted in luminous galaxies of absolute magnitude M{sup *} − 3 < M(R) < M{sup *1} and that in the quasar environments the galaxy number density is comparable to that of inactive galaxies of similar luminosities. For these quasars we undertake also a study in u,g,r,i, and z SDSS bands and again we discover that the mean colors of the quasar host galaxy it is not very different with respect to the values of the sample of inactive galaxies. For a subsample of low z sources the imaging study is complemented by spectroscopy of quasar hosts and of close companion galaxies. This study suggests that the supply and cause of the nuclear activity depends only weakly on the local environment of quasars. Contrary to past suggestions, for low redshift quasar there is a very modest connection between recent star formation and the nuclear activity.

A cosmic double helix in the archetypical quasar 3C273.

Science.gov (United States)

Lobanov, A P; Zensus, J A

2001-10-05

Finding direct evidence for plasma instability in extragalactic jets is crucial for understanding the nature of relativistic outflows from active galactic nuclei. Our radio interferometric observations of the quasar 3C273 made with the orbiting radio telescope, HALCA, and an array of ground telescopes have yielded an image in which the emission across the jet is resolved, revealing two threadlike patterns that form a double helix inside the jet. This double helical structure is consistent with a Kelvin-Helmholtz instability, and at least five different instability modes can be identified and modeled by a light jet with a Lorentz factor of 2 and Mach number of 3.5. The model reproduces in detail the internal structure of the jet on scales of up to 30 milli-arc seconds ( approximately 300 parsecs) and is consistent with the general morphology of the jet on scales of up to 1 kiloparsec.

Rapid infrared and optical variability in the bright quasar 3C273

International Nuclear Information System (INIS)

Courvoisier, T.J.-L.; Robson, E.I.; Hughes, D.H.; Bouchet, P.; Schwarz, H.E.; Krisciunas, K.

1988-01-01

We have observed variations by a factor of two in the infrared flux from the bright quasar 3C273 on a timescale as short as one day. In February 1988, the behaviour of the source changed from having a stable infrared flux and slow optical variations to a state characterized by recurrent infrared and optical flaring. The optical variations were of several per cent per day, changing from increase to decrease approximately every week. The amplitude of the repeated optical flares was 30-40%. The data are consistent with re-injection/acceleration of electrons followed by rapid cooling. The inferred magnetic field is 0.7 gauss and the data are marginally consistent with no relativistic beaming. (author)

Weak Hard X-Ray Emission from Broad Absorption Line Quasars: Evidence for Intrinsic X-Ray Weakness

DEFF Research Database (Denmark)

Luo, B.; Brandt, W. N.; Alexander, D. M.

2014-01-01

We report NuSTAR observations of a sample of six X-ray weak broad absorption line (BAL) quasars. These targets, at z = 0.148-1.223, are among the optically brightest and most luminous BAL quasars known at z 330 times weaker than...... expected for typical quasars. Our results from a pilot NuSTAR study of two low-redshift BAL quasars, a Chandra stacking analysis of a sample of high-redshift BAL quasars, and a NuSTAR spectral analysis of the local BAL quasar Mrk 231 have already suggested the existence of intrinsically X-ray weak BAL...... quasars, i.e., quasars not emitting X-rays at the level expected from their optical/UV emission. The aim of the current program is to extend the search for such extraordinary objects. Three of the six new targets are weakly detected by NuSTAR with ≲ 45 counts in the 3-24 keV band, and the other three...

THE MOST LUMINOUS GALAXIES DISCOVERED BY WISE

Energy Technology Data Exchange (ETDEWEB)

Tsai, Chao-Wei; Eisenhardt, Peter R. M.; Stern, Daniel; Moustakas, Leonidas A. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Dr., Pasadena, CA 91109 (United States); Wu, Jingwen; Wright, Edward L. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States); Assef, Roberto J. [Núcleo de Astronomía de la Facultad deIngeniería, Universidad Diego Portales, Av. Ejército Libertador 441, Santiago (Chile); Blain, Andrew W. [Department of Physics and Astronomy, University of Leicester, 1 University Road, Leicester, LE1 7RH (United Kingdom); Bridge, Carrie R.; Sayers, Jack [Division of Physics, Math, and Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Benford, Dominic J.; Leisawitz, David T. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Cutri, Roc M.; Masci, Frank J.; Yan, Lin [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Griffith, Roger L. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Jarrett, Thomas H. [Astronomy Department, University of Cape Town, Private Bag X3, Rondebosch 7701 (South Africa); Lonsdale, Carol J. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Petty, Sara M. [Department of Physics, Virginia Tech, Blacksburg, VA 24061 (United States); Stanford, S. Adam, E-mail: Chao-Wei.Tsai@jpl.nasa.gov [Department of Physics, University of California Davis, One Shields Avenue, Davis, CA 95616 (United States); and others

2015-06-01

We present 20 Wide-field Infrared Survey Explorer (WISE)-selected galaxies with bolometric luminosities L{sub bol} > 10{sup 14} L{sub ☉}, including five with infrared luminosities L{sub IR} ≡ L{sub (rest} {sub 8–1000} {sub μm)} > 10{sup 14} L{sub ☉}. These “extremely luminous infrared galaxies,” or ELIRGs, were discovered using the “W1W2-dropout” selection criteria which requires marginal or non-detections at 3.4 and 4.6 μm (W1 and W2, respectively) but strong detections at 12 and 22 μm in the WISE survey. Their spectral energy distributions are dominated by emission at rest-frame 4–10 μm, suggesting that hot dust with T{sub d} ∼ 450 K is responsible for the high luminosities. These galaxies are likely powered by highly obscured active galactic nuclei (AGNs), and there is no evidence suggesting these systems are beamed or lensed. We compare this WISE-selected sample with 116 optically selected quasars that reach the same L{sub bol} level, corresponding to the most luminous unobscured quasars in the literature. We find that the rest-frame 5.8 and 7.8 μm luminosities of the WISE-selected ELIRGs can be 30%–80% higher than that of the unobscured quasars. The existence of AGNs with L{sub bol} > 10{sup 14} L{sub ☉} at z > 3 suggests that these supermassive black holes are born with large mass, or have very rapid mass assembly. For black hole seed masses ∼10{sup 3} M{sub ☉}, either sustained super-Eddington accretion is needed, or the radiative efficiency must be <15%, implying a black hole with slow spin, possibly due to chaotic accretion.

Quasars Probing Quasars: the Circumgalactic Medium Surrounding z ~ 2 Quasars

Science.gov (United States)

Lau, Marie; Quasars Probing Quasars survey

2018-01-01

Understanding the circumgalactic medium--the gaseous halo surrounding a galaxy, is an integral part to understanding galaxy evolution. The z ~ 2-3 universe is interesting as this is when the star formation rate and AGN activity peak. My thesis concludes the decade-long Quasars Probing Quasars survey designed for studying massive galaxy formation and quasar feedback. I use background quasar sightlines that pass close to foreground quasars to study the circumgalactic medium of quasar-host galaxies in absorption. My sample of 149 quasar pairs involve spectra taken with 17 different optical and near IR instruments. I present results on the statistical and physical properties of the circumgalactic medium. The circumgalactic medium is enriched even beyond the virial radius. The alpha/Fe abundance ratio is enhanced, suggesting enrichment from core-collapse supernovae. The cool gas mass within the virial radius is enough to fuel star formation for another Gyr, and may account for 1/3 of the baryonic budget of the galaxy halo. The ionization state increases with projected distance from the quasar, which implies the quasar does not dominate the ionizing radiation flux. However, detection of fluorescent Lyman-alpha emission and NV absorption imply these transverse absorbers are partially illuminated by the quasar. In one peculiar case, the absorbing clump has density >100 cm^-3 and sub-parsec size. The average absorption in the circumgalactic medium exhibits large velocity widths, and is asymmetric about the systemic redshift of the galaxies. The widths are consistent with gravitational motions and Hubble flow, and outflows are not required to explain them. The asymmetry can be explained if the ionizing radiation from the quasar is anisotropic or intermittent and the gas is not in inflow. My results pose challenges for cosmological hydrodynamic simulations to produce a substantial cool gas reservoir surrounding quasars, that is also enriched and shows extreme kinematics.

BINARY QUASARS AT HIGH REDSHIFT. I. 24 NEW QUASAR PAIRS AT z ∼ 3-4

International Nuclear Information System (INIS)

Hennawi, Joseph F.; Myers, Adam D.; Shen, Yue; Strauss, Michael A.; Djorgovski, S. G.; Glikman, Eilat; Mahabal, Ashish; Fan Xiaohui; Martin, Crystal L.; Richards, Gordon T.; Schneider, Donald P.; Shankar, Francesco

2010-01-01

The clustering of quasars on small scales yields fundamental constraints on models of quasar evolution and the buildup of supermassive black holes. This paper describes the first systematic survey to discover high-redshift binary quasars. Using color-selection and photometric redshift techniques, we searched 8142 deg 2 of Sloan Digital Sky Survey imaging data for binary quasar candidates, and confirmed them with follow-up spectroscopy. Our sample of 27 high-redshift binaries (24 of them new discoveries) at redshifts 2.9 perpendicular perpendicular 3.5. The completeness and efficiency of our well-defined selection algorithm are quantified using simulated photometry and we find that our sample is ∼50% complete. Our companion paper uses this knowledge to make the first measurement of the small-scale clustering (R -1 Mpc comoving) of high-redshift quasars. High-redshift binaries constitute exponentially rare coincidences of two extreme (M ∼> 10 9 M sun ) supermassive black holes. At z ∼ 4, there is about one close binary per 10 Gpc 3 , thus these could be the highest sigma peaks, the analogs of superclusters, in the early universe.

Discovery of a Color-selected Quasar at Z = 5.50

Science.gov (United States)

Stern, Daniel; Spinrad, Hyron; Eisenhardt, Peter; Bunker, Andrew J.; Dawson, Steve; Stanford, S. A.; Elston, Richard

2000-04-01

We present observations of RD J030117+002025, a quasar at z=5.50 discovered from deep, multicolor, ground-based observations covering 74 arcmin2. This is the most distant quasar or active galaxy currently known. The object was targeted as an R-band dropout, with RAB>26.3 (3 σ limit in a 3" diameter region), IAB=23.8, and zAB=23.4. The Keck/Low-Resolution Imaging Spectrometer spectrum shows broad Lyα/N V λ1240 emission and sharp absorption decrements from the highly redshifted hydrogen forests. The fractional continuum depression due to the Lyα forest is DA=0.90. RD J030117+002025 is the least luminous high-redshift quasar known (MB~-22.7). Based on observations at the W. M. Keck Observatory, Kitt Peak National Observatory, and Palomar Observatory. Keck Observatory is operated as a scientific partnership among the University of California, the California Institute of Technology, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

Does the X-ray outflow quasar PDS 456 have a UV outflow at 0.3c?

Science.gov (United States)

Hamann, Fred; Chartas, George; Reeves, James; Nardini, Emanuele

2018-05-01

The quasar PDS 456 (at redshift ˜0.184) has a prototype ultra-fast outflow (UFO) measured in X-rays. This outflow is highly ionized with relativistic speeds, large total column densities log NH(cm-2) > 23, and large kinetic energies that could be important for feedback to the host galaxy. A UV spectrum of PDS 456 obtained with the Hubble Space Telescope in 2000 contains one well-measured broad absorption line (BAL) at ˜1346 Å (observed) that might be Ly α at v ≈ 0.06c or N V λ1240 at v ≈ 0.08c. However, we use photoionization models and comparisons to other outflow quasars to show that these BAL identifications are problematic because other lines that should accompany them are not detected. We argue that the UV BAL is probably C IV at v ≈ 0.30c. This would be the fastest UV outflow ever reported, but its speed is similar to the X-ray outflow and its appearance overall is similar to relativistic UV BALs observed in other quasars. The C IV BAL identification is also supported indirectly by the tentative detection of another broad C IV line at v ≈ 0.19c. The high speeds suggest that the UV outflow originates with the X-ray UFO crudely 20-30 rg from the central black hole. We speculate that the C IV BAL might form in dense clumps embedded in the X-ray UFO, requiring density enhancements of only ≳0.4 dex compared to clumpy structures already inferred for the soft X-ray absorber in PDS 456. The C IV BAL might therefore be the first detection of low-ionization clumps proposed previously to boost the opacities in UFOs for radiative driving.

QUASARS PROBING QUASARS. VIII. THE PHYSICAL PROPERTIES OF THE COOL CIRCUMGALACTIC MEDIUM SURROUNDING z ∼ 2–3 MASSIVE GALAXIES HOSTING QUASARS

Energy Technology Data Exchange (ETDEWEB)

Lau, Marie Wingyee; Prochaska, J. Xavier [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Hennawi, Joseph F., E-mail: lwymarie@ucolick.org [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69115 Heidelberg (Germany)

2016-10-01

We characterize the physical properties of the cool T  ∼ 10{sup 4} K circumgalactic medium (CGM) surrounding z  ∼ 2–3 quasar host galaxies, which are predicted to evolve into present-day massive ellipticals. Using a statistical sample of 14 quasar pairs with projected separation <300 kpc and spectra of high dispersion and high signal-to-noise ratio, we find extreme kinematics with low metal ion lines typically spanning ≈500 km s{sup −1}, exceeding any previously studied galactic population. The CGM is significantly enriched, even beyond the virial radius, with a median metallicity [M/H] ≈ −0.6. The α /Fe abundance ratio is enhanced, suggesting that halo gas is primarily enriched by core-collapse supernovae. The projected cool gas mass within the virial radius is estimated to be 1.9 × 10{sup 11} M {sub ⊙} ( R {sub ⊥}/160 kpc){sup 2}, accounting for ≈1/3 of the baryonic budget of the galaxy halo. The ionization state of CGM gas increases with projected distance from the foreground quasars, contrary to expectation if the quasar dominates the ionizing radiation flux. However, we also found peculiarities not exhibited in the CGM of other galaxy populations. In one absorption system, we may be detecting unresolved fluorescent Ly α emission, and another system shows strong N v lines. Taken together, these anomalies suggest that transverse sightlines are—at least in some cases—possibly illuminated. We also discovered a peculiar case where detection of the C ii fine-structure line implies an electron density >100 cm{sup −3} and sub-parsec-scale gas clumps.

Multifrequency observation of the optically violent variable quasar 3C 446

International Nuclear Information System (INIS)

Bregman, J.N.; Glassgold, A.E.; Huggins, P.J.; Kinney, A.L.; Mchardy, I.

1988-01-01

Nearly 20 years of optical and radio monitoring data as well as seven multifrequency spectra of the violently variable quasar 3C 446 are reported. The monitoring data suggest a correlation between the radio and optical outbursts, with the optical flare preceding the radio activity by 400-600 days. Considerable processing occurs in the optical-emitting plasma before it becomes radio-emitting plasma. Within the radio band, outbursts proceed from high to low frequencies. The flat radio spectrum turns over at 3-10 x 10 to the 11th Hz and the continuum steepens with frequency. The X-ray emission lies an order of magnitude above an extrapolation of the optical-UV spectrum and has a harder spectrum. The power is primarily concentrated in the submillimeter and infrared region. The data suggest that the X-rays are produced by the inverse Compton process from an emitting region smaller than but related to the synchrotron-emitting UV-IR region. The characteristic size of the emitting region increases with decreasing frequency. 36 references

MODERATE C IV ABSORBER SYSTEMS REQUIRE 10{sup 12} M{sub Sun} DARK MATTER HALOS AT z {approx} 2.3: A CROSS-CORRELATION STUDY OF C IV ABSORBER SYSTEMS AND QUASARS IN SDSS-III BOSS DR9

Energy Technology Data Exchange (ETDEWEB)

Vikas, Shailendra; Wood-Vasey, W. Michael [Pittsburgh Particle Physics, Astrophysics, and Cosmology Center (PITT PACC), Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Lundgren, Britt [Department of Physics, Yale University, New Haven, CT 06511 (United States); Ross, Nicholas P. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 92420 (United States); Myers, Adam D. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); AlSayyad, Yusra [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); York, Donald G. [Department of Astronomy, University of Chicago, 5640 S. Ellis Ave, Chicago, IL 60637 (United States); Schneider, Donald P. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Brinkmann, J.; Bizyaev, Dmitry; Brewington, Howard; Malanushenko, Elena; Malanushenko, Viktor; Oravetz, Daniel; Pan, Kaike; Snedden, Stephanie [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349-0059 (United States); Ge, Jian [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Muna, Demitri [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States); Paris, Isabelle; Petitjean, Patrick, E-mail: skv4@pitt.edu [UPMC-CNRS, UMR7095, Institut d' Astrophysique de Paris, F-75014 Paris (France); and others

2013-05-01

We measure the two-point cross-correlation function of C IV absorber systems and quasars, using spectroscopic data from the Sloan Digital Sky Survey III Baryon Oscillation Spectroscopic Survey (BOSS; Data Release 9). The 19,701 quasars and 6149 C IV ''moderate'' absorbers, 0.28 A < rest-frame equivalent width (EW) < 5 A, in our study cover a redshift range of 2.1 < z < 2.5 over 3300 deg{sup 2} and represent a factor of two increase in sample size over previous investigations. We find a correlation scale length and slope of the redshift-space cross-correlation function of s{sub 0} = 8.46 {+-} 1.24 Mpc, {gamma} = 1.68 {+-} 0.19, in the redshift-space range 10 < s < 100 Mpc. We find a projected cross-correlation function of C IV absorption systems and quasars of r{sub 0} = 7.76 {+-} 2.80 Mpc, {gamma} = 1.74 {+-} 0.21. We measure the combined quasar and C IV bias to be b{sub QSO} b{sub C{sub IV}} = 8.81 {+-} 2.28. Using an estimate of b{sub QSO} from the quasar auto-correlation function we find b{sub CIV} = 2.38 {+-} 0.62. This b{sub CIV} implies that EW > 0.28 A C IV absorbers at z {approx} 2.3 are typically found in dark matter halos that have masses {>=}10{sup 11.3}-10{sup 13.4} M{sub Sun} at that redshift. The complete BOSS sample will triple the number of both quasars and absorption systems and increase the power of this cross-correlation measurement by a factor of two.

How Quasar Feedback May Shape the Co-evolutionary Paths

Energy Technology Data Exchange (ETDEWEB)

Ishibashi, Wako, E-mail: wako.ishibashi@physik.uzh.ch [Physik-Institut, University of Zurich, Zürich (Switzerland)

2017-10-17

Observations point toward some form of “co-evolutionary sequence,” from dust-enshrouded starbursts to luminous unobscured quasars. Active galactic nucleus (AGN) feedback is generally invoked to expel the obscuring dusty gas in a blow-out event, eventually revealing the hidden central quasar. However, the physical mechanism driving AGN feedback, either due to winds or radiation, remains uncertain and is still a source of much debate. We consider quasar feedback, based on radiation pressure on dust, which directly acts on the obscuring dusty gas. We show that AGN radiative feedback is capable of efficiently removing the obscuring cocoon, and driving powerful outflows on galactic scales, consistent with recent observations. I will discuss how such quasar feedback may provide a natural physical interpretation of the observed evolutionary path, and the physical implications in the broader context of black hole-host galaxy co-evolution.

A very bright (i = 16.44) quasar in the 'redshift desert' discovered by the Guoshoujing Telescope (LAMOST)

International Nuclear Information System (INIS)

Wu Xuebing; Chen Zhaoyu; Jia Zhendong; Zuo Wenwen; Zhao Yongheng; Luo Ali; Bai Zhongrui; Chen Jianjun; Zhang Haotong; Yan Hongliang; Ren Juanjuan; Sun Shiwei; Wu Hong; Zhang Yong; Li Yeping; Lu Qishuai; Wang You; Ni Jijun; Wang Hai; Kong Xu

2010-01-01

The redshift range from 2.2 to 3 is known as the 'redshift desert' of quasars because quasars with redshifts in this range have similar optical colors as normal stars and are thus difficult to find in optical sky surveys. A quasar candidate, SDSS J085543.40-001517.7, which was selected by a recently proposed criterion involving near-IR Y - K and optical g - z colors, was identified spectroscopically as a new quasar with a redshift of 2.427 by the Guoshoujing Telescope (LAMOST) commissioning observation in 2009 December and confirmed by the observation made with the NAOC/Xinglong 2.16 m telescope in 2010 March. This quasar was not identified in the SDSS spectroscopic survey. Comparing with other SDSS quasars, we found that this new quasar, with an i magnitude of 16.44, is apparently the brightest one in the redshift range from 2.3 to 2.7. From its spectral properties, we derived its central black hole mass to be (1.4 ∼ 3.9) x 10 10 M o-dot and its bolometric luminosity to be 3.7 x 10 48 erg s -1 , which indicates that this new quasar is intrinsically very bright and belongs to the class of the most luminous quasars in the universe. Our identification supports the notion that quasars in the redshift desert can be found by the quasar selection criterion involving the near-IR colors. More missing quasars are expected to be uncovered by future LAMOST spectroscopic surveys, which is important to the study of the cosmological evolution of quasars at redshifts higher than 2.2. (research papers)

Rest-frame optical photometry of a z-7.54 quasar and its environment

Science.gov (United States)

Decarli, Roberto; Banados, Eduardo; Fan, Xiaohui; Walter, Fabian; Venemans, Bram; Paolo, Emanuele; Mazzucchelli, Chiara; Wang, Feige; Stern, Daniel

2017-10-01

Bright quasars are unique tools to study the dawn of galaxy and black hole formation, and to investigate the properties of the universe at the earliest cosmic epochs. We recently discovered the luminous quasar ULAS J1342+0928 at a record-breaking redshift of z=7.54 (whereas the previous quasar redshift record holder was at z=7.08). The presence of a damping wing in the quasar's spectrum, associated with a highly neutral intergalactic medium, and the high bolometric luminosity, powered by accretion on a supermassive, 8e8 Msun black hole, set unparalleled constraints on the history of reionization and on the formation and evolution of first massive black holes, only 690 Myr after the Big Bang. Here we propose to obtain sensitive Spitzer observations to sample the rest-frame optical emission of this quasar and of potential bright companion galaxies. By complementing our already secured observations with HST, IRAM/NOEMA, ALMA, and many other facilities, the proposed dataset will allow us (1) to constrain the Spectral Energy Distribution of the quasar, thus disentangling the contribution of its various components at optical wavelengths; (2) to investigate the quasar environment; and (3) to lay the foundation for high-resolution imaging and sensitive spectroscopy at MIR wavelengths with the James Webb Space Telescope.

High-z X-ray Obscured Quasars in Galaxies with Extreme Mid-IR/Optical Colors

Science.gov (United States)

Piconcelli, E.; Lanzuisi, G.; Fiore, F.; Feruglio, C.; Vignali, C.; Salvato, M.; Grappioni, C.

2009-05-01

Extreme Optical/Mid-IR color cuts have been used to uncover a population of dust-enshrouded, mid-IR luminous galaxies at high redshifts. Several lines of evidence point towards the presence of an heavily absorbed, possibly Compton-thick quasar at the heart of these systems. Nonetheless, the X-ray spectral properties of these intriguing sources still remain largely unexplored. Here we present an X-ray spectroscopic study of a large sample of 44 extreme dust-obscured galaxies (EDOGs) with F24 μm/FR>2000 and F24 μm>1.3 mJy selected from a 6 deg2 region in the SWIRE fields. The application of our selection criteria to a wide area survey has been capable of unveiling a population of X-ray luminous, absorbed z>1 quasars which is mostly missed in the traditional optical/X-ray surveys performed so far. Advances in the understanding of the X-ray properties of these recently-discovered sources by Simbol-X observations will be also discussed.

Unseen Progenitors of Luminous High- z Quasars in the R {sub h} = ct Universe

Energy Technology Data Exchange (ETDEWEB)

Fatuzzo, Marco [Physics Department, Xavier University, Cincinnati, OH 45207 (United States); Melia, Fulvio, E-mail: fatuzzo@xavier.edu, E-mail: fmelia@email.arizona.edu [Department of Physics, The Applied Math Program, and Department of Astronomy, The University of Arizona, AZ 85721 (United States)

2017-09-10

Quasars at high redshift provide direct information on the mass growth of supermassive black holes (SMBHs) and, in turn, yield important clues about how the universe evolved since the first (Pop III) stars started forming. Yet even basic questions regarding the seeds of these objects and their growth mechanism remain unanswered. The anticipated launch of eROSITA and ATHENA is expected to facilitate observations of high-redshift quasars needed to resolve these issues. In this paper, we compare accretion-based SMBH growth in the concordance ΛCDM model with that in the alternative Friedmann–Robertson–Walker cosmology known as the R {sub h} = ct universe. Previous work has shown that the timeline predicted by the latter can account for the origin and growth of the ≳10{sup 9} M {sub ⊙} highest redshift quasars better than that of the standard model. Here, we significantly advance this comparison by determining the soft X-ray flux that would be observed for Eddington-limited accretion growth as a function of redshift in both cosmologies. Our results indicate that a clear difference emerges between the two in terms of the number of detectable quasars at redshift z ≳ 7, raising the expectation that the next decade will provide the observational data needed to discriminate between these two models based on the number of detected high-redshift quasar progenitors. For example, while the upcoming ATHENA mission is expected to detect ∼0.16 (i.e., essentially zero) quasars at z ∼ 7 in R {sub h} = ct , it should detect ∼160 in ΛCDM—a quantitatively compelling difference.

The Frequency of Intrinsic X-Ray Weakness among Broad Absorption Line Quasars

Science.gov (United States)

Liu, Hezhen; Luo, B.; Brandt, W. N.; Gallagher, S. C.; Garmire, G. P.

2018-06-01

We present combined ≈14–37 ks Chandra observations of seven z = 1.6–2.7 broad absorption line (BAL) quasars selected from the Large Bright Quasar Survey (LBQS). These seven objects are high-ionization BAL (HiBAL) quasars, and they were undetected in the Chandra hard band (2–8 keV) in previous observations. The stacking analyses of previous Chandra observations suggested that these seven objects likely contain some candidates for intrinsically X-ray weak BAL quasars. With the new Chandra observations, six targets are detected. We calculate their effective power-law photon indices and hard-band flux weakness, and find that two objects, LBQS 1203+1530 and LBQS 1442–0011, show soft/steep spectral shapes ({{{Γ }}}eff}={2.2}-0.9+0.9 and {1.9}-0.8+0.9) and significant X-ray weakness in the hard band (by factors of ≈15 and 12). We conclude that the two HiBAL quasars are good candidates for intrinsically X-ray weak BAL quasars. The mid-infrared-to-ultraviolet spectral energy distributions of the two candidates are consistent with those of typical quasars. We constrain the fraction of intrinsically X-ray weak active galactic nuclei (AGNs) among HiBAL quasars to be ≈7%–10% (2/29–3/29), and we estimate it is ≈6%–23% (2/35–8/35) among the general BAL quasar population. Such a fraction is considerably larger than that among non-BAL quasars, and we suggest that intrinsically X-ray weak quasars are preferentially observed as BAL quasars. Intrinsically X-ray weak AGNs likely comprise a small minority of the luminous type 1 AGN population, and they should not affect significantly the completeness of these AGNs found in deep X-ray surveys.

Quasar Massive Ionized Outflows Traced by CIV λ1549 and [OIII]λλ4959,5007

Energy Technology Data Exchange (ETDEWEB)

Marziani, Paola [National Institute for Astrophysics, Osservatorio Astronomico di Padova, Rome (Italy); Negrete, C. Alenka; Dultzin, Deborah [Instituto de Astronomía, Universidad Nacional Autonoma de Mexico, Mexico City (Mexico); Martínez-Aldama, Mary L.; Del Olmo, Ascensión [Instituto de Astrofísica de Andalucía (CSIC), Granada (Spain); D' Onofrio, Mauro [Dipartimento di Fisica e Astronomia, Università di Padova, Padova (Italy); Stirpe, Giovanna M., E-mail: paola.marziani@oapd.inaf.it [Osservatorio Astronomico di Bologna (INAF), Bologna (Italy)

2017-09-27

The most luminous quasars (with bolometric luminosities are ≳ 10{sup 47} erg/s) show a high prevalence of CIV λ1549 and [OIII]λλ4959,5007 emission line profiles with strong blueshifts. Blueshifts are interpreted as due to Doppler effect and selective obscuration, and indicate outflows occurring over a wide range of spatial scales. We found evidence in favor of the nuclear origin of the outflows diagnosed by [OIII]λλ4959,5007. The ionized gas mass, kinetic power, and mechanical thrust are extremely high, and suggest widespread feedback effects on the host galaxies of very luminous quasars, at cosmic epochs between 2 and 6 Gyr from the Big Bang. In this mini-review we summarize results obtained by our group and reported in several major papers in the last few years with an eye on challenging aspects of quantifying feedback effects in large samples of quasars.

Quasar Massive Ionized Outflows Traced by CIV λ1549 and [OIII]λλ4959,5007

Directory of Open Access Journals (Sweden)

Paola Marziani

2017-09-01

Full Text Available The most luminous quasars (with bolometric luminosities are ≳ 1047 erg/s show a high prevalence of CIV λ1549 and [OIII]λλ4959,5007 emission line profiles with strong blueshifts. Blueshifts are interpreted as due to Doppler effect and selective obscuration, and indicate outflows occurring over a wide range of spatial scales. We found evidence in favor of the nuclear origin of the outflows diagnosed by [OIII]λλ4959,5007. The ionized gas mass, kinetic power, and mechanical thrust are extremely high, and suggest widespread feedback effects on the host galaxies of very luminous quasars, at cosmic epochs between 2 and 6 Gyr from the Big Bang. In this mini-review we summarize results obtained by our group and reported in several major papers in the last few years with an eye on challenging aspects of quantifying feedback effects in large samples of quasars.

MICROLENSING OF QUASAR BROAD EMISSION LINES: CONSTRAINTS ON BROAD LINE REGION SIZE

Energy Technology Data Exchange (ETDEWEB)

Guerras, E.; Mediavilla, E. [Instituto de Astrofisica de Canarias, Via Lactea S/N, La Laguna E-38200, Tenerife (Spain); Jimenez-Vicente, J. [Departamento de Fisica Teorica y del Cosmos, Universidad de Granada, Campus de Fuentenueva, E-18071 Granada (Spain); Kochanek, C. S. [Department of Astronomy and the Center for Cosmology and Astroparticle Physics, The Ohio State University, 4055 McPherson Lab, 140 West 18th Avenue, Columbus, OH 43221 (United States); Munoz, J. A. [Departamento de Astronomia y Astrofisica, Universidad de Valencia, E-46100 Burjassot, Valencia (Spain); Falco, E. [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Motta, V. [Departamento de Fisica y Astronomia, Universidad de Valparaiso, Avda. Gran Bretana 1111, Valparaiso (Chile)

2013-02-20

We measure the differential microlensing of the broad emission lines between 18 quasar image pairs in 16 gravitational lenses. We find that the broad emission lines are in general weakly microlensed. The results show, at a modest level of confidence (1.8{sigma}), that high ionization lines such as C IV are more strongly microlensed than low ionization lines such as H{beta}, indicating that the high ionization line emission regions are more compact. If we statistically model the distribution of microlensing magnifications, we obtain estimates for the broad line region size of r{sub s} = 24{sup +22} {sub -15} and r{sub s} = 55{sup +150} {sub -35} lt-day (90% confidence) for the high and low ionization lines, respectively. When the samples are divided into higher and lower luminosity quasars, we find that the line emission regions of more luminous quasars are larger, with a slope consistent with the expected scaling from photoionization models. Our estimates also agree well with the results from local reveberation mapping studies.

3C 254: the alignment effect and unification schemes

Science.gov (United States)

Bremer, M. N.

1997-01-01

3C 254 is a radio-loud quasar at z=0.734. Optical line and continuum emission from the underlying galaxy is clearly extended and aligned with the radio axis; the object shows the so-called `alignment effect' which is often seen in powerful radio galaxies. This is the clearest case yet of the continuum alignment effect in a radio-loud quasar. The object is one of the most lobe-dominated 3C quasars; the significance of the aligned emission in this source is discussed in terms of orientation-based unification schemes for radio-loud quasars and radio galaxies. 3C 254 is a very asymmetric radio source and it is shown that the radio structure on the side with the shortest nucleus-hotspot distance is interacting with the emission-line gas surrounding the quasar. It is also shown that the quasar is surrounded by an overdensity of faint objects, consistent with a cluster or group of galaxies around the object.

Cadmium-109 uptake by tumors derived from Balb C/3T3 cell lines with varying degrees of the transformed phenotype

International Nuclear Information System (INIS)

Morton, K.; Alazraki, N.; Winge, D.; Lynch, R.E.

1986-01-01

To determine if tumors are rich in metallothionein, the authors measured the vivo uptake of subcutaneously-injected carrier-free cadmium-109 in tumors and in normal tissues of Balb/C mice. The tumors were grown in the mice from cultured Balb/3T3 cells transformed by the Moloney murine sarcoma virus. Uptake of cadmium-109 per gram of tissue was greatest for liver, kidney, and spleen. However, tumor uptake of cadmium-109 was markedly greater than that in blood, skeletal muscle, bones, intestine or adipose tissue. B Sephadex G-75 chromatography, the radioactivity in tumor and in liver lysates eluted with cytochrome-C, a molecule similar in molecular weight to metal-lothionein. To determine if metallothionein levels are related to the degree of malignancy of tumors, cadmium-109 uptake in the tumors from the virally-transformed cells was compared to that in tumors from non-transformed Balb/3T3 cells and two derivative chemically transformed cell lines. There was strong correlation between the substrate-independent growth in soft agarose of the four cell lines, the rate of growth of the corresponding tumors, and the amount of cadmium-109 uptake in the tumors. The authors conclude that metallothionein levels may be elevated in tumors as a function of the degree of expression of the transformed phenotype

Unusual broad-line Mg II emitters among luminous galaxies in the baryon oscillation spectroscopic survey

International Nuclear Information System (INIS)

Roig, Benjamin; Blanton, Michael R.; Ross, Nicholas P.

2014-01-01

Many classes of active galactic nuclei (AGNs) have been observed and recorded since the discovery of Seyfert galaxies. In this paper, we examine the sample of luminous galaxies in the Baryon Oscillation Spectroscopic Survey. We find a potentially new observational class of AGNs, one with strong and broad Mg II λ2799 line emission, but very weak emission in other normal indicators of AGN activity, such as the broad-line Hα, Hβ, and the near-ultraviolet AGN continuum, leading to an extreme ratio of broad Hα/Mg II flux relative to normal quasars. Meanwhile, these objects' narrow-line flux ratios reveal AGN narrow-line regions with levels of activity consistent with the Mg II fluxes and in agreement with that of normal quasars. These AGN may represent an extreme case of the Baldwin effect, with very low continuum and high equivalent width relative to typical quasars, but their ratio of broad Mg II to broad Balmer emission remains very unusual. They may also be representative of a class of AGN where the central engine is observed indirectly with scattered light. These galaxies represent a small fraction of the total population of luminous galaxies (≅ 0.1%), but are more likely (about 3.5 times) to have AGN-like nuclear line emission properties than other luminous galaxies. Because Mg II is usually inaccessible for the population of nearby galaxies, there may exist a related population of broad-line Mg II emitters in the local universe which is currently classified as narrow-line emitters (Seyfert 2 galaxies) or low ionization nuclear emission-line regions.

OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

International Nuclear Information System (INIS)

Fan, J. H.; Liu, Y.; Yuan, Y. H.; Kurtanidze, O.; Chanishvili, R.; Richter, G. M.

2014-01-01

Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works

OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

Energy Technology Data Exchange (ETDEWEB)

Fan, J. H.; Liu, Y.; Yuan, Y. H. [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China); Kurtanidze, O.; Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Richter, G. M. [Astrophysikalisches Institut Potsdam, An der Sternwarte 16, D-14482 Potsdam (Germany)

2014-08-01

Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works.

The Identification of Z-dropouts in Pan-STARRS1: Three Quasars at 6.5< z< 6.7

Science.gov (United States)

Venemans, B. P.; Bañados, E.; Decarli, R.; Farina, E. P.; Walter, F.; Chambers, K. C.; Fan, X.; Rix, H.-W.; Schlafly, E.; McMahon, R. G.; Simcoe, R.; Stern, D.; Burgett, W. S.; Draper, P. W.; Flewelling, H.; Hodapp, K. W.; Kaiser, N.; Magnier, E. A.; Metcalfe, N.; Morgan, J. S.; Price, P. A.; Tonry, J. L.; Waters, C.; AlSayyad, Y.; Banerji, M.; Chen, S. S.; González-Solares, E. A.; Greiner, J.; Mazzucchelli, C.; McGreer, I.; Miller, D. R.; Reed, S.; Sullivan, P. W.

2015-03-01

Luminous distant quasars are unique probes of the high-redshift intergalactic medium (IGM) and of the growth of massive galaxies and black holes in the early universe. Absorption due to neutral hydrogen in the IGM makes quasars beyond a redshift of z≃ 6.5 very faint in the optical z band, thus locating quasars at higher redshifts requires large surveys that are sensitive above 1 micron. We report the discovery of three new z\\gt 6.5 quasars, corresponding to an age of the universe of \\lt 850 Myr, selected as z-band dropouts in the Pan-STARRS1 survey. This increases the number of known z\\gt 6.5 quasars from four to seven. The quasars have redshifts of z = 6.50, 6.52, and 6.66, and include the brightest z-dropout quasar reported to date, PSO J036.5078 + 03.0498 with {{M}1450}=-27.4. We obtained near-infrared spectroscopy for the quasars, and from the Mg ii line, we estimate that the central black holes have masses between 5 × 108 and 4 × 109 {{M}⊙ } and are accreting close to the Eddington limit ({{L}Bol}/{{L}Edd}=0.13-1.2). We investigate the ionized regions around the quasars and find near-zone radii of {{R}NZ}=1.5-5.2 proper Mpc, confirming the trend of decreasing near-zone sizes with increasing redshift found for quasars at 5.7\\lt z\\lt 6.4. By combining RNZ of the PS1 quasars with those of 5.7\\lt z\\lt 7.1 quasars in the literature, we derive a luminosity-corrected redshift evolution of {{R}NZ,corrected}=(7.2+/- 0.2)-(6.1+/- 0.7)× (z-6) Mpc. However, the large spread in RNZ in the new quasars implies a wide range in quasar ages and/or a large variation in the neutral hydrogen fraction along different lines of sight. Based in part on observations collected at the European Southern Observatory, Chile, programs 179.A-2010, 092.A-0150, 093.A-0863, and 093.A-0574, and at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated jointly by the Max-Planck Institut für Astronomie and the Instituto de Astrofísica de Andalucía (CSIC). This paper

Black hole feedback in the luminous quasar PDS 456

DEFF Research Database (Denmark)

Nardini, E.; Reeves, J. N.; Gofford, J.

2015-01-01

The evolution of galaxies is connected to the growth of supermassive black holes in their centers. During the quasar phase, a huge luminosity is released as matter falls onto the black hole, and radiation-driven winds can transfer most of this energy back to the host galaxy. Over five different...... gas. The outflow’s kinetic power larger than 1046 ergs per second is enough to provide the feedback required by models of black hole and host galaxy coevolution....

The Large Sky Area Multi-Object Fibre Spectroscopic Telescope (LAMOST) Quasar Survey: Quasar Properties from Data Release Two and Three

Science.gov (United States)

Dong, X. Y.; Wu, Xue-Bing; Ai, Y. L.; Yang, J. Y.; Yang, Q.; Wang, F.; Zhang, Y. X.; Luo, A. L.; Xu, H.; Yuan, H. L.; Zhang, J. N.; Wang, M. X.; Wang, L. L.; Li, Y. B.; Zuo, F.; Hou, W.; Guo, Y. X.; Kong, X.; Chen, X. Y.; Wu, Y.; Yang, H. F.; Yang, M.

2018-05-01

This is the second installment for the Large Sky Area Multi-Object Fibre Spectroscopic Telescope (LAMOST) Quasar Survey, which includes quasars observed from 2013 September to 2015 June. There are 9024 confirmed quasars in DR2 and 10911 in DR3. After cross-match with the Sloan Digital Sky Survey (SDSS) quasar catalogs and NED, 12126 quasars are discovered independently. Among them, 2225 quasars were released by SDSS DR12 QSO catalog in 2014 after we finalized the survey candidates. 1801 sources were identified by SDSS DR14 as QSOs. The remaining 8100 quasars are considered as newly founded, and among them, 6887 quasars can be given reliable emission line measurements and the estimated black hole masses. Quasars found in LAMOST are mostly located at low-to-moderate redshifts, with a mean value of 1.5. The highest redshift observed in DR2 and DR3 is 5. We applied emission line measurements to Hα, Hβ, Mg II, and C IV. We deduced the monochromatic continuum luminosities using photometry data, and estimated the virial black hole masses for the newly discovered quasars. Results are compiled into a quasar catalog, which will be available online.

Cross-correlation of SDSS DR7 quasars and DR10 BOSS galaxies: The weak luminosity dependence of quasar clustering at z ∼ 0.5

International Nuclear Information System (INIS)

Shen, Yue; McBride, Cameron K.; Swanson, Molly E. C.; White, Martin; Kirkpatrick, Jessica A.; Ross, Nicholas P.; Schlegel, David J.; Zheng, Zheng; Myers, Adam D.; Guo, Hong; Zehavi, Idit; Padmanabhan, Nikhil; Parejko, John K.; Schneider, Donald P.; Streblyanska, Alina; Pan, Kaike; Bizyaev, Dmitry; Brewington, Howard; Ebelke, Garrett; Malanushenko, Viktor

2013-01-01

We present the measurement of the two-point cross-correlation function (CCF) of 8198 Sloan Digital Sky Survey Data Release 7 quasars and 349,608 Data Release 10 CMASS galaxies from the Baryonic Oscillation Spectroscopic Survey at 0.3 < z < 0.9. The CCF can be reasonably well fit by a power-law model ξ QG (r) = (r/r 0 ) –γ on projected scales of r p = 2-25 h –1 Mpc with r 0 = 6.61 ± 0.25 h –1 Mpc and γ = 1.69 ± 0.07. We estimate a quasar linear bias of b Q = 1.38 ± 0.10 at (z) = 0.53 from the CCF measurements, which corresponds to a characteristic host halo mass of ∼4 × 10 12 h –1 M ☉ , compared with a ∼10 13 h –1 M ☉ characteristic host halo mass for CMASS galaxies. Based on the clustering measurements, most quasars at z-bar ∼0.5 are not the descendants of their higher luminosity counterparts at higher redshift, which would have evolved into more massive and more biased systems at low redshift. We divide the quasar sample in luminosity and constrain the luminosity dependence of quasar bias to be db Q /dlog L = 0.20 ± 0.34 or 0.11 ± 0.32 (depending on different luminosity divisions) for quasar luminosities –23.5 > M i (z = 2) > –25.5, implying a weak luminosity dependence of clustering for luminous quasars at z-bar ∼0.5. We compare our measurements with theoretical predictions, halo occupation distribution (HOD) models, and mock catalogs. These comparisons suggest that quasars reside in a broad range of host halos. The host halo mass distributions significantly overlap with each other for quasars at different luminosities, implying a poor correlation between halo mass and instantaneous quasar luminosity. We also find that the quasar HOD parameterization is largely degenerate such that different HODs can reproduce the CCF equally well, but with different satellite fractions and host halo mass distributions. These results highlight the limitations and ambiguities in modeling the distribution of quasars with the standard HOD approach.

Paired quasars near NGC 2639: Evidence for quasars in superclusters

International Nuclear Information System (INIS)

Ford, H.; Ciardullo, R.; Harms, R.

1983-01-01

Arp found 10 quasars near a low-redshift galaxy 27' SSE of NGC 2639. Six of the quasars can be grouped into three redshift pairs which align across the anonymous galaxy. The large number of quasars and pairings could show an association with the low-redshift galaxy, or alternatively, might be due to superclusters seen along the line of sight. We tested the latter hypothesis by using deep, red-sensitive Lick 3 m prime focus plates to search for a supercluster associated with the z = 0.3 quasar pair. The plates show extended nebulosity associated with the quasar U10 (thetaapprox.7'', or 20 kpc at z = 0.3) and a richness class 1, Bautz-Morgan type III cluster 4' NW of U10. A spectrum of one the cluster's brightest galaxies gives z = 0.34, suggesting that the cluster and quasar are unassociated. We obtained spectra of eight of the quasars and find that (i) two of the quasars have very strong absorption shortward of Lyα, and (ii) two of Arp's redshifts (including one which Arp considered uncertain) are incorrect. Our redshifts break two of the redshift pairs, including the pair at z = 0.3. We use the redshift distribution of optically selected quasars to argue that the third pair has no statistical significance, and conclude that there is no basis for associating the quasars with the low-redshift anonymous galaxy. The disappearance of the redshift pairs vitiates the possibility of testing the paired-quasars-in-superclusters hypothesis in the NGC 2639 field

C IV BROAD ABSORPTION LINE ACCELERATION IN SLOAN DIGITAL SKY SURVEY QUASARS

Energy Technology Data Exchange (ETDEWEB)

Grier, C. J.; Brandt, W. N.; Trump, J. R.; Schneider, D. P.; Sun, M.; Beatty, T. G. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Laboratory, University Park, PA 16802 (United States); Hall, P. B. [Department of Physics and Astronomy, York University, Toronto, ON M3J 1P3 (Canada); Filiz Ak, N. [Faculty of Sciences, Department of Astronomy and Space Sciences, Erciyes University, 38039 Kayseri (Turkey); Anderson, S. F. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Green, Paul J. [Harvard Smithsonian Center for Astrophysics, 60 Garden St, Cambridge, MA 02138 (United States); Vivek, M.; Brownstein, Joel R. [Department of Physics and Astronomy, University of Utah, 115 S. 1400 E., Salt Lake City, UT 84112 (United States); Roman-Lopes, Alexandre, E-mail: grier@psu.edu [Departamento de Fisica, Facultad de Ciencias, Universidad de La Serena, Cisternas 1200, La Serena (Chile)

2016-06-20

We present results from the largest systematic investigation of broad absorption line (BAL) acceleration to date. We use spectra of 140 quasars from three Sloan Digital Sky Survey programs to search for global velocity offsets in BALs over timescales of ≈2.5–5.5 years in the quasar rest frame. We carefully select acceleration candidates by requiring monolithic velocity shifts over the entire BAL trough, avoiding BALs with velocity shifts that might be caused by profile variability. The C iv BALs of two quasars show velocity shifts consistent with the expected signatures of BAL acceleration, and the BAL of one quasar shows a velocity-shift signature of deceleration. In our two acceleration candidates, we see evidence that the magnitude of the acceleration is not constant over time; the magnitudes of the change in acceleration for both acceleration candidates are difficult to produce with a standard disk-wind model or via geometric projection effects. We measure upper limits to acceleration and deceleration for 76 additional BAL troughs and find that the majority of BALs are stable to within about 3% of their mean velocities. The lack of widespread acceleration/deceleration could indicate that the gas producing most BALs is located at large radii from the central black hole and/or is not currently strongly interacting with ambient material within the host galaxy along our line of sight.

EXTENDED [C II] EMISSION IN LOCAL LUMINOUS INFRARED GALAXIES

International Nuclear Information System (INIS)

Díaz-Santos, T.; Armus, L.; Surace, J. A.; Charmandaris, V.; Stacey, G.; Murphy, E. J.; Haan, S.; Stierwalt, S.; Evans, A. S.; Malhotra, S.; Appleton, P.; Inami, H.; Magdis, G. E.; Elbaz, D.; Mazzarella, J. M.; Xu, C. K.; Lu, N.; Howell, J. H.; Van der Werf, P. P.; Meijerink, R.

2014-01-01

We present Herschel/PACS observations of extended [C II] 157.7 μm line emission detected on ∼1-10 kpc scales in 60 local luminous infrared galaxies (LIRGs) from the Great Observatories All-sky LIRG Survey. We find that most of the extra-nuclear emission show [C II]/FIR ratios ≥4 × 10 –3 , larger than the mean ratio seen in the nuclei, and similar to those found in the extended disks of normal star-forming galaxies and the diffuse interstellar medium of our Galaxy. The [C II] ''deficits'' found in the most luminous local LIRGs are therefore restricted to their nuclei. There is a trend for LIRGs with warmer nuclei to show larger differences between their nuclear and extra-nuclear [C II]/FIR ratios. We find an anti-correlation between [C II]/FIR and the luminosity surface density, Σ IR , for the extended emission in the spatially resolved galaxies. However, there is an offset between this trend and that found for the LIRG nuclei. We use this offset to derive a beam filling-factor for the star-forming regions within the LIRG disks of ∼6% relative to their nuclei. We confront the observed trend to photo-dissociation region models and find that the slope of the correlation is much shallower than the model predictions. Finally, we compare the correlation found between [C II]/FIR and Σ IR with measurements of high-redshift starbursting IR-luminous galaxies

C IV EMISSION AND THE ULTRAVIOLET THROUGH X-RAY SPECTRAL ENERGY DISTRIBUTION OF RADIO-QUIET QUASARS

International Nuclear Information System (INIS)

Kruczek, Nicholas E.; Richards, Gordon T.; Deo, Rajesh P.; Krawczyk, Coleman M.; Gallagher, S. C.; Hall, Patrick B.; Hewett, Paul C.; Leighly, Karen M.; Proga, Daniel

2011-01-01

In the rest-frame ultraviolet (UV), two of the parameters that best characterize the range of emission-line properties in quasar broad emission-line regions are the equivalent width and the blueshift of the C IV λ1549 line relative to the quasar rest frame. We explore the connection between these emission-line properties and the UV through X-ray spectral energy distribution (SED) for radio-quiet (RQ) quasars. Our sample consists of a heterogeneous compilation of 406 quasars from the Sloan Digital Sky Survey (at z > 1.54) and Palomar-Green survey (at z < 0.4) that have well-measured C IV emission-line and X-ray properties (including 164 objects with measured Γ). We find that RQ quasars with both strong C IV emission and small C IV blueshifts can be classified as 'hard-spectrum' sources that are (relatively) strong in the X-ray as compared to the UV. On the other hand, RQ quasars with both weak C IV emission and large C IV blueshifts are instead 'soft-spectrum' sources that are (relatively) weak in the X-ray as compared to the UV. This work helps to further bridge optical/soft X-ray 'eigenvector 1' relationships to the UV and hard X-ray. Based on these findings, we argue that future work should consider systematic errors in bolometric corrections (and thus accretion rates) that are derived from a single mean SED. Detailed analysis of the C IV emission line may allow for SED-dependent corrections to these quantities.

Quenching star formation with quasar outflows launched by trapped IR radiation

Science.gov (United States)

Costa, Tiago; Rosdahl, Joakim; Sijacki, Debora; Haehnelt, Martin G.

2018-06-01

We present cosmological radiation-hydrodynamic simulations, performed with the code RAMSES-RT, of radiatively-driven outflows in a massive quasar host halo at z = 6. Our simulations include both single- and multi-scattered radiation pressure on dust from a quasar and are compared against simulations performed with thermal feedback. For radiation pressure-driving, we show that there is a critical quasar luminosity above which a galactic outflow is launched, set by the equilibrium of gravitational and radiation forces. While this critical luminosity is unrealistically high in the single-scattering limit for plausible black hole masses, it is in line with a ≈ 3 × 10^9 M_⊙ black hole accreting at its Eddington limit, if infrared (IR) multi-scattering radiation pressure is included. The outflows are fast (v ≳ 1000 km s^{-1}) and strongly mass-loaded with peak mass outflow rates ≈ 10^3 - 10^4 M_⊙ yr^{-1}, but short-lived (star formation in the bulge. We hence argue that radiation pressure-driven feedback may be an important ingredient in regulating star formation in compact starbursts, especially during the quasar's `obscured' phase.

Weak hard X-ray emission from broad absorption line quasars: evidence for intrinsic X-ray weakness

International Nuclear Information System (INIS)

Luo, B.; Brandt, W. N.; Scott, A. E.; Alexander, D. M.; Gandhi, P.; Stern, D.; Teng, S. H.; Arévalo, P.; Bauer, F. E.; Boggs, S. E.; Craig, W. W.; Christensen, F. E.; Comastri, A.; Farrah, D.; Hailey, C. J.; Harrison, F. A.; Koss, M.; Ogle, P.; Puccetti, S.; Saez, C.

2014-01-01

We report NuSTAR observations of a sample of six X-ray weak broad absorption line (BAL) quasars. These targets, at z = 0.148-1.223, are among the optically brightest and most luminous BAL quasars known at z < 1.3. However, their rest-frame ≈2 keV luminosities are 14 to >330 times weaker than expected for typical quasars. Our results from a pilot NuSTAR study of two low-redshift BAL quasars, a Chandra stacking analysis of a sample of high-redshift BAL quasars, and a NuSTAR spectral analysis of the local BAL quasar Mrk 231 have already suggested the existence of intrinsically X-ray weak BAL quasars, i.e., quasars not emitting X-rays at the level expected from their optical/UV emission. The aim of the current program is to extend the search for such extraordinary objects. Three of the six new targets are weakly detected by NuSTAR with ≲ 45 counts in the 3-24 keV band, and the other three are not detected. The hard X-ray (8-24 keV) weakness observed by NuSTAR requires Compton-thick absorption if these objects have nominal underlying X-ray emission. However, a soft stacked effective photon index (Γ eff ≈ 1.8) for this sample disfavors Compton-thick absorption in general. The uniform hard X-ray weakness observed by NuSTAR for this and the pilot samples selected with <10 keV weakness also suggests that the X-ray weakness is intrinsic in at least some of the targets. We conclude that the NuSTAR observations have likely discovered a significant population (≳ 33%) of intrinsically X-ray weak objects among the BAL quasars with significantly weak <10 keV emission. We suggest that intrinsically X-ray weak quasars might be preferentially observed as BAL quasars.

DES J0454-4448: discovery of the first luminous z ≥ 6 quasar from the Dark Energy Survey

Energy Technology Data Exchange (ETDEWEB)

Reed, S. L.; McMahon, R. G.; Banerji, M.; Becker, G. D.; Gonzalez-Solares, E.; Martini, P.; Ostrovski, F.; Rauch, M.; Abbott, T.; Abdalla, F. B.; Allam, S.; Benoit-Levy, A.; Bertin, E.; Buckley-Geer, E.; Burke, D.; Carnero Rosell, A.; da Costa, L. N.; D' Andrea, C.; DePoy, D. L.; Desai, S.; Diehl, H. T.; Doel, P.; Cunha, C. E.; Estrada, J.; Evrard, A. E.; Fausti Neto, A.; Finley, D. A.; Fosalba, P.; Frieman, J.; Gruen, D.; Honscheid, K.; James, D.; Kent, S.; Kuehn, K.; Kuropatkin, N.; Lahav, O.; Maia, M. A. G.; Makler, M.; Marshall, J.; Merritt, K.; Miquel, R.; Mohr, J.; Nord, B.; Ogando, R.; Plazas, A.; Romer, K.; Roodman, A.; Rykoff, E.; Sako, M.; Sanchez, E.; Santiago, B.; Schubnell, M.; Sevilla, I.; Smith, C.; Soares-Santos, M.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Thomas, D.; Tucker, D.; Walker, A.; Wechsler, R. H.

2015-10-28

We present the first results of a survey for high-redshift, z ≥ 6, quasars using izY multicolour photometric observations from the Dark Energy Survey (DES). Here we report the discovery and spectroscopic confirmation of the z_AB, Y_AB = 20.2, 20.2 (M₁₄₅₀ = -26.5) quasar DES J0454-4448 with a redshift of z = 6.09±0.02 based on the onset of the Ly α forest and an H I near zone size of 4.1^+1.1_-1.2 proper Mpc. The quasar was selected as an i-band drop out with i-z = 2.46 and z_AB < 21.5 from an area of ~300 deg². It is the brightest of our 43 candidates and was identified for spectroscopic follow-up solely based on the DES i-z and z-Y colours. The quasar is detected by WISE and has W1_AB = 19.68. The discovery of one spectroscopically confirmed quasar with 5.7 < z < 6.5 and zAB ≤ 20.2 is consistent with recent determinations of the luminosity function at z ~ 6. DES when completed will have imaged ~5000 deg² to Y_AB = 23.0 (5σ point source) and we expect to discover 50–100 new quasars with z > 6 including 3–10 with z > 7 dramatically increasing the numbers of quasars currently known that are suitable for detailed studies.

DEEP HE ii AND C iv SPECTROSCOPY OF A GIANT LYα NEBULA: DENSE COMPACT GAS CLUMPS IN THE CIRCUMGALACTIC MEDIUM OF A z ∼ 2 QUASAR

Energy Technology Data Exchange (ETDEWEB)

Battaia, Fabrizio Arrigoni; Hennawi, Joseph F. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Prochaska, J. Xavier; Cantalupo, Sebastiano, E-mail: arrigoni@mpia.de [Department of Astronomy and Astrophysics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States)

2015-08-20

The recent discovery by Cantalupo et al. of the largest (∼500 kpc) luminous (L ≃ 1.43 × 10{sup 45} erg s{sup −1}) Lyα nebula associated with the quasar UM287 (z = 2.279) poses a great challenge to our current understanding of the astrophysics of the halos hosting massive z ∼ 2 galaxies. Either an enormous reservoir of cool gas is required M ≃ 10{sup 12} M{sub ⊙}, exceeding the expected baryonic mass available, or one must invoke extreme gas clumping factors not present in high-resolution cosmological simulations. However, observations of Lyα emission alone cannot distinguish between these two scenarios. We have obtained the deepest ever spectroscopic integrations in the He ii λ1640 and C iv λ1549 emission lines with the goal of detecting extended line emission, but detect neither line to a 3σ limiting SB ≃ 10{sup −18} erg s{sup −1} cm{sup −2} arcsec{sup −2}. We construct simple models of the expected emission spectrum in the highly probable scenario that the nebula is powered by photoionization from the central hyper-luminous quasar. The non-detection of He ii implies that the nebular emission arises from a mass M{sub c} ≲ 6.4 × 10{sup 10} M{sub ⊙} of cool gas on ∼200 kpc scales, distributed in a population of remarkably dense (n{sub H} ≳ 3 cm{sup −3}) and compact (R ≲ 20 pc) clouds, which would clearly be unresolved by current cosmological simulations. Given the large gas motions suggested by the Lyα line (v ≃ 500 km s{sup −1}), it is unclear how these clouds survive without being disrupted by hydrodynamic instabilities. Our work serves as a benchmark for future deep integrations with current and planned wide-field IFU spectrographs such as MUSE, KCWI, and KMOS. Our observations and models suggest that a ≃10 hr exposure would likely detect ∼10 rest-frame UV/optical emission lines, opening up the possibility of conducting detailed photoionization modeling to infer the physical state of gas in the circumgalactic

DEEP HE ii AND C iv SPECTROSCOPY OF A GIANT LYα NEBULA: DENSE COMPACT GAS CLUMPS IN THE CIRCUMGALACTIC MEDIUM OF A z ∼ 2 QUASAR

International Nuclear Information System (INIS)

Battaia, Fabrizio Arrigoni; Hennawi, Joseph F.; Prochaska, J. Xavier; Cantalupo, Sebastiano

2015-01-01

The recent discovery by Cantalupo et al. of the largest (∼500 kpc) luminous (L ≃ 1.43 × 10 45 erg s −1 ) Lyα nebula associated with the quasar UM287 (z = 2.279) poses a great challenge to our current understanding of the astrophysics of the halos hosting massive z ∼ 2 galaxies. Either an enormous reservoir of cool gas is required M ≃ 10 12 M ⊙ , exceeding the expected baryonic mass available, or one must invoke extreme gas clumping factors not present in high-resolution cosmological simulations. However, observations of Lyα emission alone cannot distinguish between these two scenarios. We have obtained the deepest ever spectroscopic integrations in the He ii λ1640 and C iv λ1549 emission lines with the goal of detecting extended line emission, but detect neither line to a 3σ limiting SB ≃ 10 −18 erg s −1 cm −2 arcsec −2 . We construct simple models of the expected emission spectrum in the highly probable scenario that the nebula is powered by photoionization from the central hyper-luminous quasar. The non-detection of He ii implies that the nebular emission arises from a mass M c ≲ 6.4 × 10 10 M ⊙ of cool gas on ∼200 kpc scales, distributed in a population of remarkably dense (n H ≳ 3 cm −3 ) and compact (R ≲ 20 pc) clouds, which would clearly be unresolved by current cosmological simulations. Given the large gas motions suggested by the Lyα line (v ≃ 500 km s −1 ), it is unclear how these clouds survive without being disrupted by hydrodynamic instabilities. Our work serves as a benchmark for future deep integrations with current and planned wide-field IFU spectrographs such as MUSE, KCWI, and KMOS. Our observations and models suggest that a ≃10 hr exposure would likely detect ∼10 rest-frame UV/optical emission lines, opening up the possibility of conducting detailed photoionization modeling to infer the physical state of gas in the circumgalactic medium

Discovery of an X-ray Violently Variable Broad Absorption Line Quasar

Science.gov (United States)

Ghosh, Kajal K.; Gutierrez, Carlos M.; Punsly, Brian; Chevallier, Loic; Goncalves, Anabela C.

2006-01-01

In this letter, we report on a quasar that is violently variable in the X-rays, XVV. It is also a broad absorption line quasar (BALQSO) that exhibits both high ionization and low ionization UV absorption lines (LoBALQSO). It is very luminous in the X-rays (approximately 10(exp 46) ergs s(sup -l) over the entire X-ray band). Surprisingly, this does not over ionize the LoBAL outflow. The X-rays vary by a factor of two within minutes in the quasar rest frame, which is shorter than 1/30 of the light travel time across a scale length equal to the black hole radius. We concluded that the X-rays are produced in a relativistic jet beamed toward earth in which variations in the Doppler enhancement produce the XVV behavior.

Quasars Probing Quasars: The Circumgalactic Medium Surrounding Z 2 Quasars

Science.gov (United States)

Lau, Marie Wingyee

parameter U positively correlates with impact parameter, which implies the foreground quasar does not dominate the radiation field. The circumgalactic medium is significantly enriched even beyond the virial radius, and has median [M/H] = -0.6. O/Fe is supersolar. No evolution in the total H column is found up to projected distance of 200 kpc, within which the median N H = 1020.5 cm-2. Within the virial radius, the mass of the cool CGM is estimated at MCGM ≈ 1.5*10 11 Msun. In two cases, detection of CII* implies electron density ne > 10 cm-3. Motivated by the preliminary kinematic results from this high-resolution sample, kinematic analysis of 148 pairs with precise foreground quasar redshifts is performed. The background spectra of this sample are of low and high resolution. The mean absorptions in metals exhibit velocity widths sigmav ≈ 300 km s-1, however the large widths do not require outflows. The mean absorptions have centroids redshifted from the systemic redshift by +200 km s-1. The asymmetry may be explained if the quasars are anisotropic or intermittent, and the gas is not flowing onto the galaxy. Finally, several observational and theoretical lines of future inquiry using multiwavelength data are presented.

A composite plot of far-infrared versus radio luminosity, and the origin of far-infrared luminosity in quasars

International Nuclear Information System (INIS)

Sopp, H.M.; Alexander, P.

1991-01-01

We have constructed a composite plot of far-infrared versus radioluminosity for late-type galaxies, Seyferts, quasars and radio galaxies. The most striking result is that the radio and far-infrared luminosities of radio-quiet quasars are correlated and follow the same correlation as normal star-forming galaxies and ultra-luminous infrared galaxies, whereas the radio-loud quasars have luminosities in both bands similar to those of radio galaxies. We conclude that the far-infrared emission from radio-quiet quasars is from star-forming host galaxies and not from active galactic nuclei. The far-infrared radio plot may be a powerful discriminator between host galaxy type. (author)

Clustering of High Redshift (z>2.9) Quasars from the Sloan Digital Sky Survey

Energy Technology Data Exchange (ETDEWEB)

Shen, Yue; Strauss, Michael A.; Oguri, Masamune; Hennawi, Joseph F.; Fan, Xiaohui; Richards, Gordon T.; Hall, Patrick B.; Schneider, Donald P.; Szalay, Alexander S.; Thakar, Anirudda R.; Berk, Daniel E.Vanden; Anderson, Scott F.; Bahcall, Neta A.; /KIPAC, Menlo Park

2006-11-30

We study the two-point correlation function of a uniformly selected sample of 4,428 optically selected luminous quasars with redshift 2.9 {le} z {le} 5.4 selected over 4041 deg{sup 2} from the Fifth Data Release of the Sloan Digital Sky Survey. We fit a power-law to the projected correlation function w{sub p}(r{sub p}) to marginalize over redshift space distortions and redshift errors. For a real-space correlation function of the form {zeta}(r) = (r/r{sub 0}){sup -{gamma}}, the fitted parameters in comoving coordinates are r{sub 0} = 15.2 {+-} 2.7 h{sup -1} Mpc and {gamma} = 2.0 {+-} 0.3, over a scale range 4 {le} r{sub p} {le} 150 h{sup -1} Mpc. Thus high-redshift quasars are appreciably more strongly clustered than their z {approx} 1.5 counterparts, which have a comoving clustering length r{sub 0} {approx} 6.5 h{sup -1} Mpc. Dividing our sample into two redshift bins: 2.9 {le} z {le} 3.5 and z {ge} 3.5, and assuming a power-law index {gamma} = 2.0, we find a correlation length of r{sub 0} = 16.9 {+-} 1.7 h{sup -1} Mpc for the former, and r{sub 0} = 24.3 {+-} 2.4 h{sup -1} Mpc for the latter. Strong clustering at high redshift indicates that quasars are found in very massive, and therefore highly biased, halos. Following Martini & Weinberg, we relate the clustering strength and quasar number density to the quasar lifetimes and duty cycle. Using the Sheth & Tormen halo mass function, the quasar lifetime is estimated to lie in the range 4 {approx} 50 Myr for quasars with 2.9 {le} z {le} 3.5; and 30 {approx} 600 Myr for quasars with z {ge} 3.5. The corresponding duty cycles are 0.004 {approx} 0.05 for the lower redshift bin and 0.03 {approx} 0.6 for the higher redshift bin. The minimum mass of halos in which these quasars reside is 2-3 x 10{sup 12} h{sup -1} M{sub {circle_dot}} for quasars with 2.9 {le} z {le} 3.5 and 4-6 x 10{sup 12} h{sup -1} M{sub {circle_dot}} for quasars with z {ge} 3.5; the effective bias factor b{sub eff} increases with redshift, e.g., b

9 CFR 3.109 - Separation.

Science.gov (United States)

2010-01-01

... Mammals Animal Health and Husbandry Standards § 3.109 Separation. Marine mammals, whenever known to be... in the same enclosure. Marine mammals must not be housed near other animals that cause them... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Separation. 3.109 Section 3.109...

IRAS 14348-1447, an Ultraluminous Pair of Colliding, Gas-Rich Galaxies: The Birth of a Quasar?

Science.gov (United States)

Sanders, D B; Scoville, N Z; Soifer, B T

1988-02-05

Ground-based observations of the object IRAS 14348-1447, which was discovered with the Infrared Astronomical Satellite, show that it is an extremely luminous colliding galaxy system that emits more than 95 percent of its energy at far-infrared wavelengths. IRAS 14348-1447, which is receeding from the sun at 8 percent of the speed of light, has a bolometric luminosity more than 100 times larger than that of our galaxy, and is therefore as luminous as optical quasars. New optical, infrared, and spectroscopic measurements suggest that the dominant luminosity source is a dustenshrouded quasar. The fuel for the intense activity is an enormous supply of molecular gas. Carbon monoxide emission has been detected at a wavelength of 2.6 millimeters by means of a new, more sensitive receiver recently installed on the 12-meter telescope of the National Radio Astronomy Observatory. IRAS 14348-1447 is the most distant and luminous source of carbon monoxide line emission yet detected. The derived mass of interstellar molecular hydrogen is 6 x 10(10) solar masses. This value is approximately 20 times that of the molecular gas content of the Milky Way and is similar to the largest masses of atomic hydrogen found in galaxies. A large mass of molecular gas may be a prerequisite for the formation of quasars during strong galactic collisions.

H i Absorption in the Steep-Spectrum Superluminal Quasar 3C 216.

Science.gov (United States)

Pihlström; Vermeulen; Taylor; Conway

1999-11-01

The search for H i absorption in strong compact steep-spectrum sources is a natural way to probe the neutral gas contents in young radio sources. In turn, this may provide information about the evolution of powerful radio sources. The recently improved capabilities of the Westerbork Synthesis Radio Telescope have made it possible to detect a 0.31% (19 mJy) deep neutral atomic hydrogen absorption line associated with the steep-spectrum superluminal quasar 3C 216. The redshift (z=0.67) of the source shifts the frequency of the 21 cm line down to the ultra-high-frequency (UHF) band (850 MHz). The exact location of the H i-absorbing gas remains to be determined by spectral line VLBI observations at 850 MHz. We cannot exclude that the gas might be extended on galactic scales, but we think it is more likely to be located in the central kiloparsec. Constraints from the lack of X-ray absorption probably rule out obscuration of the core region, and we argue that the most plausible site for the H i absorption is in the jet-cloud interaction observed in this source.

Quasar 3C351: VLA maps and a deep search for optical emission in the outer lobes

International Nuclear Information System (INIS)

Kronberg, P.P.; Clarke, J.N.; van den Bergh, S.

1980-01-01

VLA radio maps of the quasar 3C351 (z=0.371) at approx.2'' and 0.''4 resolution (a) show interaction with a relatively dense intergalactic medium, (b) show that there is electron acceleration within at least one of the radio lobes, and (c) imply that the intergalactic gas density is different on one side of the source than on the other. Striking similarities are found between the northern radio lobe of 3C351 and one of the outer hotspots of Cygnus A, and possibly other similar systems, in that the outer, on-axis hotspot is resolved and cusp-shaped, and the ''secondary'' off-axis hotspot is more compact. A search for optical emission in the outer lobes shows no emission stronger than 22/sup m/ in the J band and approx.21/sup m/ in the F band. There is also no evidence at these limits for a cluster of galaxies near the radio source, as is suggested by our conclusion that it is interacting with a medium of typical intracluster density

A Massive Molecular Gas Reservoir in the Z = 2.221 Type-2 Quasar Host Galaxy SMM J0939+8315 Lensed by the Radio Galaxy 3C220.3

Science.gov (United States)

Leung, T. K. Daisy; Riechers, Dominik A.

2016-02-01

We report the detection of CO(J = 3 \\to 2) line emission in the strongly lensed submillimeter galaxy (SMG) SMM J0939+8315 at z = 2.221, using the Combined Array for Research in Millimeter-wave Astronomy. SMM J0939+8315 hosts a type-2 quasar, and is gravitationally lensed by the radio galaxy 3C220.3 and its companion galaxy at z = 0.685. The 104 GHz continuum emission underlying the CO line is detected toward 3C220.3 with an integrated flux density of Scont = 7.4 ± 1.4 mJy. Using the CO(J = 3 \\to 2) line intensity of ICO(3-2) = (12.6 ± 2.0) Jy km s-1, we derive a lensing- and excitation-corrected CO line luminosity of {L}{{CO(1-0)}}\\prime = (3.4 ± 0.7) × 1010 (10.1/μL) K km s-1 pc2 for the SMG, where μL is the lensing magnification factor inferred from our lens modeling. This translates to a molecular gas mass of Mgas = (2.7 ± 0.6) × 1010 (10.1/μL) M⊙. Fitting spectral energy distribution models to the (sub)-millimeter data of this SMG yields a dust temperature of T = 63.1{}-1.3+1.1 K, a dust mass of Mdust = (5.2 ± 2.1) × 108 (10.1/μL) M⊙, and a total infrared luminosity of LIR = (9.1 ± 1.2) ×1012 (10.1/μL) L⊙. We find that the properties of the interstellar medium of SMM J0939+8315 overlap with both SMGs and type-2 quasars. Hence, SMM J0939+8315 may be transitioning from a starbursting phase to an unobscured quasar phase as described by the “evolutionary link” model, according to which this system may represent an intermediate stage in the evolution of present-day galaxies at an earlier epoch.

RADIOASTRON OBSERVATIONS OF THE QUASAR 3C273: A CHALLENGE TO THE BRIGHTNESS TEMPERATURE LIMIT

Energy Technology Data Exchange (ETDEWEB)

Kovalev, Y. Y.; Kardashev, N. S.; Voitsik, P. A.; Kovalev, Yu. A.; Lisakov, M. M.; Sokolovsky, K. V. [Astro Space Center of Lebedev Physical Institute, Profsoyuznaya 84/32, 117997 Moscow (Russian Federation); Kellermann, K. I. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903-2475 (United States); Lobanov, A. P.; Zensus, J. A.; Anderson, J. M.; Bach, U.; Kraus, A. [Max-Planck-Institute for Radio Astronomy, Auf dem Hügel 69, D-53121 (Germany); Johnson, M. D. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gurvits, L. I. [Joint Institute for VLBI ERIC, P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Jauncey, D. L. [CSIRO Astronomy and Space Sciences, Epping, NSW 1710 (Australia); Ghigo, F. [National Radio Astronomy Observatory, Rt. 28/92, Green Bank, WV 24944-0002 (United States); Ghosh, T.; Salter, C. J. [Arecibo Observatory, NAIC, HC3 Box 53995, Arecibo, Puerto Rico, PR 00612 (United States); Petrov, L. Yu. [Astrogeo Center, 7312 Sportsman Drive, Falls Church, VA 22043 (United States); Romney, J. D. [National Radio Astronomy Observatory, P.O. Box O, 1003 Lopezville Road, Socorro, NM 87801-0387 (United States)

2016-03-20

Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of 10{sup 11.5} K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of 10{sup 13} K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C 273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 μas (2.7 light months) and brightness temperature in excess of 10{sup 13} K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require a much higher Doppler factor than what is determined from jet apparent kinematics.

High redshift quasars and high metallicities

Science.gov (United States)

Ferland, Gary J.

1997-01-01

A large-scale code called Cloudy was designed to simulate non-equilibrium plasmas and predict their spectra. The goal was to apply it to studies of galactic and extragalactic emission line objects in order to reliably deduce abundances and luminosities. Quasars are of particular interest because they are the most luminous objects in the universe and the highest redshift objects that can be observed spectroscopically, and their emission lines can reveal the composition of the interstellar medium (ISM) of the universe when it was well under a billion years old. The lines are produced by warm (approximately 10(sup 4)K) gas with moderate to low density (n less than or equal to 10(sup 12) cm(sup -3)). Cloudy has been extended to include approximately 10(sup 4) resonance lines from the 495 possible stages of ionization of the lightest 30 elements, an extension that required several steps. The charge transfer database was expanded to complete the needed reactions between hydrogen and the first four ions and fit all reactions with a common approximation. Radiative recombination rate coefficients were derived for recombination from all closed shells, where this process should dominate. Analytical fits to Opacity Project (OP) and other recent photoionization cross sections were produced. Finally, rescaled OP oscillator strengths were used to compile a complete set of data for 5971 resonance lines. The major discovery has been that high redshift quasars have very high metallicities and there is strong evidence that the quasar phenomenon is associated with the birth of massive elliptical galaxies.

The 12C/13C ratio in stellar atmospheres. VI. Five luminous cool stars

International Nuclear Information System (INIS)

Hinkle, K.H.; Lambert, D.L.; Snell, R.L.

1976-01-01

The isotopic abundance ratio, 12 C/ 13 C, is derived from the CO vibration rotation lines at 1.6 and 2.3 μ for five cool luminous stars by a simple curve-of-growth technique. A new analysis of CN lines at 8000 A is also described for α Sco and α Ori. Results derived independently from CO and CN are in agreement. Final results are 12 C/ 13 C=7 +- 2(α Ori), 12 +- 3(α Sco), 7 +- 3(β Peg), 25 +- 7(chi Cyg), 17 +- 4(α Her), and 7 +- 1.5(α Boo). The α Boo analysis provides a check on the CO curve-of-growth technique; the 12 C/ 13 C ratio from the 2.3 μ CO lines is in good agreement with the previously determined ratio from CN and CH lines

Polarimetry and photometry of active quasars at visual and near-infrared wavelengths

International Nuclear Information System (INIS)

Smith, P.S.

1986-01-01

The optical and near-infrared continua of highly luminous BL Lacertae (BL Lac) objects and optically violent variable (OVV) quasars are studied through simultaneous broad-band photometry and linear polarimetry. Nineteen BL Lacs and OVVs were monitored during a ∼1 1/2-year period, with the major aim of characterizing the wavelength-dependent polarization exhibited by these objects. Optical (UBVRI) observations were conducted at the UCSD/U. Minn. 1.5-m telescope on Mt. Lemmon, Arizona. Simultaneous (within 1 hr.) near-infrared (JHK) measurements were made using the KPNO 2.1-m telescope. Most of the BL Lac objects exhibit large variations in polarization and brightness on time scale of less than a week. The degree of fractional linear polarization (P) is not observed to be related to brightness or optical spectral index. Most BL Lacs did not show a preferred polarization position angle (theta). Wavelength-dependent P and theta are observed in almost all BL Lacs, but not always simultaneously. The OVV quasar 1156 + 295 shows behavior very similar to the BL Lac objects. 3C 345 Exhibited polarization properties that are quite different from those of the BL Lacs. This object showed a clear correlation between brightness and P

Early Fermi Gamma-ray Space Telescope Observations of the Quasar 3C454.3

Energy Technology Data Exchange (ETDEWEB)

Abdo, A

2009-05-07

This is the first report of Fermi Gamma-ray Space Telescope observations of the quasar 3C 454.3, which has been undergoing pronounced long-term outbursts since 2000. The data from the Large Area Telescope (LAT), covering 2008 July 7-October 6, indicate strong, highly variable {gamma}-ray emission with an average flux of {approx} 3 x 10{sup -6} photons cm{sup -2} s{sup -1}, for energies > 100 MeV. The {gamma}-ray flux is variable, with strong, distinct, symmetrically-shaped flares for which the flux increases by a factor of several on a time scale of about three days. This variability indicates a compact emission region, and the requirement that the source is optically thin to pair-production implies relativistic beaming with Doppler factor {delta} > 8, consistent with the values inferred from VLBI observations of superluminal expansion ({delta} {approx} 25). The observed {gamma}-ray spectrum is not consistent with a simple power-law, but instead steepens strongly above {approx} 2 GeV, and is well described by a broken power-law with photon indices of {approx} 2.3 and {approx} 3.5 below and above the break, respectively. This is the first direct observation of a break in the spectrum of a high luminosity blazar above 100 MeV, and it is likely direct evidence for an intrinsic break in the energy distribution of the radiating particles. Alternatively, the spectral softening above 2GeV could be due to -ray absorption via photonphoton pair production on the soft X-ray photon field of the host AGN, but such an interpretation would require the dissipation region to be located very close ({approx}< 100 gravitational radii) to the black hole, which would be inconsistent with the X-ray spectrum of the source.

Epimorphin mediates mammary luminal morphogenesis through control of C/EBPbeta

International Nuclear Information System (INIS)

Hirai, Yohei; Radisky, Derek; Boudreau, Rosanne; Simian, Marina; Stevens, Mary E.; Oka, Yumiko; Takebe, Kyoko; Niwa, Shinichiro; Bissell, Mina J.

2002-01-01

We have previously shown that epimorphin, a protein expressed on the surface of myoepithelial and fibroblast cells of the mammary gland, acts as a multifunctional morphogen of mammary epithelial cells. Here, we present the molecular mechanism by which epimorphin mediates luminal morphogenesis. Treatment of cells with epimorphin to induce lumen formation greatly increases the overall expression of transcription factor CCAAT/enhancer binding protein beta (C/EBPbeta) and alters the relative expression of its two principal isoforms, LIP and LAP. These alterations were shown to be essential for the morphogenetic activities, as constitutive expression of LIP was sufficient to produce lumen formation, while constitutive expression of LAP blocked epimorphin-mediated luminal morphogenesis. Furthermore, in a transgenic mouse model in which epimorphin expression was expressed in an apolar fashion on the surface of mammary epithelial cells, we found increased expression of C/EBPbeta, increased relative expression of LIP to LAP, and enlarged ductal lumina. Together, our studies demonstrate a role for epimorphin in luminal morphogenesis through control of C/EBPbeta expression

Statistical Detection of the He ii Transverse Proximity Effect: Evidence for Sustained Quasar Activity for >25 Million Years

Energy Technology Data Exchange (ETDEWEB)

Schmidt, Tobias M. [Department of Physics, University of California, Santa Barbara, Santa Barbara, CA (United States); Max-Planck-Institut für Astronomie, Heidelberg (Germany); Worseck, Gabor [Max-Planck-Institut für Astronomie, Heidelberg (Germany); Hennawi, Joseph F. [Department of Physics, University of California, Santa Barbara, Santa Barbara, CA (United States); Max-Planck-Institut für Astronomie, Heidelberg (Germany); Prochaska, J. Xavier [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, Santa Cruz, Santa Cruz, CA (United States); Crighton, Neil H. M. [Centre for Astrophysics and Supercomputing, Swinburne University of Technology, Melbourne, VIC (Australia); Lukić, Zarija [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Oñorbe, Jose, E-mail: tschmidt@mpia.de [Max-Planck-Institut für Astronomie, Heidelberg (Germany)

2017-10-17

The reionization of helium at z ~ 3 is the final phase transition of the intergalactic medium and supposed to be driven purely by quasars. The He ii transverse proximity effect—enhanced He ii transmission in a background sightline caused by the ionizing radiation of a foreground quasar—therefore offers a unique opportunity to probe the morphology of He ii reionization and to investigate the emission properties of quasars, e.g., ionizing emissivity, lifetime and beaming geometry. We use the most-recent HST/COS far-UV dataset of 22 He ii absorption spectra and conduct our own dedicated optical spectroscopic survey to find foreground quasars around these He ii sightlines. Based on a set of 66 foreground quasars, we perform the first statistical analysis of the He ii transverse proximity effect. Despite a large object-to-object variance, our stacking analysis reveals an excess in the average He ii transmission near the foreground quasars at 3σ significance. This statistical evidence for the transverse proximity effect is corroborated by a clear dependence of the signal strength on the inferred He ii ionization rate at the background sightline. Our detection places, based on the transverse light crossing time, a geometrical limit on the quasar lifetime of t{sub Q} > 25 Myr. This evidence for sustained activity of luminous quasars is relevant for the morphology of H i and He ii reionization and helps to constrain AGN triggering mechanisms, accretion physics and models of black hole mass assembly. We show how future modeling of the transverse proximity effect can additionally constrain quasar emission geometries and e.g., clarify if the large observed object-to-object variance can be explained by current models of quasar obscuration.

DISCOVERING THE MISSING 2.2 < z < 3 QUASARS BY COMBINING OPTICAL VARIABILITY AND OPTICAL/NEAR-INFRARED COLORS

International Nuclear Information System (INIS)

Wu Xuebing; Wang Ran; Bian Fuyan; Jiang Linhua; Fan Xiaohui; Schmidt, Kasper B.

2011-01-01

The identification of quasars in the redshift range 2.2 < z < 3 is known to be very inefficient because the optical colors of such quasars are indistinguishable from those of stars. Recent studies have proposed using optical variability or near-infrared (near-IR) colors to improve the identification of the missing quasars in this redshift range. Here we present a case study combining both methods. We select a sample of 70 quasar candidates from variables in Sloan Digital Sky Survey (SDSS) Stripe 82, which are non-ultraviolet excess sources and have UKIDSS near-IR public data. They are clearly separated into two parts on the Y - K/g - z color-color diagram, and 59 of them meet or lie close to a newly proposed Y - K/g - z selection criterion for z < 4 quasars. Of these 59 sources, 44 were previously identified as quasars in SDSS DR7, and 35 of them are quasars at 2.2 < z < 3. We present spectroscopic observations of 14 of 15 remaining quasar candidates using the Bok 2.3 m telescope and the MMT 6.5 m telescope, and successfully identify all of them as new quasars at z = 2.36-2.88. We also apply this method to a sample of 643 variable quasar candidates with SDSS-UKIDSS nine-band photometric data selected from 1875 new quasar candidates in SDSS Stripe 82 given by Butler and Bloom based on the time-series selections, and find that 188 of them are probably new quasars with photometric redshifts at 2.2 < z < 3. Our results indicate that the combination of optical variability and optical/near-IR colors is probably the most efficient way to find 2.2 < z < 3 quasars and is very helpful for constructing a complete quasar sample. We discuss its implications for ongoing and upcoming large optical and near-IR sky surveys.

Quasars Probing Quasars. X. The Quasar Pair Spectral Database

Science.gov (United States)

Findlay, Joseph R.; Prochaska, J. Xavier; Hennawi, Joseph F.; Fumagalli, Michele; Myers, Adam D.; Bartle, Stephanie; Chehade, Ben; DiPompeo, Michael A.; Shanks, Tom; Lau, Marie Wingyee; Rubin, Kate H. R.

2018-06-01

The rare close projection of two quasars on the sky provides the opportunity to study the host galaxy environment of a foreground quasar in absorption against the continuum emission of a background quasar. For over a decade the “Quasars probing quasars” series has utilized this technique to further the understanding of galaxy formation and evolution in the presence of a quasar at z > 2, resolving scales as small as a galactic disk and from bound gas in the circumgalactic medium to the diffuse environs of intergalactic space. Presented here is the public release of the quasar pair spectral database utilized in these studies. In addition to projected pairs at z > 2, the database also includes quasar pair members at z useful for small-scale clustering studies. In total, the database catalogs 5627 distinct objects, with 4083 lying within 5‧ of at least one other source. A spectral library contains 3582 optical and near-infrared spectra for 3028 of the cataloged sources. As well as reporting on 54 newly discovered quasar pairs, we outline the key contributions made by this series over the last 10 years, summarize the imaging and spectroscopic data used for target selection, discuss the target selection methodologies, describe the database content, and explore some avenues for future work. Full documentation for the spectral database, including download instructions, is supplied at http://specdb.readthedocs.io/en/latest/.

An ultraluminous quasar with a twelve-billion-solar-mass black hole at redshift 6.30.

Science.gov (United States)

Wu, Xue-Bing; Wang, Feige; Fan, Xiaohui; Yi, Weimin; Zuo, Wenwen; Bian, Fuyan; Jiang, Linhua; McGreer, Ian D; Wang, Ran; Yang, Jinyi; Yang, Qian; Thompson, David; Beletsky, Yuri

2015-02-26

So far, roughly 40 quasars with redshifts greater than z = 6 have been discovered. Each quasar contains a black hole with a mass of about one billion solar masses (10(9) M Sun symbol). The existence of such black holes when the Universe was less than one billion years old presents substantial challenges to theories of the formation and growth of black holes and the coevolution of black holes and galaxies. Here we report the discovery of an ultraluminous quasar, SDSS J010013.02+280225.8, at redshift z = 6.30. It has an optical and near-infrared luminosity a few times greater than those of previously known z > 6 quasars. On the basis of the deep absorption trough on the blue side of the Lyman-α emission line in the spectrum, we estimate the proper size of the ionized proximity zone associated with the quasar to be about 26 million light years, larger than found with other z > 6.1 quasars with lower luminosities. We estimate (on the basis of a near-infrared spectrum) that the black hole has a mass of ∼1.2 × 10(10) M Sun symbol, which is consistent with the 1.3 × 10(10) M Sun symbol derived by assuming an Eddington-limited accretion rate.

Clustering of very luminous infrared galaxies and their environment

Science.gov (United States)

Gao, YU

1993-01-01

The IRAS survey reveals a class of ultraluminous infrared (IR) galaxies (ULIRG's) with IR luminosities comparable to the bolometric luminosities of quasars. The nature, origin, and evolution of ULIRG's are attracting more and more attention recently. Since galaxy morphology is certainly a function of environment, morphological observations show that ULIRG's are interacting/merging galaxies, and some ULIRG's might be the dust-enshrouded quasars (S88) or giant ellipticals, the study of ULIRG's environment and large scale clustering effects should be worthwhile. ULIRG's and very luminous IR galaxies have been selected from the 2Jy IRAS redshift survey. Meanwhile, a catalog of IRAS groups of galaxies has been constructed using a percolation-like algorithm. Therefore, whether ULIRG's and/or VLIRG's have a group environment can be checked immediately. Other aspects of the survey are discussed.

Circum-Galactic Medium in the Halo of Quasars

Directory of Open Access Journals (Sweden)

Riccardo Ottolina

2017-12-01

Full Text Available The properties of circum-galactic gas in the halo of quasar host galaxies are investigated analyzing Mg II 2800 and C IV 1540 absorption-line systems along the line of sight close to quasars. We used optical spectroscopy of closely aligned pairs of quasars (projected distance ≤ 200 kpc, but at very different redshift obtained at the VLT and Gran Telescopio Canarias to investigate the distribution of the absorbing gas for a sample of quasars at z ~1. Absorption systems of EW ≥0.3 associated with the foreground quasars are revealed up to 200 kpc from the centre of the host galaxy, showing that the structure of the absorbing gas is patchy with a covering fraction quickly decreasing beyond 100 kpc. In this contribution we use optical and near-IR images obtained at VLT to investigate the relations between the properties of the circum-galactic medium of the host galaxies and of the large scale galaxy environments of the foreground quasars.

BROAD ABSORPTION LINE DISAPPEARANCE ON MULTI-YEAR TIMESCALES IN A LARGE QUASAR SAMPLE

Energy Technology Data Exchange (ETDEWEB)

Filiz Ak, N.; Brandt, W. N.; Schneider, D. P. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Hall, P. B. [Department of Physics and Astronomy, York University, 4700 Keele St., Toronto, Ontario M3J 1P3 (Canada); Anderson, S. F.; Gibson, R. R. [Astronomy Department, University of Washington, Seattle, WA 98195 (United States); Lundgren, B. F. [Department of Physics, Yale University, New Haven, CT 06511 (United States); Myers, A. D. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); Petitjean, P. [Institut d' Astrophysique de Paris, Universite Paris 6, F-75014, Paris (France); Ross, Nicholas P. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 92420 (United States); Shen Yue [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-51, Cambridge, MA 02138 (United States); York, D. G. [Department of Astronomy and Astrophysics, and Enrico Fermi Institute, University of Chicago, 5640 S. Ellis Ave., Chicago, IL 60637 (United States); Bizyaev, D.; Brinkmann, J.; Malanushenko, E.; Oravetz, D. J.; Pan, K.; Simmons, A. E. [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349-0059 (United States); Weaver, B. A., E-mail: nfilizak@astro.psu.edu [Center for Cosmology and Particle Physics, New York University, New York, NY 10003 (United States)

2012-10-01

We present 21 examples of C IV broad absorption line (BAL) trough disappearance in 19 quasars selected from systematic multi-epoch observations of 582 bright BAL quasars (1.9 < z < 4.5) by the Sloan Digital Sky Survey-I/II (SDSS-I/II) and SDSS-III. The observations span 1.1-3.9 yr rest-frame timescales, longer than have been sampled in many previous BAL variability studies. On these timescales, Almost-Equal-To 2.3% of C IV BAL troughs disappear and Almost-Equal-To 3.3% of BAL quasars show a disappearing trough. These observed frequencies suggest that many C IV BAL absorbers spend on average at most a century along our line of sight to their quasar. Ten of the 19 BAL quasars showing C IV BAL disappearance have apparently transformed from BAL to non-BAL quasars; these are the first reported examples of such transformations. The BAL troughs that disappear tend to be those with small-to-moderate equivalent widths, relatively shallow depths, and high outflow velocities. Other non-disappearing C IV BALs in those nine objects having multiple troughs tend to weaken when one of them disappears, indicating a connection between the disappearing and non-disappearing troughs, even for velocity separations as large as 10,000-15,000 km s{sup -1}. We discuss possible origins of this connection including disk-wind rotation and changes in shielding gas.

MAD ADAPTIVE OPTICS IMAGING OF HIGH-LUMINOSITY QUASARS: A PILOT PROJECT

Energy Technology Data Exchange (ETDEWEB)

Liuzzo, E. [Osservatorio di Radioastronomia, INAF, via Gobetti 101, I-40129 Bologna (Italy); Falomo, R.; Paiano, S.; Baruffolo, A.; Farinato, J.; Moretti, A.; Ragazzoni, R. [Osservatorio Astronomico di Padova, INAF, vicolo dell’Osservatorio 5, I-35122 Padova (Italy); Treves, A. [Università dell’Insubria (Como) (Italy); Uslenghi, M. [INAF-IASF, via E. Bassini 15, I-20133 Milano (Italy); Arcidiacono, C.; Diolaiti, E.; Lombini, M. [Osservatorio Astronomico di Bologna, INAF, Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Brast, R. [Dipartimento di Fisica e Astronomia, Università di Bologna, Via Irnerio, 46, I-40126, Bologna (Italy); Donaldson, R.; Kolb, J.; Marchetti, E.; Tordo, S., E-mail: liuzzo@ira.inaf.it [European Southern Observatory, Karl-Schwarschild-Strasse 2, D-85748 Garching bei München (Germany)

2016-08-01

We present near-IR images of five luminous quasars at z ∼ 2 and one at z ∼ 4 obtained with an experimental adaptive optics (AO) instrument at the European Southern Observatory Very Large Telescope. The observations are part of a program aimed at demonstrating the capabilities of multi-conjugated adaptive optics imaging combined with the use of natural guide stars for high spatial resolution studies on large telescopes. The observations were mostly obtained under poor seeing conditions but in two cases. In spite of these nonoptimal conditions, the resulting images of point sources have cores of FWHM ∼ 0.2 arcsec. We are able to characterize the host galaxy properties for two sources and set stringent upper limits to the galaxy luminosity for the others. We also report on the expected capabilities for investigating the host galaxies of distant quasars with AO systems coupled with future Extremely Large Telescopes. Detailed simulations show that it will be possible to characterize compact (2–3 kpc) quasar host galaxies for quasi-stellar objects at z = 2 with nucleus K -magnitude spanning from 15 to 20 (corresponding to absolute magnitude −31 to −26) and host galaxies that are 4 mag fainter than their nuclei.

MAD Adaptive Optics Imaging of High-luminosity Quasars: A Pilot Project

Science.gov (United States)

Liuzzo, E.; Falomo, R.; Paiano, S.; Treves, A.; Uslenghi, M.; Arcidiacono, C.; Baruffolo, A.; Diolaiti, E.; Farinato, J.; Lombini, M.; Moretti, A.; Ragazzoni, R.; Brast, R.; Donaldson, R.; Kolb, J.; Marchetti, E.; Tordo, S.

2016-08-01

We present near-IR images of five luminous quasars at z ˜ 2 and one at z ˜ 4 obtained with an experimental adaptive optics (AO) instrument at the European Southern Observatory Very Large Telescope. The observations are part of a program aimed at demonstrating the capabilities of multi-conjugated adaptive optics imaging combined with the use of natural guide stars for high spatial resolution studies on large telescopes. The observations were mostly obtained under poor seeing conditions but in two cases. In spite of these nonoptimal conditions, the resulting images of point sources have cores of FWHM ˜ 0.2 arcsec. We are able to characterize the host galaxy properties for two sources and set stringent upper limits to the galaxy luminosity for the others. We also report on the expected capabilities for investigating the host galaxies of distant quasars with AO systems coupled with future Extremely Large Telescopes. Detailed simulations show that it will be possible to characterize compact (2-3 kpc) quasar host galaxies for quasi-stellar objects at z = 2 with nucleus K-magnitude spanning from 15 to 20 (corresponding to absolute magnitude -31 to -26) and host galaxies that are 4 mag fainter than their nuclei.

9 CFR 109.3 - Pasteurizers.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurizers. 109.3 Section 109.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STERILIZATION AND PASTEURIZATION AT...

Using the Properties of Broad Absorption Line Quasars to Illuminate Quasar Structure

Science.gov (United States)

Yong, Suk Yee; King, Anthea L.; Webster, Rachel L.; Bate, Nicholas F.; O'Dowd, Matthew J.; Labrie, Kathleen

2018-06-01

A key to understanding quasar unification paradigms is the emission properties of broad absorption line quasars (BALQs). The fact that only a small fraction of quasar spectra exhibit deep absorption troughs blueward of the broad permitted emission lines provides a crucial clue to the structure of quasar emitting regions. To learn whether it is possible to discriminate between the BALQ and non-BALQ populations given the observed spectral properties of a quasar, we employ two approaches: one based on statistical methods and the other supervised machine learning classification, applied to quasar samples from the Sloan Digital Sky Survey. The features explored include continuum and emission line properties, in particular the absolute magnitude, redshift, spectral index, line width, asymmetry, strength, and relative velocity offsets of high-ionisation C IV λ1549 and low-ionisation Mg II λ2798 lines. We consider a complete population of quasars, and assume that the statistical distributions of properties represent all angles where the quasar is viewed without obscuration. The distributions of the BALQ and non-BALQ sample properties show few significant differences. None of the observed continuum and emission line features are capable of differentiating between the two samples. Most published narrow disk-wind models are inconsistent with these observations, and an alternative disk-wind model is proposed. The key feature of the proposed model is a disk-wind filling a wide opening angle with multiple radial streams of dense clumps.

A Hungry Quasar Caught in the Act

Science.gov (United States)

2001-05-01

The VLT Secures Spectacular Image of Distant Gravitational Interaction Summary A new image of a distant quasar (the luminous core of an "active" galaxy) shows that it is engaged in a gravitational battle with its neighbouring galaxies . It also provides information on how supermassive black holes present in the center of quasars are fed. Using the FORS2 multi-mode instrument at the ESO 8.2-m VLT KUEYEN telescope on Paranal (Chile), a team of German astronomers [1] obtained a spectacular image of the close and complex environment of the distant quasar "HE 1013-2136", located some 10 billion light-years away [2]. The remarkable structures revealed in this photo lend support to the hypothesis that quasar activity is connected to gravitational interaction between galaxies, already at this early epoch of the Universe (about 5 billion years after the Big Bang). PR Photo 20a/01 : A VLT image of the Quasar HE 1013-2136 . PR Photo 20b/01 : A sharpened version of the same image. Feeding the Black Hole "Quasars" (Quasi-Stellar Objects) were first discovered by Dutch-American astronomer Maarten Schmidt in 1963 as distant, energetic objects of star-like appearance. Since then, more than 15,000 quasars have been found and we now know that they are the luminous cores at the heart of distant galaxies. Such "Active Galactic Nuclei (AGN)" are thought to host Supermassive Black Holes of up to one billion solar masses at their centres. Black Holes represent the densest possible state of matter; if the Earth were to become one, it would measure no more than a few millimetres across. The Black Hole in a galaxy gobbles up the gas and dust of its host, a process that efficiently powers the luminous core that we observe as a point-like "quasar". A Black Hole must be continuously fed to remain active. During an active phase of typically 100 million years, the Black Hole in a quasar swallows material with a total weight of up to 10 solar masses every year. This may be predominantly in the

Formación estelar y AGNs en los entornos de quasars

Science.gov (United States)

Coldwell, G.; García Lambas, D.

En este trabajo utilizamos las galaxias del catálogo 2dF (2dF public 100K data release) y muestras de quasars tomados del catálogo Verón-Cetty & Verón (2001) para estudiar la naturaleza de estas galaxias en los entornos de quasars con redshift en el rango 0.1en una muestra de galaxias random del catálogo 2dF y en una muestra de cúmulos Abell con similar distribución de redshift que los quasars. Los resultados indican que existe una gran fracción de galaxias con fuertes líneas de emisión, eta > 3.5, en los entornos de quasars comparado con la fracción presente en las vecindades de galaxias típicas del 2dF. Analizamos las distribuciones de luminosidad para estas galaxias (eta > 3.5) encontrando un exceso de galaxias mas luminosas que M ˜ -19.5 en las vecindades de quasars, indicativo de la posible presencia de AGNs. Por otro lado, estimamos la tasa de formación estelar promedio para objetos a distintas distancias de quasars, galaxias y cúmulos de galaxias detectando una actividad de formacion estelar significativamente alta dentro de 1.5 Mpc h-1 de quasars con respecto a las galaxias del 2dF. Estos resultados proveen evidencia de un particular entorno de galaxias alrededor de Quasars.

STELLAR VELOCITY DISPERSION MEASUREMENTS IN HIGH-LUMINOSITY QUASAR HOSTS AND IMPLICATIONS FOR THE AGN BLACK HOLE MASS SCALE

Energy Technology Data Exchange (ETDEWEB)

Grier, C. J.; Martini, P.; Peterson, B. M.; Pogge, R. W.; Zu, Y. [Department of Astronomy, Ohio State University, 140 W 18th Avenue, Columbus, OH 43210 (United States); Watson, L. C. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Bentz, M. C. [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States); Dasyra, K. M. [Observatoire de Paris, LERMA (CNRS:UMR8112), 61 Avenue de l' Observatoire, F-75014, Paris (France); Dietrich, M. [Department of Physics and Astronomy, Ohio University, Athens, OH 45601 (United States); Ferrarese, L. [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria BV V9E 2E7 (Canada)

2013-08-20

We present new stellar velocity dispersion measurements for four luminous quasars with the Near-Infrared Integral Field Spectrometer instrument and the ALTAIR laser guide star adaptive optics system on the Gemini North 8 m telescope. Stellar velocity dispersion measurements and measurements of the supermassive black hole (BH) masses in luminous quasars are necessary to investigate the coevolution of BHs and galaxies, trace the details of accretion, and probe the nature of feedback. We find that higher-luminosity quasars with higher-mass BHs are not offset with respect to the M{sub BH}-{sigma}{sub *} relation exhibited by lower-luminosity active galactic nuclei (AGNs) with lower-mass BHs, nor do we see correlations with galaxy morphology. As part of this analysis, we have recalculated the virial products for the entire sample of reverberation-mapped AGNs and used these data to redetermine the mean virial factor (f) that places the reverberation data on the quiescent M{sub BH}-{sigma}{sub *} relation. With our updated measurements and new additions to the AGN sample, we obtain (f) = 4.31 {+-} 1.05, which is slightly lower than, but consistent with, most previous determinations.

ESO 113-IG45 galaxy and/or quasar?

CERN Document Server

West, R M; Danks, A C

1978-01-01

Spectroscopy, UBV photometry and photography have been obtained of the extraordinary 13th magnitude object ESO 113-IG45 identified as a Seyfert galaxy by Fairall (1977); R.A.=01/sup h/ 21/sup m/.9; Decl .=-59 degrees 04' (1950). V/sub 0/=13630+or-50 km s/sup -1/; M/sub V /=-24/sup m/.0; largest diameter 75 kpc or more (with H/sub 0/=55 km s /sup -1/ Mpc/sup -1/). The nucleus is stellar-like and several times more luminous than the surrounding envelope which has a well-developed lane-structure. It is the intrinsically most luminous Seyfert nuclear yet known, and may be described as a 'quasar in the center of a (spiral) galaxy'. It is probably associated with the X-ray source 2A0120-591. (14 refs).

The X-Ray Reflection Spectrum of the Radio-loud Quasar 4C 74.26

DEFF Research Database (Denmark)

Lohfink, Anne M.; Fabian, Andrew C.; Ballantyne, David R.

2017-01-01

of the supermassive black hole, the presumed jet launching point, are potentially particularly valuable in illuminating the jet formation process. Here, we present the hard X-ray NuSTAR observations of the radio-loud quasar 4C 74.26 in a joint analysis with quasi-simultaneous, soft X-ray Swift observations. Our...... the three months covered by our NuSTAR campaign. This lack of variation could mean that the jet formation in this radio-loud quasar differs from what is observed in broad-line radio galaxies....

ALMA SCIENCE VERIFICATION DATA: MILLIMETER CONTINUUM POLARIMETRY OF THE BRIGHT RADIO QUASAR 3C 286

Energy Technology Data Exchange (ETDEWEB)

Nagai, H.; Nakanishi, K.; Hada, K. [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan); Paladino, R. [INAF-Osservatorio di Radioastronomia, Via P. Gobetti, 101 I-40129 Bologna (Italy); Hull, C. L. H. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Cortes, P.; Fomalont, E. [Joint ALMA Observatory, Alonso de Córdova 3107, Vitacura 763 0355, Santiago de Chile (Chile); Moellenbrock, G. [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Asada, K., E-mail: hiroshi.nagai@nao.ac.jp [The Academia Sinica Institute of Astronomy and Astrophysics, AS/NTU. No.1, Sec. 4, Roosevelt Rd, Taipei 10617, Taiwan, R.O.C (China)

2016-06-20

We present full-polarization observations of the compact, steep-spectrum radio quasar 3C 286 made with the Atacama Large Millimeter and Submillimeter Array (ALMA) at 1.3 mm. These are the first full-polarization ALMA observations, which were obtained in the framework of Science Verification. A bright core and a south–west component are detected in the total intensity image, similar to previous centimeter images. Polarized emission is also detected toward both components. The fractional polarization of the core is about 17%; this is higher than the fractional polarization at centimeter wavelengths, suggesting that the magnetic field is even more ordered in the millimeter radio core than it is further downstream in the jet. The observed polarization position angle (or electric vector position angle (EVPA)) in the core is ∼39{sup ◦}, which confirms the trend that the EVPA slowly increases from centimeter to millimeter wavelengths. With the aid of multi-frequency VLBI observations, we argue that this EVPA change is associated with the frequency-dependent core position. We also report a serendipitous detection of a sub-mJy source in the field of view, which is likely to be a submillimeter galaxy.

41 CFR 109-45.303-3 - Delivery.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Delivery. 109-45.303-3 Section 109-45.303-3 Public Contracts and Property Management Federal Property Management Regulations..., ABANDONMENT, OR DESTRUCTION OF PERSONAL PROPERTY 45.3-Sale of Personal Property § 109-45.303-3 Delivery. (a...

Quasars and cosmology

International Nuclear Information System (INIS)

Fliche, H.-H.; Souriau, J.-M.

1978-03-01

On the basis of colorimetric data a composite spectrum of quasars is established from the visible to the Lyman's limit. Its agreement with the spectrum of the quasar 3C273, obtained directly, confirms the homogeneity of these objects. The compatibility of the following hypotheses: negligible evolution of quasars, Friedmann type model of the universe with cosmological constant, is studied by means of two tests: a non-correlation test adopted to the observation conditions and the construction of diagrams (absolute magnitude, volume) using the K-correction deduced from the composite spectrum. This procedure happens to give relatively well-defined values of the parameters; the central values of the density parameter, the reduced curvature and the reduced cosmological constant are: Ω 0 =0.053, k 0 =0.245, lambda-zero=1.19, which correspond to a big bang model, eternally expanding, spatially finite, in which Hubble's parameter H is presently increasing. This model responds well to different cosmological tests: density of matter, diameter of radio sources, age of the universe. Its characteristics suggest various cosmogonic mechanisms, espacially mass formation by growth of empty spherical bubbles [fr

Signs of depth-luminance covariance in 3-D cluttered scenes.

Science.gov (United States)

Scaccia, Milena; Langer, Michael S

2018-03-01

In three-dimensional (3-D) cluttered scenes such as foliage, deeper surfaces often are more shadowed and hence darker, and so depth and luminance often have negative covariance. We examined whether the sign of depth-luminance covariance plays a role in depth perception in 3-D clutter. We compared scenes rendered with negative and positive depth-luminance covariance where positive covariance means that deeper surfaces are brighter and negative covariance means deeper surfaces are darker. For each scene, the sign of the depth-luminance covariance was given by occlusion cues. We tested whether subjects could use this sign information to judge the depth order of two target surfaces embedded in 3-D clutter. The clutter consisted of distractor surfaces that were randomly distributed in a 3-D volume. We tested three independent variables: the sign of the depth-luminance covariance, the colors of the targets and distractors, and the background luminance. An analysis of variance showed two main effects: Subjects performed better when the deeper surfaces were darker and when the color of the target surfaces was the same as the color of the distractors. There was also a strong interaction: Subjects performed better under a negative depth-luminance covariance condition when targets and distractors had different colors than when they had the same color. Our results are consistent with a "dark means deep" rule, but the use of this rule depends on the similarity between the color of the targets and color of the 3-D clutter.

Determining Central Black Hole Masses in Distant Active Galaxies and Quasars. II. Improved Optical and UV Scaling Relationships

DEFF Research Database (Denmark)

Vestergaard, Marianne; Peterson, B. M.

2006-01-01

We present four improved empirical relationships useful for estimating the central black hole mass in nearby AGNs and distant luminous quasars alike using either optical or UV single-epoch spectroscopy. These mass-scaling relationships between line widths and luminosity are based on recently...

3.3 Å structure of Niemann–Pick C1 protein reveals insights into the function of the C-terminal luminal domain in cholesterol transport

Energy Technology Data Exchange (ETDEWEB)

Li, Xiaochun; Lu, Feiran; Trinh, Michael N.; Schmiege, Philip; Seemann, Joachim; Wang, Jiawei; Blobel, Günter

2017-08-07

Niemann–Pick C1 (NPC1) and NPC2 proteins are indispensable for the export of LDL-derived cholesterol from late endosomes. Mutations in these proteins result in Niemann–Pick type C disease, a lysosomal storage disease. Despite recent reports of the NPC1 structure depicting its overall architecture, the function of its C-terminal luminal domain (CTD) remains poorly understood even though 45% of NPC disease-causing mutations are in this domain. Here, we report a crystal structure at 3.3 Å resolution of NPC1* (residues 314–1,278), which—in contrast to previous lower resolution structures—features the entire CTD well resolved. Notably, all eight cysteines of the CTD form four disulfide bonds, one of which (C909–C914) enforces a specific loop that in turn mediates an interaction with a loop of the N-terminal domain (NTD). Importantly, this loop and its interaction with the NTD were not observed in any previous structures due to the lower resolution. Our mutagenesis experiments highlight the physiological relevance of the CTD–NTD interaction, which might function to keep the NTD in the proper orientation for receiving cholesterol from NPC2. Additionally, this structure allows us to more precisely map all of the disease-causing mutations, allowing future molecular insights into the pathogenesis of NPC disease.

Discovery and spectrophotometry of high-redshift quasars

International Nuclear Information System (INIS)

MacAlpine, G.M.; Feldman, F.R.

1982-01-01

We report on the discovery and spectrophotometry of 30 new high-redshift quasars, which were detected using the Curtis Schmidt technique. We also discuss new follow-up spectrophotometry for 23 quasar candidates from University of Michigan Lists I--IV. Our program sample contains eight quasars with z>3, at least five objects exhibiting broad absorption troughs, and a pair of quasars which are 1' apart on the sky and nearly identical in redshift, at z near 2.13. The redshift distribution for the majority of quasars in UM List IV suggests that most of the single-line quasar candidates in the UM List have low to moderate redshifts, with the reported line often being Mg II lambda2798 or C III] lambda1909. For 17 high-redshift quasars where lambda912 at the emission-line redshift could be examined, we did not find any definite Lyman limit cutoffs. Although three objects show a decline of the continuum within 100 A of lambda912, we do not believe them to be unambiguous examples for emission-line clouds situated in the line of sight. When our O I lambda1304 measurements are combined with the data of others to yield a composite spectrum, we obtain O I lambda1304/lambda8446 = 1.35. This suggests reddening with E/sub B/-Vroughly-equal0.23. Finally, our data exhibit a correlation between Lyα emission line velocity widths and redshift. The higher z quasars in the sample tend to have narrower lines, due, at least in part, to bias in the detection technique

A Massive X-ray Outflow From The Quasar PDS 456

Science.gov (United States)

Reeves, J. N.; O'Brien, P. T.; Ward, M. J.

2003-01-01

We report on XMM-Newton spectroscopic observations of the luminous, radio-quiet quasar PDS 456. The hard X-ray spectrum of PDS 456 shows a deep absorption trough (constituting 50% of the continuum) at energies above 7 keV in the quasar rest frame, which can be attributed to a series of blue-shifted K-shell absorption edges due to highly ionized iron. The higher resolution soft X-ray grating RGS spectrum exhibits a broad absorption line feature near 1 keV, which can be modeled by a blend of L-shell transitions from highly ionized iron (Fe XVII - XXIV). An extreme outflow velocity of approx. 50000 km/s is required to model the K and L shell iron absorption present in the XMM-Newton data. Overall, a large column density (N(sub H) = 5 x 10(exp 23)/sq cm) of highly ionized gas (log xi = 2.5) is required in PDS 456. A large mass outflow rate of approx. 10 solar mass/year (assuming a conservative outflow covering factor of 0.1 steradian) is derived, which is of the same order as the overall mass accretion rate in PDS 456. This represents a substantial fraction (approx. 10%) of the quasar energy budget, whilst the large column and outflow velocity place PDS 456 towards the extreme end of the broad absorption line quasar population.

THE SUBARU HIGH-z QUASAR SURVEY: DISCOVERY OF FAINT z ∼ 6 QUASARS

International Nuclear Information System (INIS)

Kashikawa, Nobunari; Furusawa, Hisanori; Niino, Yuu; Ishizaki, Yoshifumi; Onoue, Masafusa; Toshikawa, Jun; Ishikawa, Shogo; Willott, Chris J.; Im, Myungshin; Shimasaku, Kazuhiro; Ouchi, Masami; Hibon, Pascale

2015-01-01

We present the discovery of one or two extremely faint z ∼ 6 quasars in 6.5 deg 2 utilizing a unique capability of the wide-field imaging of the Subaru/Suprime-Cam. The quasar selection was made in (i'-z B ) and (z B -z R ) colors, where z B and z R are bandpasses with central wavelengths of 8842 Å and 9841 Å, respectively. The color selection can effectively isolate quasars at z ∼ 6 from M/L/T dwarfs without the J-band photometry down to z R < 24.0, which is 3.5 mag deeper than the Sloan Digital Sky Survey (SDSS). We have selected 17 promising quasar candidates. The follow-up spectroscopy for seven targets identified one apparent quasar at z = 6.156 with M 1450 = –23.10. We also identified one possible quasar at z = 6.041 with a faint continuum of M 1450 = –22.58 and a narrow Lyα emission with HWHM =427 km s –1 , which cannot be distinguished from Lyman α emitters. We derive the quasar luminosity function at z ∼ 6 by combining our faint quasar sample with the bright quasar samples by SDSS and CFHQS. Including our data points invokes a higher number density in the faintest bin of the quasar luminosity function than the previous estimate employed. This suggests a steeper faint-end slope than lower z, though it is yet uncertain based on a small number of spectroscopically identified faint quasars, and several quasar candidates still remain to be diagnosed. The steepening of the quasar luminosity function at the faint end does increase the expected emission rate of the ionizing photon; however, it only changes by a factor of approximately two to six. This was found to still be insufficient for the required photon budget of reionization at z ∼ 6

Evolution of radio quasars from redshift 0.6-3.7

International Nuclear Information System (INIS)

Neff, S.G.; Hutchings, J.B.

1990-01-01

This paper presents the results of VLA radio imaging of 58 radio-loud quasars with redshift 2.0 or higher, which fill the redshift-luminosity plane as evenly as possible. This work completes a survey of about 250 quasars covering redshifts from 0.6-3.7, which attempts to sample luminosity and look-back time in a uniform way. Within the constraints of possible selection effects it is found that the relative population of extended and unresolved sources changes with redshift in a way that suggests that radio quasars may live longer and spend more time as large triple sources in the present epoch than in the earlier universe. There appear to be few low-luminosity radio quasars at high redshift. Ejection of material appears to occur on one side at a time, with usually at least one reversal of direction in the source lifetime. The velocity of ejection appears to be mildly relativistic at high redshift, but of lower velocity in the present epoch. There is also evidence suggestive of changes in the IGM with cosmic time; however, the data presented do not show the minimum in density at z about 2 that has been suggested for cluster environments. 11 refs

Milliarcsecond Imaging of the Radio Emission from the Quasar with the Most Massive Black Hole at Reionization

Energy Technology Data Exchange (ETDEWEB)

Wang, Ran; Wu, Xue-Bing; Jiang, Linhua [Kavli Institute of Astronomy and Astrophysics at Peking University, No. 5 Yiheyuan Road, Haidian District, Beijing 100871 (China); Momjian, Emmanuel; Carilli, Chris L. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Fan, Xiaohui [Steward Observatory, University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); Walter, Fabian [Max-Planck-Institute for Astronomy, Königsstuhl 17, D-69117 Heidelberg (Germany); Strauss, Michael A. [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Wang, Feige [Department of Astronomy, School of Physics, Peking University, No. 5 Yiheyuan Road, Haidian District, Beijing 100871 (China)

2017-02-01

We report Very Long Baseline Array (VLBA) observations of the 1.5 GHz radio continuum emission of the z = 6.326 quasar SDSS J010013.02+280225.8 (hereafter J0100+2802). J0100+2802 is by far the most optically luminous and is a radio-quiet quasar with the most massive black hole known at z > 6. The VLBA observations have a synthesized beam size of 12.10 mas ×5.36 mas (FWHM), and detected the radio continuum emission from this object with a peak surface brightness of 64.6 ± 9.0 μ Jy beam{sup −1} and a total flux density of 88 ± 19 μ Jy. The position of the radio peak is consistent with that from SDSS in the optical and Chandra in the X-ray. The radio source is marginally resolved by the VLBA observations. A 2D Gaussian fit to the image constrains the source size to (7.1 ± 3.5) mas × (3.1 ± 1.7) mas. This corresponds to a physical scale of (40 ± 20) pc × (18 ± 10) pc. We estimate the intrinsic brightness temperature of the VLBA source to be T {sub B} = (1.6 ± 1.2) × 10{sup 7} K. This is significantly higher than the maximum value in normal star-forming galaxies, indicating an active galactic nucleus (AGN) origin for the radio continuum emission. However, it is also significantly lower than the brightness temperatures found in highest-redshift radio-loud quasars. J0100+2802 provides a unique example for studying the radio activity in optically luminous and radio-quiet AGNs in the early universe. Further observations at multiple radio frequencies will accurately measure the spectral index and address the dominant radiation mechanism of the radio emission.

An Intercomparison Study of Two Proximate Damped Lyα Systems with Residual Flux upon the Lyα Absorption Trough toward Quasars

Science.gov (United States)

Xie, Xiaoyi; Zhou, Hongyan; Pan, Xiang; Jiang, Peng; Shi, Xiheng; Ji, Tuo; Zhang, Shaohua; Wu, Shengmiao; Zhong, Zhihao

2018-05-01

In this paper, we present an intercomparison study of two quasars, SDSS J145618.32+340037.2 and SDSS J215331.50–025514.1, which have proximate damped Lyα systems (PDLAs) with residual flux upon the Lyα absorption trough. Though they both have residual flux as luminous as 1043 erg s‑1, their PDLAs are quite different in, e.g., neutral hydrogen column density, metal line absorption strength, high-ionization absorption lines as well as residual flux strength. For J1456+3400, the H I column density is log(N H I /cm–2) = 20.6 ± 0.2, with z abs = 2.3138, nearly identical to the quasar redshift (z = 2.3142) determined from the [O III] emission line. The metallicity of this system is typical of DLAs and there is high ionization therein, suggesting that the PDLA system is multiphase, putting it in the quasar environment. For J2153–0255, we measure the H I column density to be log(N H I /cm–2) = 21.5 ± 0.1 at z abs = 3.511, slightly redshifted with respect to the quasar (z = 3.490) measured from C III]. The metallicity of this system is quite low and there is a lack of significant high-ionization absorption lines therein, suggesting that the system is beyond the quasar host galaxy. The residual flux is wide (∼1000 km s‑1) in J1456, with a significance of ∼8σ, while also wide (∼1500 km s‑1) but with a smaller significance of ∼3σ in J2153. Among many explanations, we find that Lyα fuzz or resonant scattering can be used to explain the residual flux in the two sources while partial coverage cannot be excluded for J1456. By comparing these two cases, together with a similar case reported previously, we suggest that the strength of the residual flux is related to properties such as metallicity and high-ionization absorption lines of PDLAs. The residual flux recorded upon the PDLA absorption trough opens a window for us to see the physical conditions and processes of the quasar environment, and their profile and strength further remind us of their

FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

Energy Technology Data Exchange (ETDEWEB)

Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J. [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Akiyama, Kazunori; Honma, Mareki [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan); Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan, R.O.C. (China); Bower, Geoffrey C.; Dexter, Matt [Department of Astronomy, Radio Astronomy Laboratory, University of California Berkeley, 601 Campbell, Berkeley, CA 94720-3411 (United States); Brinkerink, Christiaan [Department of Astrophysics, IMAPP, Radboud University Nijmegen, P.O. Box 9010, 6500-GL Nijmegen (Netherlands); Chamberlin, Richard [Caltech Submillimeter Observatory, 111 Nowelo Street, Hilo, HI 96720 (United States); Freund, Robert [Arizona Radio Observatory, Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721-0065 (United States); Friberg, Per [James Clerk Maxwell Telescope, Joint Astronomy Centre, 660 North A' ohoku Place, University Park, Hilo, HI 96720 (United States); Gurwell, Mark A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Jorstad, Svetlana G. [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Krichbaum, Thomas P. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany); Loinard, Laurent, E-mail: rslu@haystack.mit.edu [Centro de Radiostronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, 58089 Morelia, Michoacan (Mexico); and others

2013-07-20

We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of {approx}1 pc extending along the northwest-southeast direction (P.A. = 127 Degree-Sign {+-} 3 Degree-Sign ), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of {approx}8 Multiplication-Sign 10{sup 10} K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 {mu}as (5-7 light months) resolution.

FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

International Nuclear Information System (INIS)

Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J.; Akiyama, Kazunori; Honma, Mareki; Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto; Bower, Geoffrey C.; Dexter, Matt; Brinkerink, Christiaan; Chamberlin, Richard; Freund, Robert; Friberg, Per; Gurwell, Mark A.; Jorstad, Svetlana G.; Krichbaum, Thomas P.; Loinard, Laurent

2013-01-01

We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of ∼1 pc extending along the northwest-southeast direction (P.A. = 127° ± 3°), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of ∼8 × 10 10 K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 μas (5-7 light months) resolution.

THE HALO OCCUPATION DISTRIBUTION OF SDSS QUASARS

International Nuclear Information System (INIS)

Richardson, Jonathan; Chatterjee, Suchetana; Nagai, Daisuke; Zheng Zheng; Shen Yue

2012-01-01

We present an estimate of the projected two-point correlation function (2PCF) of quasars in the Sloan Digital Sky Survey (SDSS) over the full range of one- and two-halo scales, 0.02 h –1 Mpc p –1 Mpc. This was achieved by combining data from SDSS DR7 on large scales and Hennawi et al. (with appropriate statistical corrections) on small scales. Our combined clustering sample is the largest spectroscopic quasar clustering sample to date, containing ∼48, 000 quasars in the redshift range 0.4 ∼ sat = (7.4 ± 1.4) × 10 –4 , be satellites in dark matter halos. At z ∼ 1.4, the median masses of the host halos of central and satellite quasars are constrained to be M cen = 4.1 +0.3 –0.4 × 10 12 h –1 M ☉ and M sat = 3.6 +0.8 –1.0 × 10 14 h –1 M ☉ , respectively. To investigate the redshift evolution of the quasar-halo relationship, we also perform HOD modeling of the projected 2PCF measured by Shen et al. for SDSS quasars with median redshift 3.2. We find tentative evidence for an increase in the mass scale of quasar host halos—the inferred median mass of halos hosting central quasars at z ∼ 3.2 is M cen = 14.1 +5.8 –6.9 × 10 12 h –1 M ☉ . The cutoff profiles of the mean occupation functions of central quasars reveal that quasar luminosity is more tightly correlated with halo mass at higher redshifts. The average quasar duty cycle around the median host halo mass is inferred to be f q = 7.3 +0.6 –1.5 × 10 –4 at z ∼ 1.4 and f q = 8.6 +20.4 –7.2 × 10 –2 at z ∼ 3.2. We discuss the implications of our results for quasar evolution and quasar-galaxy co-evolution.

Erratum: "Space Density of Optically Selected Type 2 Quasars" (2008, AJ, 136, 2373)

Science.gov (United States)

Reyes, Reinabelle; Zakamska, Nadia L.; Strauss, Michael A.; Green, Joshua; Krolik, Julian H.; Shen, Yue; Richards, Gordon T.; Anderson, Scott F.; Schneider, Donald P.

2010-03-01

Figure 12 of the paper "Space Density of Optically Selected Type 2 Quasars" compares the obscured quasar fractions derived in our work with those of other studies. Unfortunately, some of the points from these other studies were shown incorrectly. Specifically, the results from X-ray data—Hasinger (2004; open circles) and Ueda et al. (2003; open squares)—which we had taken from Figure 16 of Hopkins et al. (2006), were affected by a luminosity conversion error, in the sense that the displayed luminosities for these data were too high by ~1 dex. With this erratum, we correct this problem and update the figure. The new version (Figure 12) shows more recent results from Hasinger (2008), in lieu of the Hasinger (2004) data points. These are based on data in the redshift range z = 0.2-3.2 (open circles) in that work. The best linear fit to these data (black dashed line) is consistent with that derived for the redshift slice z = 0.4-0.8, which overlaps with the highest redshift bin in our study, and is higher than that derived for redshifts smaller than 0.4 (corresponding to a shift of ~0.7 dex in luminosity). Figure 12 also shows estimates of the obscured quasar fraction derived from the ratio of IR to bolometric luminosities of an AGN sample at redshift z ~ 1 (Treister et al. 2008; filled triangles). Because the obscured quasar fractions derived from our analysis (colored arrows) are strict lower limits, there was already a hint in the previous version of Figure 12 that at high quasar luminosities, we find higher obscured quasar fractions than X-ray surveys. The correction and updates of Figure 12 strengthen this conclusion. At face value, our derived obscured quasar fractions are consistent with those from IR data (Treister et al. 2008; filled triangles). However, we find that they are significantly higher than those derived from X-ray surveys at L_[O\\,\\mathsc {iii]}\\gtrsim 10^{9.5}\\;L_{\\odot }, especially those from the recent analysis by Hasinger (2008). This

SDSS QUASARS IN THE WISE PRELIMINARY DATA RELEASE AND QUASAR CANDIDATE SELECTION WITH OPTICAL/INFRARED COLORS

International Nuclear Information System (INIS)

Wu Xuebing; Hao Guoqiang; Jia Zhendong; Zhang Yanxia; Peng Nanbo

2012-01-01

We present a catalog of 37,842 quasars in the Sloan Digital Sky Survey (SDSS) Data Release 7, which have counterparts within 6'' in the Wide-field Infrared Survey Explorer (WISE) Preliminary Data Release. The overall WISE detection rate of the SDSS quasars is 86.7%, and it decreases to less than 50.0% when the quasar magnitude is fainter than i = 20.5. We derive the median color-redshift relations based on this SDSS-WISE quasar sample and apply them to estimate the photometric redshifts of the SDSS-WISE quasars. We find that by adding the WISE W1- and W2-band data to the SDSS photometry we can increase the photometric redshift reliability, defined as the percentage of sources with photometric and spectroscopic redshift difference less than 0.2, from 70.3% to 77.2%. We also obtain the samples of WISE-detected normal and late-type stars with SDSS spectroscopy, and present a criterion in the z – W1 versus g – z color-color diagram, z – W1 > 0.66(g – z) + 2.01, to separate quasars from stars. With this criterion we can recover 98.6% of 3089 radio-detected SDSS-WISE quasars with redshifts less than four and overcome the difficulty in selecting quasars with redshifts between 2.2 and 3 from SDSS photometric data alone. We also suggest another criterion involving the WISE color only, W1 – W2 > 0.57, to efficiently separate quasars with redshifts less than 3.2 from stars. In addition, we compile a catalog of 5614 SDSS quasars detected by both WISE and UKIDSS surveys and present their color-redshift relations in the optical and infrared bands. By using the SDSS ugriz, UKIDSS, YJHK, and WISE W1- and W2-band photometric data, we can efficiently select quasar candidates and increase the photometric redshift reliability up to 87.0%. We discuss the implications of our results on the future quasar surveys. An updated SDSS-WISE quasar catalog consisting of 101,853 quasars with the recently released WISE all-sky data is also provided.

Dicty_cDB: SFE109 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII

High-Redshift Quasars Found in Sloan Digital Sky Survey Commissioning Data. II. The Spring Equatorial Stripe

International Nuclear Information System (INIS)

Fan, Xiaohui; Strauss, Michael A.; Schneider, Donald P.; Gunn, James E.; Lupton, Robert H.; Anderson, Scott F.; Voges, Wolfgang; Margon, Bruce; Annis, James; Bahcall, Neta A.

2000-01-01

This is the second paper in a series aimed at finding high-redshift quasars from five-color (u ' g ' r ' i ' z ' ) imaging data taken along the Celestial Equator by the Sloan Digital Sky Survey (SDSS) during its commissioning phase. In this paper, we present 22 high-redshift quasars (z>3.6) discovered from ∼250 deg2 of data in the spring Equatorial Stripe, plus photometry for two previously known high-redshift quasars in the same region of the sky. Our success rate in identifying high-redshift quasars is 68%. Five of the newly discovered quasars have redshifts higher than 4.6 (z=4.62, 4.69, 4.70, 4.92, and 5.03). All the quasars have i * B 0 =0.5). Several of the quasars show unusual emission and absorption features in their spectra, including an object at z=4.62 without detectable emission lines, and a broad absorption line (BAL) quasar at z=4.92. (c) (c) 2000. The American Astronomical Society

Hunting for Intrinsically X-ray Weak Quasars: The Case of PHL 1811 Analogs

Science.gov (United States)

Brandt, William

2009-09-01

A central dogma of X-ray astronomy is that luminous X-ray emission is a universal property of efficiently accreting supermassive black holes. One interesting challenge to this idea has come from the quasar PHL 1811 which appears to be intrinsically X-ray weak and also has distinctive emission-line properties. We propose to observe a sample of eight SDSS quasars, selected to have similar UV emission-line properties to that of PHL 1811, to test if they are also X-ray weak. Our analyses of the currently available X-ray data appear to support this hypothesis but do not provide a proper test. Our results will have implications for the nature of accretion-disk coronae, emission-line formation, and AGN selection.

The Gaseous Environments of Quasars: Outflows, Feedback & Cold Mode Accretion

Science.gov (United States)

Chen, Chen; Hamann, Fred

2018-06-01

The early stages of massive galaxy evolution can involve galaxy-scale outflows driven by a starburst or a central quasar and cold-mode accretion (infall) that adds to the mass buildup in the galaxies. I will describe three related studies that use quasar absorption lines to measure outflows, infall, and the general gaseous environments of quasars across a range of spatial scales. The three studies are: 1) High-resolution spectroscopy with Keck-HIRES and VLT-UVES to study associated absorption lines (AALs) that have redshifts greater than the emission redshifts indicating infall and/or rich multi-component AAL complexes that might be interstellar clouds in the host galaxies that have been shredded and dispersed by a fast unseen quasar-driven wind. The data provide strong constraints on the gas kinematics, spatial structure, column densities, metallicities, and energetics. 2) A complete inventory of high-velocity CIV 1548,1550 mini-BAL outflows in quasars using high-resolution high signal-to-noise spectra in the public VLT-UVES and Keck-HIRES archives. This sensitive mini-BAL survey fills an important niche between previous work on narrow absorption lines (NALs) and the much-studied broad absorption lines (BALs) to build a more complete picture of quasar outflows. I will report of the mini-BAL statistics, the diversity of lines detected, and some tests for correlations with the quasar properties. We find, for example, that mini-BALs at v > 4000 km/s in at least 10% of 511 quasars studied, including 1% at v > 0.1 c. Finally, 3) Use the much larger database of NALs measured in 262,449 BOSS quasars by York et al. (in prep.) to study their potential relationships to the quasars and, specifically, their origins in quasar outflows. This involves primarily comparisons of the incidence and properties of NALs at different velocity shifts to other measured properties of the quasars such as BAL outflows, emission line characteristics, radio-loudness, and red colors. We find

Gas-rich galaxy pair unveiled in the lensed quasar 0957+561

Science.gov (United States)

Planesas; Martin-Pintado; Neri; Colina

1999-12-24

Molecular gas in the host galaxy of the lensed quasar 0957+561 (QSO 0957+561) at the redshift of 1.41 has been detected in the carbon monoxide (CO) line. This detection shows the extended nature of the molecular gas distribution in the host galaxy and the pronounced lensing effects due to the differentially magnified CO luminosity at different velocities. The estimated mass of molecular gas is about 4 x 10(9) solar masses, a molecular gas mass typical of a spiral galaxy like the Milky Way. A second, weaker component of CO is interpreted as arising from a close companion galaxy that is rich in molecular gas and has remained undetected so far. Its estimated molecular gas mass is 1.4 x 10(9) solar masses, and its velocity relative to the main galaxy is 660 kilometers per second. The ability to probe the molecular gas distribution and kinematics of galaxies associated with high-redshift lensed quasars can be used to improve the determination of the Hubble constant H(0).

41 CFR 109-1.5108-3 - Stores inventories.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stores inventories. 109-1.5108-3 Section 109-1.5108-3 Public Contracts and Property Management Federal Property Management....51-Personal Property Management Standards and Practices § 109-1.5108-3 Stores inventories. Perpetual...

Catalog of 3 < z < 5.5 Quasar Candidates Selected among XMM-Newton Sources and Its Spectroscopic Verification

Energy Technology Data Exchange (ETDEWEB)

Khorunzhev, Georgii; Sazonov, Sergey; Burenin, Rodion [High Energy Astrophysics, Space Research Institute, Russian Academy of Sciences, Moscow (Russian Federation); Eselevich, Maxim, E-mail: horge@iki.rssi.ru [Laboratory of Infrared Methods in Astrophysics, Institute of Solar-Terrestrial Physics, Russian Academy of Sciences, Irkutsk (Russian Federation)

2017-11-13

We have compiled a catalog of 903 quasar candidates (including known quasars) at 3 < z < 5.5 selected among X-ray sources from the XMM-Newton serendipitous survey (3XMM-DR4 catalog). We used photometric SDSS, 2MASS, and WISE data to select the objects. The surface number density of objects in our sample exceeds that in the SDSS spectroscopic quasar sample at the same redshifts by a factor of 1.5. We have performed spectroscopic observations of a subsample of new quasar candidates using a new low- and medium-resolution spectrograph at the 1.6-m AZT-33IK telescope (Mondy, Russia) and demonstrated that the purity of these candidates is about 65%. We have discovered one of the most distant (z = 5.08) X-ray selected quasars.

Catalog of 3 < z < 5.5 Quasar Candidates Selected among XMM-Newton Sources and Its Spectroscopic Verification

Directory of Open Access Journals (Sweden)

Georgii Khorunzhev

2017-11-01

Full Text Available We have compiled a catalog of 903 quasar candidates (including known quasars at 3 < z < 5.5 selected among X-ray sources from the XMM-Newton serendipitous survey (3XMM-DR4 catalog. We used photometric SDSS, 2MASS, and WISE data to select the objects. The surface number density of objects in our sample exceeds that in the SDSS spectroscopic quasar sample at the same redshifts by a factor of 1.5. We have performed spectroscopic observations of a subsample of new quasar candidates using a new low- and medium-resolution spectrograph at the 1.6-m AZT-33IK telescope (Mondy, Russia and demonstrated that the purity of these candidates is about 65%. We have discovered one of the most distant (z = 5.08 X-ray selected quasars.

THE INTRINSIC FRACTIONS AND RADIO PROPERTIES OF LOW-IONIZATION BROAD ABSORPTION LINE QUASARS

International Nuclear Information System (INIS)

Dai Xinyu; Shankar, Francesco; Sivakoff, Gregory R.

2012-01-01

Low-ionization (Mg II, Fe II, and Fe III) broad absorption line quasars (LoBALs) probe a relatively obscured quasar population and could be at an early evolutionary stage for quasars. We study the intrinsic fractions of LoBALs using the Sloan Digital Sky Survey (SDSS), Two Micron All Sky Survey, and Faint Images of the Radio Sky at Twenty cm survey. We find that the LoBAL fractions of the near-infrared (NIR) and radio samples are approximately 5-7 times higher than those measured in the optical sample. This suggests that the fractions measured in the NIR and radio bands are closer to the intrinsic fractions of the populations, and that the optical fractions are significantly biased due to obscuration effects, similar to high-ionization broad absorption line quasars (HiBALs). Considering a population of obscured quasars that do not enter the SDSS, which could have a much higher LoBAL fraction, we expect that the intrinsic fraction of LoBALs could be even higher. We also find that the LoBAL fractions decrease with increasing radio luminosities, again, similarly to HiBALs. In addition, we find evidence for increasing fractions of LoBALs toward higher NIR luminosities, especially for FeLoBALs with a fraction of ∼18% at M K s < -31 mag. This population of NIR-luminous LoBALs may be at an early evolutionary stage of quasar evolution. To interpret the data, we use a luminosity-dependent model for LoBALs that yields significantly better fits than those from a pure geometric model.

Quasar Accretion Disk Sizes With Continuum Reverberation Mapping From the Dark Energy Survey

Energy Technology Data Exchange (ETDEWEB)

Mudd, D.; et al.

2017-11-30

We present accretion disk size measurements for 15 luminous quasars at $0.7 \\leq z \\leq 1.9$ derived from $griz$ light curves from the Dark Energy Survey. We measure the disk sizes with continuum reverberation mapping using two methods, both of which are derived from the expectation that accretion disks have a radial temperature gradient and the continuum emission at a given radius is well-described by a single blackbody. In the first method we measure the relative lags between the multiband light curves, which provides the relative time lag between shorter and longer wavelength variations. The second method fits the model parameters for the canonical Shakura-Sunyaev thin disk directly rather than solving for the individual time lags between the light curves. Our measurements demonstrate good agreement with the sizes predicted by this model for accretion rates between 0.3-1 times the Eddington rate. These results are also in reasonable agreement with disk size measurements from gravitational microlensing studies of strongly lensed quasars, as well as other photometric reverberation mapping results.

FLARING BEHAVIOR OF THE QUASAR 3C 454.3 ACROSS THE ELECTROMAGNETIC SPECTRUM

International Nuclear Information System (INIS)

Jorstad, Svetlana G.; Marscher, Alan P.; Chatterjee, Ritaban; D'Arcangelo, Francesca D.; Larionov, Valeri M.; Blinov, Dmitry A.; Hagen-Thorn, Vladimir A.; Konstantinova, Tatiana S.; Kopatskaya, Evgenia N.; Agudo, Ivan; Gomez, Jose L.; Smith, Paul S.; Gurwell, Mark; Laehteenmaeki, Anne; Tornikoski, Merja; Markowitz, Alex; Arkharov, Arkadi A.; Falcone, Abe D.; Jordan, Brendan; Kimeridze, Givi N.

2010-01-01

We analyze the behavior of the parsec-scale jet of the quasar 3C 454.3 during pronounced flaring in 2005-2008. Three major disturbances propagated down the jet along different trajectories with Lorentz factors Γ > 10. The disturbances show a clear connection with millimeter-wave outbursts, in 2005 May/June, 2007 July, and 2007 December. High-amplitude optical events in the R-band light curve precede peaks of the millimeter-wave outbursts by 15-50 days. Each optical outburst is accompanied by an increase in X-ray activity. We associate the optical outbursts with propagation of the superluminal knots and derive the location of sites of energy dissipation in the form of radiation. The most prominent and long lasting of these, in 2005 May, occurred closer to the black hole, while the outbursts with a shorter duration in 2005 autumn and in 2007 might be connected with the passage of a disturbance through the millimeter-wave core of the jet. The optical outbursts, which coincide with the passage of superluminal radio knots through the core, are accompanied by systematic rotation of the position angle of optical linear polarization. Such rotation appears to be a common feature during the early stages of flares in blazars. We find correlations between optical variations and those at X-ray and γ-ray energies. We conclude that the emergence of a superluminal knot from the core yields a series of optical and high-energy outbursts, and that the millimeter-wave core lies at the end of the jet's acceleration and collimation zone. We infer that the X-ray emission is produced via inverse Compton scattering by relativistic electrons of photons both from within the jet (synchrotron self-Compton) and external to the jet (external Compton, or EC); which one dominates depends on the physical parameters of the jet. A broken power-law model of the γ-ray spectrum reflects a steepening of the synchrotron emission spectrum from near-IR to soft UV wavelengths. We propose that the �

Storm in a Teacup: X-Ray View of an Obscured Quasar and Superbubble

Science.gov (United States)

Lansbury, George B.; Jarvis, Miranda E.; Harrison, Chris M.; Alexander, David M.; Del Moro, Agnese; Edge, Alastair C.; Mullaney, James R.; Thomson, Alasdair P.

2018-03-01

We present the X-ray properties of the “Teacup AGN” (SDSS J1430+1339), a z = 0.085 type 2 quasar that is interacting dramatically with its host galaxy. Spectral modeling of the central quasar reveals a powerful, highly obscured active galactic nucleus (AGN) with a column density of N H = (4.2–6.5) × 1023 cm‑2 and an intrinsic luminosity of L 2–10 keV = (0.8–1.4) × 1044 erg s‑1. The current high bolometric luminosity inferred (L bol ≈1045–1046 erg s‑1) has ramifications for previous interpretations of the Teacup as a fading/dying quasar. High-resolution Chandra imaging data reveal a ≈10 kpc loop of X-ray emission, cospatial with the “eastern bubble” previously identified in luminous radio and ionized gas (e.g., [O III] line) emission. The X-ray emission from this structure is in good agreement with a shocked thermal gas, with T = (4–8) × 106 K, and there is evidence for an additional hot component with T ≳ 3 × 107 K. Although the Teacup is a radiatively dominated AGN, the estimated ratio between the bubble power and the X-ray luminosity is in remarkable agreement with observations of ellipticals, groups, and clusters of galaxies undergoing AGN feedback.

Radiation exposure to dial painters from 3H luminous paint industry

International Nuclear Information System (INIS)

Sawant, J.V.

1992-01-01

Tritium is used as the active component in self-luminous paint. The paper describes in-vitro solubilisation study of luminous paint in blood serum. Besides urine samples of luminous paint workers and air samples of two watch factories were analysed for 3 H. The results of these analysis are also presented. (author). 8 refs., 4 figs., 4 tabs

The luminosity function of quasars

Science.gov (United States)

Pei, Yichuan C.

1995-01-01

We propose a new evolutionary model for the optical luminosity function of quasars. Our analytical model is derived from fits to the empirical luminosity function estimated by Hartwick and Schade and Warren, Hewett, and Osmer on the basis of more than 1200 quasars over the range of redshifts 0 approximately less than z approximately less than 4.5. We find that the evolution of quasars over this entire redshift range can be well fitted by a Gaussian distribution, while the shape of the luminosity function can be well fitted by either a double power law or an exponential L(exp 1/4) law. The predicted number counts of quasars, as a function of either apparent magnitude or redshift, are fully consistent with the observed ones. Our model indicates that the evolution of quasars reaches its maximum at z approximately = 2.8 and declines at higher redshifts. An extrapolation of the evolution to z approximately greater than 4.5 implies that quasars may have started their cosmic fireworks at z(sub f) approximately = 5.2-5.5. Forthcoming surveys of quasars at these redshifts will be critical to constrain the epoch of quasar formation. All the results we derived are based on observed quasars and are therefore subject to the bias of obscuration by dust in damped Ly alpha systems. Future surveys of these absorption systems at z approximately greater than 3 will also be important if the formation epoch of quasars is to be known unambiguously.

Gravitationally Lensed Quasars in Gaia: II. Discovery of 24 Lensed Quasars

Science.gov (United States)

Lemon, Cameron A.; Auger, Matthew W.; McMahon, Richard G.; Ostrovski, Fernanda

2018-04-01

We report the discovery, spectroscopic confirmation and preliminary characterisation of 24 gravitationally lensed quasars identified using Gaia observations. Candidates were selected in the Pan-STARRS footprint with quasar-like WISE colours or as photometric quasars from SDSS, requiring either multiple detections in Gaia or a single Gaia detection near a morphological galaxy. The Pan-STARRS grizY images were modelled for the most promising candidates and 60 candidate systems were followed up with the William Herschel Telescope. 13 of the lenses were discovered as Gaia multiples and 10 as single Gaia detections near galaxies. We also discover 1 lens identified through a quasar emission line in an SDSS galaxy spectrum. The lenses have median image separation 2.13″ and the source redshifts range from 1.06 to 3.36. 4 systems are quadruply-imaged and 20 are doubly-imaged. Deep CFHT data reveal an Einstein ring in one double system. We also report 12 quasar pairs, 10 of which have components at the same redshift and require further follow-up to rule out the lensing hypothesis. We compare the properties of these lenses and other known lenses recovered by our search method to a complete sample of simulated lenses to show the lenses we are missing are mainly those with small separations and higher source redshifts. The initial Gaia data release only catalogues all images of ˜ 30% of known bright lensed quasars, however the improved completeness of Gaia data release 2 will help find all bright lensed quasars on the sky.

VLBI structure of the QSO 3C286

Science.gov (United States)

Kus, A. J.; Marecki, A.; Neff, S.; Van Ardenne, A.; Wilkinson, P. N.

1988-01-01

Observations of the quasar 3C286 with the EVN at 609 and 1420 MHz are reported. Results are presented on source size, the steepening of the spectral index, the IC X-ray flux, and surface brightness temperature. It is concluded that 3C286 appears to be not as energetic as the other 3C sources of the class.

41 CFR 109-40.103-3 - International transportation.

Science.gov (United States)

2010-07-01

... transportation. 109-40.103-3 Section 109-40.103-3 Public Contracts and Property Management Federal Property..., TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-3 International transportation. See 4 CFR 52.2 for a certificate required in nonuse of U.S. flag vessels or U.S...

The Sloan Digital Sky Survey Quasar Catalog. 3. Third data release

Energy Technology Data Exchange (ETDEWEB)

Schneider, Donald P.; Hall, Patrick B.; Richards, Gordon T.; Vanden Berk, Daniel E.; Anderson, Scott F.; Fan, Xiao-Hui; Jester, Sebastian; Stoughton, Chris; Strauss,; SubbaRao, Mark; Brandt, W.N.; Gunn, James E.; Yanny, Brian; Bahcall, Neta A.; Barentine, J.C.; Blanton, Michael R.; Boroski, William N.; Brewington, Howard J.; Brinkmann, J.; Brunner, Robert; Csabai, Istvan; /Penn State U., Astron. Astrophys. /York U., Canada /Princeton U. Observ. /Washington U., Seattle, Astron. Dept. /Arizona U.,

2005-03-01

We present the third edition of the Sloan Digital Sky Survey (SDSS) Quasar Catalog. The catalog consists of the 46,420 objects in the SDSS Third Data Release that have luminosities larger than M{sub i} = -22 (in a cosmology with H{sub 0} = 70 km s{sup -1} Mpc{sup -1}, {Omega}{sub M} = 0.3, and {Omega}{sub {Lambda}} = 0.7), have at least one emission line with FWHM larger than 1000 km s{sup -1} or are unambiguously broad absorption line quasars, are fainter than i = 15.0, and have highly reliable redshifts. The area covered by the catalog is {approx} 4188 deg{sup 2}. The quasar redshifts range from 0.08 to 5.41, with a median value of 1.47; the high-redshift sample includes 520 quasars at redshifts greater than four, of which 17 are at redshifts greater than five. For each object the catalog presents positions accurate to better than 0.2'' rms per coordinate, five-band (ugriz) CCD-based photometry with typical accuracy of 0.03 mag, and information on the morphology and selection method. The catalog also contains radio, near-infrared, and X-ray emission properties of the quasars, when available, from other large-area surveys. The calibrated digital spectra cover the wavelength region 3800-9200 at a spectral resolution of {approx} 2000; the spectra can be retrieved from the public database using the information provided in the catalog. A total of 44,221 objects in the catalog were discovered by the SDSS; 28,400 of the SDSS discoveries are reported here for the first time.

A 14 h {sup −3} Gpc{sup 3} study of cosmic homogeneity using BOSS DR12 quasar sample

Energy Technology Data Exchange (ETDEWEB)

Laurent, Pierre; Goff, Jean-Marc Le; Burtin, Etienne; Rich, James; Bourboux, Hélion du Mas des; Delabrouille, Nathalie Palanque; Rossi, Graziano; Yeche, Christophe [CEA, Centre de Saclay, IRFU/SPP, F-91191 Gif-sur-Yvette (France); Hamilton, Jean-Christophe; Ntelis, Pierros; Aubourg, Eric; Bautista, Julian [APC, Université Paris Diderot-Paris 7, CNRS/IN2P3, CEA, Observatoire de Paris, 10, rue A. Domon and L. Duquet, Paris (France); Hogg, David W. [Center for Cosmology and Particle Physics, New York University, 4 Washington Place, Meyer Hall of Physics, New York, NY 10003 (United States); Myers, Adam; Eftekharzadeh, Sarah [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); Pâris, Isabelle [Aix Marseille Université, CNRS, LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, 13388, Marseille (France); Delubac, Timothée [Laboratoire d' astrophysique, Ecole Polytechnique Fédérale de Lausanne (EPFL), Observatoire de Sauverny,CH-1290 Versoix (Switzerland); Petitjean, Patrick [Institut d' Astrophysique de Paris, CNRS-UPMC, UMR7095, 98bis bd Arago, Paris, 75014 France (France); Schneider, Donald P., E-mail: jmlegoff@cea.fr [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

2016-11-01

The BOSS quasar sample is used to study cosmic homogeneity with a 3D survey in the redshift range 2.2 < z < 2.8. We measure the count-in-sphere, N (< r ), i.e. the average number of objects around a given object, and its logarithmic derivative, the fractal correlation dimension, D {sub 2}( r ). For a homogeneous distribution N (< r ) ∝ r {sup 3} and D {sub 2}( r ) = 3. Due to the uncertainty on tracer density evolution, 3D surveys can only probe homogeneity up to a redshift dependence, i.e. they probe so-called ''spatial isotropy'. Our data demonstrate spatial isotropy of the quasar distribution in the redshift range 2.2 < z < 2.8 in a model-independent way, independent of any FLRW fiducial cosmology, resulting in 3 − ( D {sub 2}) < 1.7 × 10{sup −3} (2 σ) over the range 250 < r < 1200 h {sup −1} Mpc for the quasar distribution. If we assume that quasars do not have a bias much less than unity, this implies spatial isotropy of the matter distribution on large scales. Then, combining with the Copernican principle, we finally get homogeneity of the matter distribution on large scales. Alternatively, using a flat ΛCDM fiducial cosmology with CMB-derived parameters, and measuring the quasar bias relative to this ΛCDM model, our data provide a consistency check of the model, in terms of how homogeneous the Universe is on different scales. D {sub 2}( r ) is found to be compatible with our ΛCDM model on the whole 10 < r < 1200 h {sup −1} Mpc range. For the matter distribution we obtain 3 − ( D {sub 2}) < 5 × 10{sup −5} (2 σ) over the range 250 < r < 1200 h {sup −1} Mpc, consistent with homogeneity on large scales.

The CTIO surveys for large redshift quasars

International Nuclear Information System (INIS)

Osmer, P.S.

1978-01-01

Lyman α emission in large redshift quasars is readily detectable on slitless spectrograms taken with an objective combination on the 4m telescope. This provides a new survey method, independent of color for finding radio-quiet quasars in large numbers. Surveys by Smith with the Curtis Schmidt and Hoag and Smith with the 4 m telescope, have produced more than 200 candidates with 1.5< z<3.5 and 16< m<21. Spectroscopic observations with the CTIO SIT vidicon system have been carried out for more than 50 of the candidates, with the result that the basic properties of the surveys are known. To date three 16th magnitude quasars with zapproximately2.2 and six quasars with 3.0< z<3.25 have been found. One of the most important uses of the surveys will be the determination of the surface and surface densities of large redshift quasars. A preliminary analysis of the data indicates that the space density of quasars is at least constant, if not increasing, over the interval 1.0< z<3.25. However, the Hoag-Smith sample has only one candidate with z<3.2.(Auth.)

THE REDSHIFT DISTRIBUTION OF INTERVENING WEAK Mg II QUASAR ABSORBERS AND A CURIOUS DEPENDENCE ON QUASAR LUMINOSITY

Energy Technology Data Exchange (ETDEWEB)

Evans, Jessica L.; Churchill, Christopher W.; Nielsen, Nikole M.; Klimek, Elizabeth S. [New Mexico State University, Las Cruces, NM 88003 (United States); Murphy, Michael T. [Centre for Astrophysics and Supercomputing, Swinburne University of Technology, Hawthorn, Melbourne, VIC 3122 (Australia)

2013-05-01

We have identified 469 Mg II {lambda}{lambda}2796, 2803 doublet systems having W{sub r} {>=} 0.02 A in 252 Keck/High Resolution Echelle Spectrometer and UVES/Very Large Telescope quasar spectra over the redshift range 0.1 < z < 2.6. Using the largest sample yet of 188 weak Mg II systems (0.02 A {<=}W{sub r} < 0.3 A), we calculate their absorber redshift path density, dN/dz. We find clear evidence of evolution, with dN/dz peaking at z {approx} 1.2, and that the product of the absorber number density and cross section decreases linearly with increasing redshift; weak Mg II absorbers seem to vanish above z {approx_equal} 2.7. If the absorbers are ionized by the UV background, we estimate number densities of 10{sup 6}-10{sup 9} Mpc{sup -3} for spherical geometries and 10{sup 2}-10{sup 5} Mpc{sup -3} for more sheetlike geometries. We also find that dN/dz toward intrinsically faint versus bright quasars differs significantly for weak and strong (W{sub r} {>=} 1.0 A) absorbers. For weak absorption, dN/dz toward bright quasars is {approx}25% higher than toward faint quasars (10{sigma} at low redshift, 0.4 {<=} z {<=} 1.4, and 4{sigma} at high redshift, 1.4 < z {<=} 2.34). For strong absorption the trend reverses, with dN/dz toward faint quasars being {approx}20% higher than toward bright quasars (also 10{sigma} at low redshift and 4{sigma} at high redshift). We explore scenarios in which beam size is proportional to quasar luminosity and varies with absorber and quasar redshifts. These do not explain dN/dz's dependence on quasar luminosity.

RADIO-SELECTED QUASARS IN THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

McGreer, Ian D.; Helfand, David J.; White, Richard L.

2009-01-01

We have conducted a pilot survey for z > 3.5 quasars by combining the FIRST radio survey with the Sloan Digital Sky Survey (SDSS). While SDSS already targets FIRST sources for spectroscopy as quasar candidates, our survey includes fainter quasars and greatly improves the discovery rate by using strict astrometric criteria for matching the radio and optical positions. Our method allows for selection of high-redshift quasars with less color bias than with optical selection, as using radio selection essentially eliminates stellar contamination. We report the results of spectroscopy for 45 candidates, including 29 quasars in the range 0.37 3.5. We compare quasars selected using radio and optical criteria, and find that radio-selected quasars have a much higher fraction of moderately reddened objects. We derive a radio-loud quasar luminosity function at 3.5 < z < 4.0, and find that it is in good agreement with expectations from prior SDSS results.

Luminous bacteria cultured from fish guts in the Gulf of Oman.

Science.gov (United States)

Makemson, J C; Hermosa, G V

1999-01-01

The incidence of culturable luminous bacteria in Omani market fish guts was correlated to habitat type amongst 109 species of fish. Isolated representative luminous bacteria were compared to known species using the Biolog system (95 traits/isolate) and cluster analysis, which showed that the main taxa present in fish guts were clades related to Vibrio harveyi and Photobacterium species with sporadic incidence of P. phosphoreum. The luminous isolates from gut of the slip-mouth (barred pony fish), Leiognathus fasciatus, were mainly a type related to Photobacterium but phenotypically different from known species. These luminous gut bacteria were identical with the bacteria in the light organ, indicating that the light organ supplies a significant quantity of luminous bacteria to the gut. In many of the fish that lack light organs, luminous bacteria were also the dominant bacterial type in the gut, while in some others luminous bacteria were encountered sporadically and at low densities, reflecting the incidence of culturable luminous bacteria in seawater. Pelagic fish contained the highest incidence of culturable luminous bacteria and reef-associated fish the lowest. No correlation was found between the incidence of culturable luminous bacteria and the degree to which fish produce a melanin-covered gut. Copyright 1999 John Wiley & Sons, Ltd.

Tank characterization report for single-shell tank 241-C-109

Energy Technology Data Exchange (ETDEWEB)

Simpson, B.C.

1997-05-23

One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices.

Tank characterization report for single-shell tank 241-C-109

International Nuclear Information System (INIS)

Simpson, B.C.

1997-01-01

One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices

WHT spectroscopy of emission-line gas around two separate quasars at z = 0.87

International Nuclear Information System (INIS)

Fabian, A.C.; Crawford, C.S.; Johnstone, R.M.; Hewett, P.C.; Allington-Smith, J.R.

1988-01-01

A report is given of observations made with the Faint Object Spectrograph on the 4.2-m William Herschel Telescope (WHT), in which the line emission of the fuzz around two separate quasars, which coincidentally both have redshifts z = 0.87, is detected and measured. These represent the most distant quasars for which the spectrum of the fuzz has been obtained. The oxygen line ratios we observe are similar to those of the lower-z quasar 3C48 (to which the present quasars show a strong similarity) and again imply a high gas density. If confined by surrounding hot gas, the pressure is so high that an intracluster medium is required. This suggests that the quasars lie in clusters or groups of galaxies. (author)

Quasars.

Science.gov (United States)

Smith, H J

1966-11-01

A short historical outline of the discovery and a description of observed properties of quasars introduces questions as to their nature. Some of the principal arguments concerning their reality, distance, intrinsic properties and age lead to the conclusion that, while there is room for other points of view; a strong case can be made for the interpretation, on which quasars are the most distant observable objects in the known universe. To produce such luminosities over times of thousands to millions of years requires the presence of millions of solar masses. For each quasar this enormous mass may be concentrated into a single object, in which case novel physics comes into play. Whatever the final interpretation, quasars seem certain to illuminate such questions as the origin and evolution of galaxies, perhaps also the structure and origin of the universe.

Influence of Al{sub 2}O{sub 3} reflective layer under phosphor layer on luminance and luminous efficiency characteristics in alternating-current plasma display panel

Energy Technology Data Exchange (ETDEWEB)

Park, Choon-Sang [School of Electronics Engineering, College of IT Engineering, Kyungpook National University, Daegu (Korea, Republic of); Tae, Heung-Sik, E-mail: hstae@ee.knu.ac.kr [School of Electronics Engineering, College of IT Engineering, Kyungpook National University, Daegu (Korea, Republic of); Jung, Eun Young [Core Technology Lab., Corporate R and D Center, Samsung SDI Company Ltd., Cheonan (Korea, Republic of)

2013-11-29

This paper examines the optical and discharge characteristics of alternating-current plasma display panel when adopting the Al{sub 2}O{sub 3} reflective layer. The Al{sub 2}O{sub 3} reflective layer is deposited under the phosphor layer by using the screen-printing method. The resulting changes in the optical and discharge characteristics, including the power consumption, color temperature, luminance, luminous efficiency, scanning electron microscopy image, and reflectance, are then compared for both cases with and without Al{sub 2}O{sub 3} reflective layer. As a result of optimizing the thicknesses between the Al{sub 2}O{sub 3} and phosphor layers, the luminance and luminous efficiency are improved by about 17% and 7%, respectively. - Highlights: • We examine characteristics of plasma display panel when adopting reflective layer. • Al{sub 2}O{sub 3} reflective layer was deposited under the phosphor layer. • Al{sub 2}O{sub 3} reflective layer with flaky shape is very effective in enhancing luminance.

Mean and extreme radio properties of quasars and the origin of radio emission

Energy Technology Data Exchange (ETDEWEB)

Kratzer, Rachael M.; Richards, Gordon T. [Department of Physics, Drexel University, Philadelphia, PA (United States)

2015-02-01

We investigate the evolution of both the radio-loud fraction (RLF) and (using stacking analysis) the mean radio loudness of quasars. We consider how these properties evolve as a function of redshift and luminosity, black hole (BH) mass and accretion rate, and parameters related to the dominance of a wind in the broad emission-line region. We match the FIRST source catalog to samples of luminous quasars (both spectroscopic and photometric), primarily from the Sloan Digital Sky Survey. After accounting for catastrophic errors in BH mass estimates at high redshift, we find that both the RLF and the mean radio luminosity increase for increasing BH mass and decreasing accretion rate. Similarly, both the RLF and mean radio loudness increase for quasars that are argued to have weaker radiation line driven wind components of the broad emission-line region. In agreement with past work, we find that the RLF increases with increasing optical/UV luminosity and decreasing redshift, while the mean radio loudness evolves in the exact opposite manner. This difference in behavior between the mean radio loudness and the RLF in L−z may indicate selection effects that bias our understanding of the evolution of the RLF; deeper surveys in the optical and radio are needed to resolve this discrepancy. Finally, we argue that radio-loud (RL) and radio-quiet (RQ) quasars may be parallel sequences, but where only RQ quasars at one extreme of the distribution are likely to become RL, possibly through slight differences in spin and/or merger history.

Quasars and superclusters

International Nuclear Information System (INIS)

Osmer, P.S.

1983-01-01

The evidence for quasar superclusters is discussed, together with implications and survey techniques. The data base of clusters of pairs of quasars with similar redshifts, which is supportive of theories of gravitational lenses, indicates that quasar superclusters do exist. Surveys of large redshift quasars have shown that the quasars do not necessarily cluster. It is cautioned that randomness in an observational scheme, followed by assumptions of uniformity in analyses, will produce results that support a uniformity that may not exist. It is suggested that clusters observed in one survey should be sought in other direction using the same techniques. Continuing expanded surveys of large redshift quasars are recommended in order to form an all-sky distribution of the objects. 18 references

Far infrared peculiar behavior of quasars

International Nuclear Information System (INIS)

Liu Yulin; Liu Jiying

1988-09-01

Many quasars possibly have nebulous envelopes with far infrared radiation. These nebulosities may be similar to fuzz in the optical region in morphology. These quasars have many properties in common. (author). Refs, 3 figs

Energetics of the molecular gas in the H2 luminous radio galaxy 3C 326: Evidence for negative AGN feedback

Science.gov (United States)

Nesvadba, N. P. H.; Boulanger, F.; Salomé, P.; Guillard, P.; Lehnert, M. D.; Ogle, P.; Appleton, P.; Falgarone, E.; Pineau Des Forets, G.

2010-10-01

We present a detailed analysis of the gas conditions in the H2 luminous radio galaxy 3C 326 N at z ~ 0.1, which has a low star-formation rate (SFR ~ 0.07 M⊙ yr-1) in spite of a gas surface density similar to those in starburst galaxies. Its star-formation efficiency is likely a factor ~10-50 lower than those of ordinary star-forming galaxies. Combining new IRAM CO emission-line interferometry with existing Spitzer mid-infrared spectroscopy, we find that the luminosity ratio of CO and pure rotational H2 line emission is factors 10-100 lower than what is usually found. This suggests that most of the molecular gas is warm. The Na D absorption-line profile of 3C 326 N in the optical suggests an outflow with a terminal velocity of ~-1800 km s-1 and a mass outflow rate of 30-40 M⊙ yr-1, which cannot be explained by star formation. The mechanical power implied by the wind, of order 1043 erg s-1, is comparable to the bolometric luminosity of the emission lines of ionized and molecular gas. To explain these observations, we propose a scenario where a small fraction of the mechanical energy of the radio jet is deposited in the interstellar medium of 3C 326 N, which powers the outflow, and the line emission through a mass, momentum and energy exchange between the different gas phases of the ISM. Dissipation times are of order 107-8 yrs, similar or greater than the typical jet lifetime. Small ratios of CO and PAH surface brightnesses in another 7 H2 luminous radio galaxies suggest that a similar form of AGN feedback could be lowering star-formation efficiencies in these galaxies in a similar way. The local demographics of radio-loud AGN suggests that secular gas cooling in massive early-type galaxies of ≥1011 M⊙ could generally be regulated through a fundamentally similar form of “maintenance-phase” AGN feedback. Based on observations carried out with the IRAM Plateau de Bure Interferometer.

First observation of a quasar with a redshift of 4

International Nuclear Information System (INIS)

Warren, S.J.; Hewett, P.C.; Irwin, M.J.; McMahon, R.G.; Bridgeland, M.T.; Bunclark, P.S.; Kibblewhite, E.J.

1987-01-01

The authors report the discovery of a quasar (0046-293) with a redshift z = 4.01 and another (0044-276) with a redshift z 3.42. The redshift of the former quasar is the highest yet detected and compares with the z = 3.80 of the previous most distant known quasar. The new quasars lie in the same field as three other known high-redshift quasars and were identified in a preliminary analysis of new multi-colour data derived from measurements of direct photographic plates taken with the United Kingdom Schmidt Telescope. The two new quasars are significantly fainter (msub(R) > 19) than previously known high-redshift quasars discovered by optical techniques, and demonstrate that the luminosity function of optically selected high-redshift quasars extends over at least two magnitudes. (author)

SELECTING QUASARS BY THEIR INTRINSIC VARIABILITY

International Nuclear Information System (INIS)

Schmidt, Kasper B.; Rix, Hans-Walter; Jester, Sebastian; Hennawi, Joseph F.; Marshall, Philip J.; Dobler, Gregory

2010-01-01

We present a new and simple technique for selecting extensive, complete, and pure quasar samples, based on their intrinsic variability. We parameterize the single-band variability by a power-law model for the light-curve structure function, with amplitude A and power-law index γ. We show that quasars can be efficiently separated from other non-variable and variable sources by the location of the individual sources in the A-γ plane. We use ∼60 epochs of imaging data, taken over ∼5 years, from the SDSS stripe 82 (S82) survey, where extensive spectroscopy provides a reference sample of quasars, to demonstrate the power of variability as a quasar classifier in multi-epoch surveys. For UV-excess selected objects, variability performs just as well as the standard SDSS color selection, identifying quasars with a completeness of 90% and a purity of 95%. In the redshift range 2.5 < z < 3, where color selection is known to be problematic, variability can select quasars with a completeness of 90% and a purity of 96%. This is a factor of 5-10 times more pure than existing color selection of quasars in this redshift range. Selecting objects from a broad griz color box without u-band information, variability selection in S82 can afford completeness and purity of 92%, despite a factor of 30 more contaminants than quasars in the color-selected feeder sample. This confirms that the fraction of quasars hidden in the 'stellar locus' of color space is small. To test variability selection in the context of Pan-STARRS 1 (PS1) we created mock PS1 data by down-sampling the S82 data to just six epochs over 3 years. Even with this much sparser time sampling, variability is an encouragingly efficient classifier. For instance, a 92% pure and 44% complete quasar candidate sample is attainable from the above griz-selected catalog. Finally, we show that the presented A-γ technique, besides selecting clean and pure samples of quasars (which are stochastically varying objects), is also

Close companions to two high-redshift quasars

Energy Technology Data Exchange (ETDEWEB)

McGreer, Ian D.; Fan, Xiaohui; Bian, Fuyan [Steward Observatory, The University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721-0065 (United States); Strauss, Michael A. [Princeton University Observatory, Peyton Hall, Princeton, NJ 08544 (United States); Haiman, Zoltàn [Department of Astronomy, Columbia University, 550 West 120th Street, New York, NY 10027 (United States); Richards, Gordon T. [Department of Physics, Drexel University, 3141 Chestnut Street, Philadelphia, PA 19104 (United States); Jiang, Linhua [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Schneider, Donald P., E-mail: imcgreer@as.arizona.edu [Department of Astronomy and Astrophysics and the Institute for Gravitation and the Cosmos, The Pennsylvania State University, University Park, PA 16802 (United States)

2014-10-01

We report the serendipitous discoveries of companion galaxies to two high-redshift quasars. SDSS J025617.7+001904 is a z = 4.79 quasar included in our recent survey of faint quasars in the SDSS Stripe 82 region. The initial MMT slit spectroscopy shows excess Lyα emission extending well beyond the quasar's light profile. Further imaging and spectroscopy with LBT/MODS1 confirms the presence of a bright galaxy (i {sub AB} = 23.6) located 2'' (12 kpc projected) from the quasar with strong Lyα emission (EW{sub 0} ≈ 100 Å) at the redshift of the quasar, as well as faint continuum. The second quasar, CFHQS J005006.6+344522 (z = 6.25), is included in our recent HST SNAP survey of z ∼ 6 quasars searching for evidence of gravitational lensing. Deep imaging with ACS and WFC3 confirms an optical dropout ∼4.5 mag fainter than the quasar (Y {sub AB} = 25) at a separation of 0.''9. The red i {sub 775} – Y {sub 105} color of the galaxy and its proximity to the quasar (5 kpc projected if at the quasar redshift) strongly favor an association with the quasar. Although it is much fainter than the quasar, it is remarkably bright when compared to field galaxies at this redshift, while showing no evidence for lensing. Both systems may represent late-stage mergers of two massive galaxies, with the observed light for one dominated by powerful ongoing star formation and for the other by rapid black hole growth. Observations of close companions are rare; if major mergers are primarily responsible for high-redshift quasar fueling then the phase when progenitor galaxies can be observed as bright companions is relatively short.

What's in the Wind? Determining the Properties of Outflowing Gas in Powerful Broad Absorption Line Quasars

Science.gov (United States)

Leighly, Karen

2017-08-01

A significant fraction of quasars exhibits blueshifted broadabsorption lines (BALs) in their rest-UV spectra, indicating powerfuloutflows emerging from the central engine. These outflows may removeangular momentum to enable black hole growth, enrich the intergalacticmedium with metals, and trigger quenching of star formation ingalaxies. Despite years of study, the physical conditions of theoutflowing gas are poorly understood. The handful of objects that havebeen subjected to detailed analysis are atypical and characterized byrelatively narrow lines where blending is unimportant. However,investigating more powerful BAL quasars will give us better insightinto the types of outflows much more likely to impact galaxyevolution.SimBAL is a novel spectral synthesis fitting method for BAL quasarsthat uses Bayesian model calibration to compare synthetic to observedspectra. With the model inputs of ionization parameter, columndensity, and covering fraction specified, the gas properties givingrise to the BAL features can be determined. We propose to applySimBAL to archival spectra of a sample of 14 luminous BAL quasars to characterize their bulk outflow properties as a function of velocityfor the first time. Our results will show the range of parameterstypical of powerful outflows, an essential step towards constrainingthe physics behind quasar winds and thus their impact on theirenvironments.

Quasar energy distributions. I. Soft X-ray spectra of quasars

International Nuclear Information System (INIS)

Wilkes, B.J.; Elvis, M.

1987-01-01

As the initial stage of a study of quasar energy distributions (QEDs), Einstein IPC spectra of 24 quasars are presented. These are combined with previously reported IPC spectra to form a sample of 33 quasars with well-determined soft X-ray slopes. A correlation analysis shows that radio loudness, rather than redshift or luminosity, is fundamentally related to the X-ray slope. This correlation is not followed by higher energy spectra of active galaxies. Two components are required to explain both sets of results. The best-fit column densities are systematically smaller than the Galactic values. The same effect is not present in a sample of BL Lac objects, implying that the effect is intrinsic to the quasars and is caused by a low-energy turnup in the quasar spectra. 74 references

Modulated High-Energy Gamma-Ray Emission from the Micro-quasar Cygnus X-3

International Nuclear Information System (INIS)

Abdo, A.A.; Cheung, C.C.; Dermer, C.D.; Grove, J.E.; Johnson, W.N.; Lovellette, M.N.; Makeev, A.; Ray, P.S.; Strickman, M.S.; Wood, K.S.; Abdo, A.A.; Cheung, C.C.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Focke, W.B.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Johnson, A.S.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tanaka, T.; Thayer, J.B.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Waite, A.P.; Wang, P.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.D.; Bloom, E.D.; Borgland, A.W.; Cameron, R.A.; Chiang, J.; Claus, R.; Digel, S.W.; Silva, E.D.E.; Drell, P.S.; Dubois, R.; Focke, W.B.; Glanzman, T.; Godfrey, G.; Hayashida, M.; Johannesson, G.; Johnson, A.S.; Kamae, T.; Kocian, M.L.; Lande, J.; Madejski, G.M.; Michelson, P.F.; Mitthumsiri, W.; Monzani, M.E.; Moskalenko, I.V.; Murgia, S.; Nolan, P.L.; Paneque, D.; Reimer, A.; Reimer, O.; Rochester, L.S.; Romani, R.W.; Tanaka, T.; Thayer, J.B.; Tramacere, A.; Uchiyama, Y.; Usher, T.L.; Waite, A.P.; Wang, P.; Axelsson, M.; Hjalmarsdotter, L.; Axelsson, M.; Conrad, J.; Hjalmarsdotter, L.; Jackson, M.S.; Meurer, C.; Ryde, F.; Ylinen, T.; Baldini, L.; Bellazzini, R.; Brez, A.; Kuss, M.; Latronico, L.; Omodei, N.; Pesce-Rollins, M.; Razzano, M.; Sgro, C.; Ballet, J.; Casandjian, J.M.; Chaty, S.; Corbel, S.; Grenier, I.A.; Koerding, E.; Rodriguez, J.; Starck, J.L.; Tibaldo, L.

2009-01-01

Micro-quasars are accreting black holes or neutron stars in binary systems with associated relativistic jets. Despite their frequent outburst activity, they have never been unambiguously detected emitting high-energy gamma rays. The Fermi Large Area Telescope (LAT) has detected a variable high-energy source coinciding with the position of the x-ray binary and micro-quasar Cygnus X-3. Its identification with Cygnus X-3 is secured by the detection of its orbital period in gamma rays, as well as the correlation of the LAT flux with radio emission from the relativistic jets of Cygnus X-3. The gamma-ray emission probably originates from within the binary system, opening new areas in which to study the formation of relativistic jets. (authors)

Inspiraling halo accretion mapped in Ly α emission around a z ˜ 3 quasar

Science.gov (United States)

Arrigoni Battaia, Fabrizio; Prochaska, J. Xavier; Hennawi, Joseph F.; Obreja, Aura; Buck, Tobias; Cantalupo, Sebastiano; Dutton, Aaron A.; Macciò, Andrea V.

2018-01-01

In an effort to search for Ly α emission from circum- and intergalactic gas on scales of hundreds of kpc around z ∼ 3 quasars, and thus characterize the physical properties of the gas in emission, we have initiated an extensive fast survey with the Multi-Unit Spectroscopic Explorer (MUSE): Quasar Snapshot Observations with MUse: Search for Extended Ultraviolet eMission (QSO MUSEUM). In this work, we report the discovery of an enormous Ly α nebula (ELAN) around the quasar SDSS J102009.99+104002.7 at z = 3.164, which we followed-up with deeper MUSE observations. This ELAN spans ∼297 projected kpc, has an average Ly α surface brightness SBLy α ∼ 6.04 × 10-18 erg s-1 cm-2 arcsec-2(within the 2σ isophote) and is associated with an additional four previously unknown embedded sources: two Ly α emitters and two faint active galactic nuclei (one type-1 and one type-2 quasar). By mapping at high significance, the line-of-sight velocity in the entirety of the observed structure, we unveiled a large-scale coherent rotation-like pattern spanning ∼300 km s-1 with a velocity dispersion of <270 km s-1, which we interpret as a signature of the inspiraling accretion of substructures within the quasar's host halo. Future multiwavelength data will complement our MUSE observations and are definitely needed to fully characterize such a complex system. None the less, our observations reveal the potential of new sensitive integral-field spectrographs to characterize the dynamical state of diffuse gas on large scales in the young Universe, and thereby witness the assembly of galaxies.

Clustering Batik Images using Fuzzy C-Means Algorithm Based on Log-Average Luminance

Directory of Open Access Journals (Sweden)

Ahmad Sanmorino

2012-06-01

Full Text Available Batik is a fabric or clothes that are made ​​with a special staining technique called wax-resist dyeing and is one of the cultural heritage which has high artistic value. In order to improve the efficiency and give better semantic to the image, some researchers apply clustering algorithm for managing images before they can be retrieved. Image clustering is a process of grouping images based on their similarity. In this paper we attempt to provide an alternative method of grouping batik image using fuzzy c-means (FCM algorithm based on log-average luminance of the batik. FCM clustering algorithm is an algorithm that works using fuzzy models that allow all data from all cluster members are formed with different degrees of membership between 0 and 1. Log-average luminance (LAL is the average value of the lighting in an image. We can compare different image lighting from one image to another using LAL. From the experiments that have been made, it can be concluded that fuzzy c-means algorithm can be used for batik image clustering based on log-average luminance of each image possessed.

The Intrinsically X-Ray-weak Quasar PHL 1811. II. Optical and UV Spectra and Analysis

Science.gov (United States)

Leighly, Karen M.; Halpern, Jules P.; Jenkins, Edward B.; Casebeer, Darrin

2007-11-01

This is the second of two papers reporting observations and analysis of the unusually bright (mb=14.4), luminous (MB=-25.5), nearby (z=0.192) narrow-line quasar PHL 1811. The first paper reported that PHL 1811 is intrinsically X-ray-weak and presented a spectral energy distribution (SED). Here we present HST STIS optical and UV spectra, and ground-based optical spectra. The optical and UV line emission is very unusual. There is no evidence for forbidden or semiforbidden lines. The near-UV spectrum is dominated by very strong Fe II and Fe III, and unusual low-ionization lines such as Na I D and Ca II H and K are observed. High-ionization lines are very weak; C IV has an equivalent width of 6.6 Å, a factor of ~5 smaller than measured from quasar composite spectra. An unusual feature near 1200 Å can be deblended in terms of Lyα, N V, Si II, and C III* using the blueshifted C IV profile as a template. Photoionization modeling shows that the unusual line emission can be explained qualitatively by the unusually soft SED. Principally, a low gas temperature results in inefficient emission of collisionally excited lines, including the semiforbidden lines generally used as density diagnostics. The emission resembles that of high-density gas; in both cases this is a consequence of inefficient cooling. PHL 1811 is very unusual, but we note that quasar surveys may be biased against finding similar objects. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555. These observations are associated with proposal 9181. Based on observations obtained at Kitt Peak National Observatory, a division of the National Optical Astronomy Observatories, which is operated by the Association of Universities for Research in Astronomy, Inc., under cooperative agreement with the National Science Foundation.

Close Companions to Two High-redshift Quasars

Science.gov (United States)

McGreer, Ian D.; Fan, Xiaohui; Strauss, Michael A.; Haiman, Zoltàn; Richards, Gordon T.; Jiang, Linhua; Bian, Fuyan; Schneider, Donald P.

2014-10-01

We report the serendipitous discoveries of companion galaxies to two high-redshift quasars. SDSS J025617.7+001904 is a z = 4.79 quasar included in our recent survey of faint quasars in the SDSS Stripe 82 region. The initial MMT slit spectroscopy shows excess Lyα emission extending well beyond the quasar's light profile. Further imaging and spectroscopy with LBT/MODS1 confirms the presence of a bright galaxy (i AB = 23.6) located 2'' (12 kpc projected) from the quasar with strong Lyα emission (EW0 ≈ 100 Å) at the redshift of the quasar, as well as faint continuum. The second quasar, CFHQS J005006.6+344522 (z = 6.25), is included in our recent HST SNAP survey of z ~ 6 quasars searching for evidence of gravitational lensing. Deep imaging with ACS and WFC3 confirms an optical dropout ~4.5 mag fainter than the quasar (Y AB = 25) at a separation of 0.''9. The red i 775 - Y 105 color of the galaxy and its proximity to the quasar (5 kpc projected if at the quasar redshift) strongly favor an association with the quasar. Although it is much fainter than the quasar, it is remarkably bright when compared to field galaxies at this redshift, while showing no evidence for lensing. Both systems may represent late-stage mergers of two massive galaxies, with the observed light for one dominated by powerful ongoing star formation and for the other by rapid black hole growth. Observations of close companions are rare; if major mergers are primarily responsible for high-redshift quasar fueling then the phase when progenitor galaxies can be observed as bright companions is relatively short. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs #12184 and #12493. Observations were also made with the LBT and MMT.

Quasars in galaxy cluster environments

International Nuclear Information System (INIS)

Ellingson, E.

1989-01-01

The evolution of radio loud quasars is found to be strongly dependent upon their galaxy cluster environment. Previous studies have shown that bright quasars are found in rich clusters, while high luminosity quasars are found only in poorer environments. The analysis of low luminosity radio quiet quasars indicate that they are never found in rich environments, suggesting that they are a physically different class of objects. Properties of the quasar environment are investigated to determine constraints on the physical mechanisms of quasar formation and evolution. The optical cluster morphology indicates that the cluster cores have smaller radii and higher galaxy densities than are typical for low redshift clusters of similar richness. Radio morphologies may indicate that the formation of a dense intra-cluster medium is associated with the quasars' fading at these epochs. Galaxy colors appear to be normal, but there may be a tendency for clusters associated with high luminosity quasars to contain a higher fraction of gas-rich galaxies than those associated with low luminosity quasars. Multislit spectroscopic observations of galaxies associated with high luminosity quasars indicate that quasars are preferentially located in regions of low relative velocity dispersion, either in rich clusters of abnormally low dispersion, or in poor groups which are dynamically normal. This suggests that galaxy-galaxy interactions may play a role in quasar formation and sustenanace. Virialization of rich clusters and the subsequent increase in galaxy velocities may therefore be responsible for the fading of quasars in rich environments

Highly Accreting Quasars at High Redshift

Science.gov (United States)

Martínez-Aldama, Mary L.; Del Olmo, Ascensión; Marziani, Paola; Sulentic, Jack W.; Negrete, C. Alenka; Dultzin, Deborah; Perea, Jaime; D'Onofrio, Mauro

2017-12-01

We present preliminary results of a spectroscopic analysis for a sample of type 1 highly accreting quasars (LLedd>0.2) at high redshift, z 2-3. The quasars were observed with the OSIRIS spectrograph on the GTC 10.4 m telescope located at the Observatorio del Roque de los Muchachos in La Palma. The highly accreting quasars were identified using the 4D Eigenvector 1 formalism, which is able to organize type 1 quasars over a broad range of redshift and luminosity. The kinematic and physical properties of the broad line region have been derived by fitting the profiles of strong UV emission lines such as AlIII, SiIII and CIII. The majority of our sources show strong blueshifts in the high-ionization lines and high Eddington ratios which are related with the productions of outflows. The importance of highly accreting quasars goes beyond a detailed understanding of their physics: their extreme Eddington ratio makes them candidates standard candles for cosmological studies.

Sloan Digital Sky Survey III photometric quasar clustering: probing the initial conditions of the Universe

Energy Technology Data Exchange (ETDEWEB)

Ho, Shirley; Agarwal, Nishant; Lyons, Richard; Disbrow, Ashley; O' Connell, Ross [McWilliams Center for Cosmology, Department of Physics, Carnegie Mellon University, 5000 Forbes Avenue, Pittsburgh, PA 15213 (United States); Myers, Adam D. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); Seo, Hee-Jong; Schlegel, David; Ross, Nicholas P. [Lawrence Berkeley National Laboratory, 1 Cyclotron Rd, Berkeley, CA 94702 (United States); Ross, Ashley [Institute of Cosmology and Gravitation, University of Portsmouth, Dennis Sciama Building, Portsmouth, PO1 3FX (United Kingdom); Hirata, Christopher; Huff, Eric; Weinberg, David [Department of Astronomy, Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Padmanabhan, Nikhil [Department of Physics and Astronomy, Yale University, New Haven, CT 06520 (United States); Slosar, Anže [Brookhaven National Laboratory, Bldg. 510, Upton NY 11375 (United States); Strauss, Michael; Bahcall, Neta [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Brinkmann, J. [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349-0059 (United States); Palanque-Delabrouille, Nathalie, E-mail: shirleyh@andrew.cmu.edu [CEA, Centre de Saclay, Irfu/SPP, F-91191 Gif-sur-Yvette (France); and others

2015-05-01

The Sloan Digital Sky Survey has surveyed 14,555 square degrees of the sky, and delivered over a trillion pixels of imaging data. We present the large-scale clustering of 1.6 million quasars between z=0.5 and z=2.5 that have been classified from this imaging, representing the highest density of quasars ever studied for clustering measurements. This data set spans 0∼ 11,00 square degrees and probes a volume of 80 h{sup −3} Gpc{sup 3}. In principle, such a large volume and medium density of tracers should facilitate high-precision cosmological constraints. We measure the angular clustering of photometrically classified quasars using an optimal quadratic estimator in four redshift slices with an accuracy of ∼ 25% over a bin width of δ{sub l} ∼ 10−15 on scales corresponding to matter-radiation equality and larger (0ℓ ∼ 2−3). Observational systematics can strongly bias clustering measurements on large scales, which can mimic cosmologically relevant signals such as deviations from Gaussianity in the spectrum of primordial perturbations. We account for systematics by employing a new method recently proposed by Agarwal et al. (2014) to the clustering of photometrically classified quasars. We carefully apply our methodology to mitigate known observational systematics and further remove angular bins that are contaminated by unknown systematics. Combining quasar data with the photometric luminous red galaxy (LRG) sample of Ross et al. (2011) and Ho et al. (2012), and marginalizing over all bias and shot noise-like parameters, we obtain a constraint on local primordial non-Gaussianity of f{sub NL} = −113{sup +154}{sub −154} (1σ error). We next assume that the bias of quasar and galaxy distributions can be obtained independently from quasar/galaxy-CMB lensing cross-correlation measurements (such as those in Sherwin et al. (2013)). This can be facilitated by spectroscopic observations of the sources, enabling the redshift distribution to be

What BOSS has taught us about Quasars.

Science.gov (United States)

Ross, Nicholas; SDSS-III BOSS Quasar Science Working Group

2015-01-01

This talk presents science highlights from the SDSS-III BOSS Quasar Survey, which has obtained spectra for over 300,000 quasars, 200,000 of which are at redshift z>2. Using this dataset, new measurements of the luminosity function have been made, with the faint end of the luminosity function now measured to z~5. New clustering results from DR12 are presented, and the weak luminosity dependence of quasar clustering at z~0.5 is also discussed.New studies of the broad absorption line (BAL) quasar population have also been performed, with a sample of BAL quasars from the original SDSS being re-observed. These new data have shown the disappearance of CIV BAL troughs and indeed the transformation of BAL QSOs to non-BAL QSOs. BAL disappearance, and emergence, events appear to be extremes of general BAL variability, and have shed light on accretion-disk wind models.We highlight the discovery of new classes of quasars including: a population of broad-line Mg II emitters found in a passive galaxy sample; objects with extremely red optical-to-mid infrared colors; objects with very curious UV line (LyA:NV) ratios and potentially the long-sought after high-redshift Type 2 Quasar population.Finally, we describe two new dedicated programs, one focusing on reverberation mapping, the other on X-ray selected quasars.A full list of papers connected to the BOSS Quasar Survey is given at: http://www.sdss3.org/science/publications.php

Reverberation Mapping of High-Luminosity Quasars

Energy Technology Data Exchange (ETDEWEB)

Kaspi, Shai [Raymond and Beverly Sackler Faculty of Exact Sciences, School of Physics and Astronomy, Tel-Aviv University, Tel-Aviv (Israel); Brandt, William N. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA (United States); Institute for Gravitation and the Cosmos, Pennsylvania State University, University Park, PA (United States); Department of Physics, Pennsylvania State University, University Park, PA (United States); Maoz, Dan; Netzer, Hagai [Raymond and Beverly Sackler Faculty of Exact Sciences, School of Physics and Astronomy, Tel-Aviv University, Tel-Aviv (Israel); Schneider, Donald P. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA (United States); Institute for Gravitation and the Cosmos, Pennsylvania State University, University Park, PA (United States); Shemmer, Ohad, E-mail: shai@wise.tau.ac.il [Department of Physics, University of North Texas, Denton, TX (United States)

2017-10-30

Over the past three decades reverberation mapping (RM) has been applied to about 100 AGNs. Their broad line region (BLR) sizes were measured and yielded mass estimates of the black holes in their center. However, very few attempts were carried out for high-luminosity quasars, at luminosities higher than 10{sup 46} erg/sec in the optical. Most of these attempts failed since RM of such quasars is difficult due to a number of reasons, mostly due to the long time needed to monitor these objects. During the past two decades we carried out a RM campaign on six high-luminosity quasars. This contribution presents some of the final light curves of that RM campaign in which we measured the BLR size in C iv of three of the objects (S5 0836+71, SBS 1116+603, and SBS 1425+606). We present the C iv BLR size and luminosity relation over eight orders of magnitude in luminosity, pushing the luminosity limit to its highest point so far.

THE FIRST HIGH-REDSHIFT QUASAR FROM Pan-STARRS

Energy Technology Data Exchange (ETDEWEB)

Morganson, Eric; De Rosa, Gisella; Decarli, Roberto; Walter, Fabian; Rix, Hans-Walter [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, 69117 Heidelberg (Germany); Chambers, Ken; Burgett, William; Flewelling, Heather; Hodapp, Klaus; Kaiser, Nick; Magnier, Eugene; Sweeney, Bill; Waters, Christopher [Institute for Astronomy, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); McGreer, Ian; Fan, Xiaohui [Steward Observatory, University of Arizona, 933 N Cherry Ave., Tucson, AZ 85721 (United States); Greiner, Jochen [Max-Planck-Institut fuer extraterrestrische Physik, Giessenbachstrasse 1, 85748 Garching (Germany); Price, Paul, E-mail: morganson@mpia.de [Princeton University Observatory, 4 Ivy Lane, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States)

2012-06-15

We present the discovery of the first high-redshift (z > 5.7) quasar from the Panoramic Survey Telescope and Rapid Response System 1 (Pan-STARRS1 or PS1). This quasar was initially detected as an i{sub P1} dropout in PS1, confirmed photometrically with the SAO Wide-field InfraRed Camera at Arizona's Multiple Mirror Telescope (MMT) and the Gamma-Ray Burst Optical/Near-Infrared Detector at the MPG 2.2 m telescope in La Silla. The quasar was verified spectroscopically with the MMT Spectrograph, Red Channel and the Cassegrain Twin Spectrograph at the Calar Alto 3.5 m telescope. Its near-infrared spectrum was taken at the Large Binocular Telescope Observatory (LBT) with the LBT Near-Infrared Spectroscopic Utility with Camera and Integral Field Unit for Extragalactic Research. It has a redshift of 5.73, an AB z{sub P1} magnitude of 19.4, a luminosity of 3.8 Multiplication-Sign 10{sup 47} erg s{sup -1}, and a black hole mass of 6.9 Multiplication-Sign 10{sup 9} M{sub Sun }. It is a broad absorption line quasar with a prominent Ly{beta} peak and a very blue continuum spectrum. This quasar is the first result from the PS1 high-redshift quasar search that is projected to discover more than 100 i{sub P1} dropout quasars and could potentially find more than 10 z{sub P1} dropout (z > 6.8) quasars.

THE FIRST HIGH-REDSHIFT QUASAR FROM Pan-STARRS

International Nuclear Information System (INIS)

Morganson, Eric; De Rosa, Gisella; Decarli, Roberto; Walter, Fabian; Rix, Hans-Walter; Chambers, Ken; Burgett, William; Flewelling, Heather; Hodapp, Klaus; Kaiser, Nick; Magnier, Eugene; Sweeney, Bill; Waters, Christopher; McGreer, Ian; Fan, Xiaohui; Greiner, Jochen; Price, Paul

2012-01-01

We present the discovery of the first high-redshift (z > 5.7) quasar from the Panoramic Survey Telescope and Rapid Response System 1 (Pan-STARRS1 or PS1). This quasar was initially detected as an i P1 dropout in PS1, confirmed photometrically with the SAO Wide-field InfraRed Camera at Arizona's Multiple Mirror Telescope (MMT) and the Gamma-Ray Burst Optical/Near-Infrared Detector at the MPG 2.2 m telescope in La Silla. The quasar was verified spectroscopically with the MMT Spectrograph, Red Channel and the Cassegrain Twin Spectrograph at the Calar Alto 3.5 m telescope. Its near-infrared spectrum was taken at the Large Binocular Telescope Observatory (LBT) with the LBT Near-Infrared Spectroscopic Utility with Camera and Integral Field Unit for Extragalactic Research. It has a redshift of 5.73, an AB z P1 magnitude of 19.4, a luminosity of 3.8 × 10 47 erg s –1 , and a black hole mass of 6.9 × 10 9 M ☉ . It is a broad absorption line quasar with a prominent Lyβ peak and a very blue continuum spectrum. This quasar is the first result from the PS1 high-redshift quasar search that is projected to discover more than 100 i P1 dropout quasars and could potentially find more than 10 z P1 dropout (z > 6.8) quasars.

Diversity of soft X-ray spectra in quasars

International Nuclear Information System (INIS)

Elvis, M.; Wilkes, B.J.; Tananbaum, H.

1985-01-01

Soft X-ray spectra for three quasars obtained with the Einstein Imaging Proportional Counter covering the 0.1-4.0 keV band are reported. Power-law fits to these spectra have best-fit energy indices of 1.2 +0.6 or -0.2, for the quasar NAB 0205 + 024, 0.6 +0.3 or -0.2 for the quasar B2 1028 + 313, and 2.2 + or -0.4 for the quasar PG 1211 + 143. None of the quasars shows any evidence for a column density of cold matter in excess of the galactic values. The derived spectra demonstrate that there is no single universal power law slope for quasar X-ray spectra. The implications of these results for the X-ray background, X-ray continuum emission mechanisms, and the production of the optical/UV emission lines are briefly discussed. 46 references

A Polarimetric Search for Hidden Quasars in Three Radio-selected Ultraluminous Infrared Galaxies

International Nuclear Information System (INIS)

Tran, H.D.; Brotherton, M.S.; Stanford, S.A.; Breugel, W. van; Dey, A.; Stern, D.; Antonucci, R.

1999-01-01

We have carried out a spectropolarimetric search for hidden broad-line quasars in three ultraluminous infrared galaxies (ULIRGs) discovered in the positional correlations between sources detected in deep radio surveys and the IRAS Faint Source Catalog. Only the high-ionization Seyfert 2 galaxy TF J1736+1122 is highly polarized, displaying a broad-line spectrum visible in polarized light. The other two objects, TF J1020+6436 and FF J1614+3234, display spectra dominated by a population of young (A type) stars similar to those of open-quotes E+Aclose quotes galaxies. They are unpolarized, showing no sign of hidden broad-line regions. The presence of young starburst components in all three galaxies indicates that the ULIRG phenomenon encompasses both active galactic nuclei (AGNs) and starburst activity, but the most energetic ULIRGs do not necessarily harbor open-quotes buried quasars.close quotes We find that a luminous infrared galaxy is most likely to host an obscured quasar if it exhibits a high-ionization ([O iii] λ5007/Hβ approx-gt 5) spectrum typical of a 'classic' Seyfert 2 galaxy with little or no Balmer absorption lines, is 'ultraluminous' (L IR approx-gt 10 12 L circle-dot ), and has a 'warm' IR color (f 25 /f 60 approx-gt 0.25). The detection of hidden quasars in this group but not in the low-ionization, starburst-dominated ULIRGs (classified as LINERs or H ii galaxies) may indicate an evolutionary connection, with the latter being found in younger systems. copyright copyright 1999. The American Astronomical Society

The Quasar Accretion Disk Size-Black Hole Mass Relation

Science.gov (United States)

Morgan, Christopher W.; Kochanek, C. S.; Morgan, Nicholas D.; Falco, Emilio E.

2010-04-01

We use the microlensing variability observed for 11 gravitationally lensed quasars to show that the accretion disk size at a rest-frame wavelength of 2500 Å is related to the black hole mass by log(R 2500/cm) = (15.78 ± 0.12) + (0.80 ± 0.17)log(M BH/109 M sun). This scaling is consistent with the expectation from thin-disk theory (R vprop M 2/3 BH), but when interpreted in terms of the standard thin-disk model (T vprop R -3/4), it implies that black holes radiate with very low efficiency, log(η) = -1.77 ± 0.29 + log(L/L E), where η =L/(\\dot{M}c^2). Only by making the maximum reasonable shifts in the average inclination, Eddington factors, and black hole masses can we raise the efficiency estimate to be marginally consistent with typical efficiency estimates (η ≈ 10%). With one exception, these sizes are larger by a factor of ~4 than the size needed to produce the observed 0.8 μm quasar flux by thermal radiation from a thin disk with the same T vprop R -3/4 temperature profile. While scattering a significant fraction of the disk emission on large scales or including a large fraction of contaminating line emission can reduce the size discrepancy, resolving it also appears to require that accretion disks have flatter temperature/surface brightness profiles. Based on observations obtained with the Small and Moderate Aperture Research Telescope System (SMARTS) 1.3 m, which is operated by the SMARTS Consortium, the Apache Point Observatory 3.5 m telescope, which is owned and operated by the Astrophysical Research Consortium, the WIYN Observatory which is owned and operated by the University of Wisconsin, Indiana University, Yale University, and the National Optical Astronomy Observatories (NOAO), the 6.5 m Magellan Baade telescope, which is a collaboration between the observatories of the Carnegie Institution of Washington (OCIW), University of Arizona, Harvard University, University of Michigan, and Massachusetts Institute of Technology, and observations made

A Compton-thick Wind in the High Luminosity Quasar, PDS 456

Science.gov (United States)

Reeves, J. N.; O'Brien, P. T.; Behar, E.; Miller, L.; Turner, T. J.; Braito, V.; Fabian, A. C.; Kaspi, S.; Mushotzky, R.; Ward, M.

2009-01-01

PDS 456 is a nearby (z=0.184), luminous (L(sub bol) approximately equal to 10(exp 47) ergs(exp -1) type I quasar. A deep 190 ks Suzaku observation in February 2007 revealed the complex, broad band X-ray spectrum of PDS 456. The Suzaku spectrum exhibits highly statistically significant absorption features near 9 keV in the quasar rest-frame. We show that the most plausible origin of the absorption is from blue-shifted resonance (1s-2p) transitions of hydrogen-like iron (at 6.97 keV in the rest frame). This indicates that a highly ionized outflow may be present moving at near relativistic velocities (0.26-0.31c). A possible hard X-ray excess is detected above 15 keV with HXD (at 99.8% confidence), which may arise from high column density gas (N(sub H) greater than 10(exp 24)cm(exp -2) partially covering the X-ray emission, or through strong Compton reflection. Here we propose that the iron K-shell absorption in PDS 456 is associated with a thick, possibly clumpy outflow, covering about 20% of 4(pi) steradian solid angle. The outflow is likely launched from the inner accretion disk, within 15-100 gravitational radii of the black hole. The kinetic power of the outflow may be similar to the bolometric luminosity of PDS 456. Such a powerful wind could have a significant effect on the co-evolution of the host galaxy and its supermassive black hole, through feedback.

Clues to quasar broad-line region geometry and kinematics

NARCIS (Netherlands)

Vestergaard, M; Wilkes, BJ; Barthel, PD

2000-01-01

We present evidence that the high-velocity C IV lambda 1549 emission-line gas of radio-loud quasars may originate in a disklike configuration, in close proximity to the accretion disk often assumed to emit the low-ionization lines. For a sample of 36 radio-loud z approximate to 2 quasars, we find

Highly Accreting Quasars at High Redshift

Directory of Open Access Journals (Sweden)

Mary L. Martínez-Aldama

2018-01-01

Full Text Available We present preliminary results of a spectroscopic analysis for a sample of type 1 highly accreting quasars (L/LEdd ~ 1.0 at high redshift, z ~2–3. The quasars were observed with the OSIRIS spectrograph on the GTC 10.4 m telescope located at the Observatorio del Roque de los Muchachos in La Palma. The highly accreting quasars were identified using the 4D Eigenvector 1 formalism, which is able to organize type 1 quasars over a broad range of redshift and luminosity. The kinematic and physical properties of the broad line region have been derived by fitting the profiles of strong UV emission lines such as Aliiiλ1860, Siiii]λ1892 and Ciii]λ1909. The majority of our sources show strong blueshifts in the high-ionization lines and high Eddington ratios which are related with the productions of outflows. The importance of highly accreting quasars goes beyond a detailed understanding of their physics: their extreme Eddington ratio makes them candidates standard candles for cosmological studies.

The QUASAR facility

Science.gov (United States)

Gates, David

2013-10-01

The QUAsi-Axisymmetric Research (QUASAR) stellarator is a new facility which can solve two critical problems for fusion, disruptions and steady-state, and which provides new insights into the role of magnetic symmetry in plasma confinement. If constructed it will be the only quasi-axisymmetric stellarator in the world. The innovative principle of quasi-axisymmetry (QA) will be used in QUASAR to study how ``tokamak-like'' systems can be made: 1) Disruption-free, 2) Steady-state with low recirculating power, while preserving or improving upon features of axisymmetric tokamaks, such as 1) Stable at high pressure simultaneous with 2) High confinement (similar to tokamaks), and 3) Scalable to a compact reactor Stellarator research is critical to fusion research in order to establish the physics basis for a magnetic confinement device that can operate efficiently in steady-state, without disruptions at reactor-relevant parameters. The two large stellarator experiments - LHD in Japan and W7-X under construction in Germany are pioneering facilities capable of developing 3D physics understanding at large scale and for very long pulses. The QUASAR design is unique in being QA and optimized for confinement, stability, and moderate aspect ratio (4.5). It projects to a reactor with a major radius of ~8 m similar to advanced tokamak concepts. It is striking that (a) the EU DEMO is a pulsed (~2.5 hour) tokamak with major R ~ 9 m and (b) the ITER physics scenarios do not presume steady-state behavior. Accordingly, QUASAR fills a critical gap in the world stellarator program. This work supported by DoE Contract No. DEAC02-76CH03073.

Quasar 2175 Å dust absorbers - II. Correlation analysis and relationship with other absorption line systems

Science.gov (United States)

Ma, Jingzhe; Ge, Jian; Prochaska, J. Xavier; Zhang, Shaohua; Ji, Tuo; Zhao, Yinan; Zhou, Hongyan; Lu, Honglin; Schneider, Donald P.

2018-03-01

We present the cold neutral content (H I and C I gas) of 13 quasar 2175 Å dust absorbers (2DAs) at z = 1.6-2.5 to investigate the correlation between the presence of the UV extinction bump with other physical characteristics. These 2DAs were initially selected from the Sloan Digital Sky Surveys I-III and followed up with the Keck-II telescope and the Multiple Mirror Telescope as detailed in our Paper I. We perform a correlation analysis between metallicity, redshift, depletion level, velocity width, and explore relationships between 2DAs and other absorption line systems. The 2DAs on average have higher metallicity, higher depletion levels, and larger velocity widths than Damped Lyman α absorbers (DLAs) or subDLAs. The correlation between [Zn/H] and [Fe/Zn] or [Zn/H] and logΔV90 can be used as alternative stellar mass estimators based on the well-established mass-metallicity relation. The estimated stellar masses of the 2DAs in this sample are in the range of ˜109 to ˜2 × 1011 M⊙ with a median value of ˜2 × 1010 M⊙. The relationship with other quasar absorption line systems can be described as (1) 2DAs are a subset of Mg II and Fe II absorbers, (2) 2DAs are preferentially metal-strong DLAs/subDLAs, (3) More importantly, all of the 2DAs show C I detections with logN(C I) > 14.0 cm-2, and (4) 2DAs can be used as molecular gas tracers. Their host galaxies are likely to be chemically enriched, evolved, massive (more massive than typical DLA/subDLA galaxies), and presumably star-forming galaxies.

Constraining the location of rapid gamma-ray flares in the flat spectrum radio quasar 3C 273 [Constraining the location of rapid gamma-ray flares in the FSRQ 3C 273

International Nuclear Information System (INIS)

Rani, B.; Lott, B.; Krichbaum, T. P.; Fuhrmann, L.; Zensus, J. A.

2013-01-01

Here, we present a γ-ray photon flux and spectral variability study of the flat-spectrum radio quasar 3C 273 over a rapid flaring activity period between September 2009 to April 2010. Five major flares were observed in the source during this period. The most rapid flare observed in the source has a flux doubling time of 1.1 hr. The rapid γ-ray flares allow us to constrain the location and size of the γ-ray emission region in the source. The γγ-opacity constrains the Doppler factor δ_γ ≥ 10 for the highest energy (15 GeV) photon observed by the Fermi-Large Area Telescope (LAT). Causality arguments constrain the size of the emission region to 1.6 × 10"1"5 cm. The γ-ray spectra measured over this period show clear deviations from a simple power law with a break in the 1–2 GeV energy range. We discuss possible explanations for the origin of the γ-ray spectral breaks. Our study suggests that the γ-ray emission region in 3C 273 is located within the broad line region (< 1.6 pc). As a result, the spectral behavior and temporal characteristics of the individual flares indicate the presence of multiple shock scenarios at the base of the jet.

THE PROPERTIES OF QUASAR HOSTS AT THE PEAK OF THE QUASAR ACTIVITY

International Nuclear Information System (INIS)

Kotilainen, Jari K.; Falomo, Renato; Decarli, Roberto; Treves, Aldo; Uslenghi, Michela; Scarpa, Riccardo

2009-01-01

We present near-infrared imaging obtained with ESO VLT/ISAAC of a sample of 16 low luminosity radio-quiet quasars (RQQs) at the epoch around the peak of the quasar activity (2 2. The luminosity trend with a cosmic epoch resembles that observed for massive inactive galaxies, suggesting a similar star formation history. In particular, both quasar host galaxies and massive inactive galaxies appear mostly assembled already at the peak age of the quasar activity. This result is of key importance for testing the models of joint formation and evolution of galaxies and their active nuclei.

Radio structure in quasars

International Nuclear Information System (INIS)

Barthel, P.D.

1984-01-01

In this thesis, observational attention is given to the extended extragalactic radio sources associated with quasars. The isolated compact radio sources, often identified with quasars, are only included in the discussions. Three aspects of the radio structure in quasars and their cosmic evolution are considered: a study of the parsec scale morphology in quasar cores, in relation to the extended morphologies; an investigation of possible epoch dependent hotspot properties as well as a more detailed investigation of this fine scale structure; a VLA project was carried out to obtain morphological information on scales of 0.5 arcsec on high redshift quasars and to investigate possible epoch dependent morphological properties. MERLIN observations at 0.1 arcsec resolution to supplement the VLA data were initiated. (Auth.)

Distribution in depth of quasars

International Nuclear Information System (INIS)

Schmidt, M.; Green, R.F.

1980-01-01

The authors discuss the distribution in depth of different kinds of quasars: quasi-stellar radio sources with steep radio spectrum, those with flat radio spectrum, and optically selected quasars. All exhibit an increase of space density with distance to a different degree. The optically selected quasars, in particular, show a steep increase of surface density with magnitude. The steepness of the increase is inconsistent with a uniform distribution of quasars in the local hypothesis. In the cosmological hypothesis the co-moving space density of optically selected quasars increases by a factor of 100,000 to a redshift of 2, and by factors of 1000 and 10 for steep-spectrum and flat-spectrum radio quasars, respectively. (Auth.)

An astrophysics data program investigation of a synoptic study of quasar continua

Science.gov (United States)

Elvis, Martin

1991-01-01

A summary of the program is presented. The major product of the program, an atlas of quasar energy distributions, is presented in the appendices along with papers written as a result of this research. The topics covered in the papers include: (1) accurate galactic N(sub h) values toward quasars and active galactic nuclei (AGN); (2) weak bump quasars; (3) millimeter measurements of hard x ray selected active galaxies- implications for the nature of the continuous spectrum; (3) persistence and change in the soft x ray spectrum of the quasar PG1211+143; (4) the soft x ray excess in einstein quasar spectra; and (5) EXOSAT x ray spectra of quasars.

3C 220.3: A radio galaxy lensing a submillimeter galaxy

Energy Technology Data Exchange (ETDEWEB)

Haas, Martin; Westhues, Christian; Chini, Rolf [Astronomisches Institut, Ruhr Universität, Bochum (Germany); Leipski, Christian; Klaas, Ulrich; Meisenheimer, Klaus [Max-Planck-Institut für Astronomie, Heidelberg (Germany); Barthel, Peter; Koopmans, Léon V. E. [Kapteyn Astronomical Institute, University of Groningen (Netherlands); Wilkes, Belinda J.; Bussmann, R. Shane; Willner, S. P.; Ashby, Matthew L. N.; Kuraszkiewicz, Joanna [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Vegetti, Simona [Max-Planck-Institut für Astrophysik, Garching (Germany); Clements, David L. [Imperial College, London (United Kingdom); Fassnacht, Christopher D. [University of California, Davis, CA (United States); Horesh, Assaf [Division of Physics, Mathematics, and Astronomy, California Institute of Technology, Pasadena, CA (United States); Lagattuta, David J. [Centre for Astrophysics and Supercomputing, Swinburne University of Technology, Hawthorn (Australia); Stern, Daniel; Wylezalek, Dominika, E-mail: haas@astro.rub.de [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA (United States)

2014-07-20

Herschel Space Observatory photometry and extensive multiwavelength follow-up have revealed that the powerful radio galaxy (PRG) 3C 220.3 at z = 0.685 acts as a gravitational lens for a background submillimeter galaxy (SMG) at z = 2.221. At an observed wavelength of 1 mm, the SMG is lensed into three distinct images. In the observed near infrared, these images are connected by an arc of ∼1''.8 radius forming an Einstein half-ring centered near the radio galaxy. In visible light, only the arc is apparent. 3C 220.3 is the only known instance of strong galaxy-scale lensing by a PRG not located in a galaxy cluster and therefore it offers the potential to probe the dark matter content of the radio galaxy host. Lens modeling rejects a single lens, but two lenses centered on the radio galaxy host A and a companion B, separated by 1''.5, provide a fit consistent with all data and reveal faint candidates for the predicted fourth and fifth images. The model does not require an extended common dark matter halo, consistent with the absence of extended bright X-ray emission on our Chandra image. The projected dark matter fractions within the Einstein radii of A (1''.02) and B (0''.61) are about 0.4 ± 0.3 and 0.55 ± 0.3. The mass to i-band light ratios of A and B, M/L{sub i}∼8±4 M{sub ⊙} L{sub ⊙}{sup −1}, appear comparable to those of radio-quiet lensing galaxies at the same redshift in the CfA-Arizona Space Telescope LEns Survey, Lenses Structure and Dynamics, and Strong Lenses in the Legacy Survey samples. The lensed SMG is extremely bright with observed f(250 μm) = 440 mJy owing to a magnification factor μ ∼ 10. The SMG spectrum shows luminous, narrow C IV λ1549 Å emission, revealing that the SMG houses a hidden quasar in addition to a violent starburst. Multicolor image reconstruction of the SMG indicates a bipolar morphology of the emitted ultraviolet (UV) light suggestive of cones through which UV light escapes a

Rapidly star-forming galaxies adjacent to quasars at redshifts exceeding 6.

Science.gov (United States)

Decarli, R; Walter, F; Venemans, B P; Bañados, E; Bertoldi, F; Carilli, C; Fan, X; Farina, E P; Mazzucchelli, C; Riechers, D; Rix, H-W; Strauss, M A; Wang, R; Yang, Y

2017-05-24

The existence of massive (10 11 solar masses) elliptical galaxies by redshift z ≈ 4 (refs 1, 2, 3; when the Universe was 1.5 billion years old) necessitates the presence of galaxies with star-formation rates exceeding 100 solar masses per year at z > 6 (corresponding to an age of the Universe of less than 1 billion years). Surveys have discovered hundreds of galaxies at these early cosmic epochs, but their star-formation rates are more than an order of magnitude lower. The only known galaxies with very high star-formation rates at z > 6 are, with one exception, the host galaxies of quasars, but these galaxies also host accreting supermassive (more than 10 9 solar masses) black holes, which probably affect the properties of the galaxies. Here we report observations of an emission line of singly ionized carbon ([C ii] at a wavelength of 158 micrometres) in four galaxies at z > 6 that are companions of quasars, with velocity offsets of less than 600 kilometres per second and linear offsets of less than 100 kiloparsecs. The discovery of these four galaxies was serendipitous; they are close to their companion quasars and appear bright in the far-infrared. On the basis of the [C ii] measurements, we estimate star-formation rates in the companions of more than 100 solar masses per year. These sources are similar to the host galaxies of the quasars in [C ii] brightness, linewidth and implied dynamical mass, but do not show evidence for accreting supermassive black holes. Similar systems have previously been found at lower redshift. We find such close companions in four out of the twenty-five z > 6 quasars surveyed, a fraction that needs to be accounted for in simulations. If they are representative of the bright end of the [C ii] luminosity function, then they can account for the population of massive elliptical galaxies at z ≈ 4 in terms of the density of cosmic space.

Genomic and phylogenetic characterization of luminous bacteria symbiotic with the deep-sea fish Chlorophthalmus albatrossis (Aulopiformes: Chlorophthalmidae).

Science.gov (United States)

Dunlap, Paul V; Ast, Jennifer C

2005-02-01

Bacteria forming light-organ symbiosis with deep-sea chlorophthalmid fishes (Aulopiformes: Chlorophthalmidae) are considered to belong to the species Photobacterium phosphoreum. The identification of these bacteria as P. phosphoreum, however, was based exclusively on phenotypic traits, which may not discriminate between phenetically similar but evolutionarily distinct luminous bacteria. Therefore, to test the species identification of chlorophthalmid symbionts, we carried out a genomotypic (repetitive element palindromic PCR genomic profiling) and phylogenetic analysis on strains isolated from the perirectal light organ of Chlorophthalmus albatrossis. Sequence analysis of the 16S rRNA gene of 10 strains from 5 fish specimens placed these bacteria in a cluster related to but phylogenetically distinct from the type strain of P. phosphoreum, ATCC 11040(T), and the type strain of Photobacterium iliopiscarium, ATCC 51760(T). Analysis of gyrB resolved the C. albatrossis strains as a strongly supported clade distinct from P. phosphoreum and P. iliopiscarium. Genomic profiling of 109 strains from the 5 C. albatrossis specimens revealed a high level of similarity among strains but allowed identification of genomotypically different types from each fish. Representatives of each type were then analyzed phylogenetically, using sequence of the luxABFE genes. As with gyrB, analysis of luxABFE resolved the C. albatrossis strains as a robustly supported clade distinct from P. phosphoreum. Furthermore, other strains of luminous bacteria reported as P. phosphoreum, i.e., NCIMB 844, from the skin of Merluccius capensis (Merlucciidae), NZ-11D, from the light organ of Nezumia aequalis (Macrouridae), and pjapo.1.1, from the light organ of Physiculus japonicus (Moridae), grouped phylogenetically by gyrB and luxABFE with the C. albatrossis strains, not with ATCC 11040(T). These results demonstrate that luminous bacteria symbiotic with C. albatrossis, together with certain other strains of

A Three-decade X-band VLBI Study of 3CR Lobe-dominated Quasar Nuclei

Directory of Open Access Journals (Sweden)

Hough David H.

2013-12-01

Full Text Available We report X-band VLBI observations of several 3CR lobe-dominated quasar nuclei from 1981 to 2010, mostly obtained with the NRAO VLBA. The goal is to follow flux density outbursts and to fully determine the jet morphology and kinematics on 1-100 pc scales. In 3C207, the core region has flux outbursts at mean intervals of ~7 yr; one of these is actually a double outburst from a stationary true core and a swinging component ~0.5 mas apart. The position angle (PA of the swinging component varies by ~40°, while the PA values of the jet components span ~25°. The jet extends to ~25 mas. Average superluminal speeds are ~10c. One component shows apparent acceleration from 7c to 14c at 2-3 mas from the true core, in a jet recollimation zone that redirects the flow toward PA ~90°. Individual jet components expand until reaching the recollimation zone. In 3C263 and other objects, some of the same phenomena are seen, including ejection of jet components over a range in PA, superluminal motion, and apparent acceleration, but to a lesser degree. Possible physical interpretations involving beaming, orientation, projection, precession, and magnetic effects are discussed.

Quasar Absorption Studies

Science.gov (United States)

Mushotzky, Richard (Technical Monitor); Elvis, Martin

2004-01-01

The aim of the proposal is to investigate the absorption properties of a sample of inter-mediate redshift quasars. The main goals of the project are: Measure the redshift and the column density of the X-ray absorbers; test the correlation between absorption and redshift suggested by ROSAT and ASCA data; constrain the absorber ionization status and metallicity; constrain the absorber dust content and composition through the comparison between the amount of X-ray absorption and optical dust extinction. Unanticipated low energy cut-offs where discovered in ROSAT spectra of quasars and confirmed by ASCA, BeppoSAX and Chandra. In most cases it was not possible to constrain adequately the redshift of the absorber from the X-ray data alone. Two possibilities remain open: a) absorption at the quasar redshift; and b) intervening absorption. The evidences in favour of intrinsic absorption are all indirect. Sensitive XMM observations can discriminate between these different scenarios. If the absorption is at the quasar redshift we can study whether the quasar environment evolves with the Cosmic time.

SDSS J013127.34–032100.1: A NEWLY DISCOVERED RADIO-LOUD QUASAR AT z = 5.18 WITH EXTREMELY HIGH LUMINOSITY

Energy Technology Data Exchange (ETDEWEB)

Yi, Wei-Min; Bai, Jin-Ming; Zhang, Ju-jia; Wang, Fang; Wang, Jian-Guo; Fan, Yu-Feng; Chang, Liang; Wang, Chuan-Jun; Lun, Bao-Li [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Wang, Feige; Wu, Xue-Bing; Yang, Jinyi; Ho, Luis C.; Zuo, Wenwen; Yang, Qian; Ai, Yanli [Department of Astronomy, School of Physics, Peking University, Beijing 100871 (China); Fan, Xiaohui [Steward Observatory, University of Arizona, Tucson, AZ 85721-0065 (United States); Brandt, William N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Kim, Minjin [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of); Wang, Ran [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); and others

2014-11-10

Very few of the z > 5 quasars discovered to date have been radio-loud, with radio-to-optical flux ratios (radio-loudness parameters) higher than 10. Here we report the discovery of an optically luminous radio-loud quasar, SDSS J013127.34–032100.1 (J0131–0321 in short), at z = 5.18 ± 0.01 using the Lijiang 2.4 m and Magellan telescopes. J0131–0321 has a spectral energy distribution consistent with that of radio-loud quasars. With an i-band magnitude of 18.47 and a radio flux density of 33 mJy, its radio-loudness parameter is ∼100. The optical and near-infrared spectra taken by Magellan enable us to estimate its bolometric luminosity to be L {sub bol} ∼ 1.1 × 10{sup 48} erg s{sup –1}, approximately 4.5 times greater than that of the most distant quasar known to date. The black hole mass of J0131–0321 is estimated to be 2.7 × 10{sup 9} M {sub ☉}, with an uncertainty up to 0.4 dex. Detailed physical properties of this high-redshift, radio-loud, potentially super-Eddington quasar can be probed in the future with more dedicated and intensive follow-up observations using multi-wavelength facilities.

Discovery of an infrared nucleus in Cygnus A - An obscured quasar revealed?

International Nuclear Information System (INIS)

Djorgovski, S.; Weir, N.; Matthews, K.; Graham, J.R.

1991-01-01

This paper reports on the discovery of a compact, unresolved infrared nucleus, coincident with the radio core, in the prototypical powerful radio galaxy Cygnus A (3C 405). The infrared colors and magnitudes of the nucleus can be explained as a highly reddened extension of the radio continuum. The implied restframe extinction is A(V) equal to about 50 + or - 30 magnitudes. The extinction-corrected luminosity of the object is in the quasar range. This discovery gives some support to the unification models for quasars and powerful radio galaxies. 35 refs

Testing Disk-Wind Models with Quasar CIV 1549Å Associated Absorption Lines

DEFF Research Database (Denmark)

Vestergaard, Marianne

2012-01-01

Narrow associated C IV 1549Å absorption lines (NALs) with a rest equivalent width EW =3 Å detected in z ˜ 2 radio-loud and radio-quiet quasars, (a) exhibit evidence of an origin in radiatively accelerated gas, and (b) may be closely related to broad absorption line (BAL) outflows. These NALs...... and the few BALs detected in this quasar sample obey key predictions of models of radiatively driven disk-winds in which (1) the local disk luminosity launches the wind, (2) the central UV radiation drives it outwards, and (3) the wind acceleration (i.e., terminal velocity) depends on the strength of the X...

Moderate resolution spectrophotometry of high redshift quasars

Science.gov (United States)

Schneider, Donald P.; Schmidt, Maarten; Gunn, James E.

1991-01-01

A uniform set of photometry and high signal-to-noise moderate resolution spectroscopy of 33 quasars with redshifts larger than 3.1 is presented. The sample consists of 17 newly discovered quasars (two with redshifts in excess of 4.4) and 16 sources drawn from the literature. The objects in this sample have r magnitudes between 17.4 and 21.4; their luminosities range from -28.8 to -24.9. Three of the 33 objects are broad absorption line quasars. A number of possible high redshift damped Ly-alpha systems were found.

The X-Ray Reflection Spectrum of the Radio-loud Quasar 4C 74.26

DEFF Research Database (Denmark)

Lohfink, Anne M.; Fabian, Andrew C.; Ballantyne, David R.

2017-01-01

The relativistic jets created by some active galactic nuclei are important agents of AGN feedback. In spite of this, our understanding of what produces these jets is still incomplete. X-ray observations, which can probe the processes operating in the central regions in the immediate vicinity of t...... the three months covered by our NuSTAR campaign. This lack of variation could mean that the jet formation in this radio-loud quasar differs from what is observed in broad-line radio galaxies.......The relativistic jets created by some active galactic nuclei are important agents of AGN feedback. In spite of this, our understanding of what produces these jets is still incomplete. X-ray observations, which can probe the processes operating in the central regions in the immediate vicinity...... of the supermassive black hole, the presumed jet launching point, are potentially particularly valuable in illuminating the jet formation process. Here, we present the hard X-ray NuSTAR observations of the radio-loud quasar 4C 74.26 in a joint analysis with quasi-simultaneous, soft X-ray Swift observations. Our...

Sunyaev–Zel’Dovich Signal from Quasar Hosts: Implications for Detection of Quasar Feedback

Energy Technology Data Exchange (ETDEWEB)

Chowdhury, Dhruba Dutta; Chatterjee, Suchetana, E-mail: dhruba.duttachowdhury@yale.edu [Department of Physics, Presidency University, Kolkata, 700073 (India)

2017-04-10

Several analytic and numerical studies have indicated that the interstellar medium of a quasar host galaxy heated by feedback can contribute to a substantial secondary signal in the cosmic microwave background (CMB) through the thermal Sunyaev–Zel’dovich (SZ) effect. Recently, many groups have tried to detect this signal by cross-correlating CMB maps with quasar catalogs. Using a self-similar model for the gas in the intra-cluster medium and a realistic halo occupation distribution (HOD) prescription for quasars, we estimate the level of SZ signal from gravitational heating of quasar hosts. The bias in the host halo signal estimation due to an unconstrained high mass HOD tail and yet unknown redshift dependence of the quasar HOD restricts us from drawing any robust conclusions at low redshift ( z < 1.5) from our analysis. However, at higher redshifts ( z > 2.5), we find an excess signal in recent observations than what is predicted from our model. The excess signal could be potentially generated from additional heating due to quasar feedback.

Sunyaev–Zel’Dovich Signal from Quasar Hosts: Implications for Detection of Quasar Feedback

International Nuclear Information System (INIS)

Chowdhury, Dhruba Dutta; Chatterjee, Suchetana

2017-01-01

Several analytic and numerical studies have indicated that the interstellar medium of a quasar host galaxy heated by feedback can contribute to a substantial secondary signal in the cosmic microwave background (CMB) through the thermal Sunyaev–Zel’dovich (SZ) effect. Recently, many groups have tried to detect this signal by cross-correlating CMB maps with quasar catalogs. Using a self-similar model for the gas in the intra-cluster medium and a realistic halo occupation distribution (HOD) prescription for quasars, we estimate the level of SZ signal from gravitational heating of quasar hosts. The bias in the host halo signal estimation due to an unconstrained high mass HOD tail and yet unknown redshift dependence of the quasar HOD restricts us from drawing any robust conclusions at low redshift ( z < 1.5) from our analysis. However, at higher redshifts ( z > 2.5), we find an excess signal in recent observations than what is predicted from our model. The excess signal could be potentially generated from additional heating due to quasar feedback.

X-ray, optical, and radio properties of quasars

International Nuclear Information System (INIS)

Blumenthal, G.R.; Keel, W.C.; Miller, J.S.

1982-01-01

We have examined a sample of 26 low-redshift quasars for the relationships between X-ray luminosity and optical spectroscopic features. All quasars were observed with the Einstein Observatory and with the IDS on the Lick 3 meter telescope. We find evidence for correlations between quasar X-ray luminosity and both optical continuum luminosity and Hβ luminosity. In the latter case, there is a smooth relationship connecting quasars, Seyfert 1, and Seyfert 2 galaxies. For the quasars in this sample, there is also a strong correlation between optical continuum luminosity and both the Hβ luminosity and equivalent width. Unlike the case for Seyfert 1 nuclei, there is no evidence for a correlation between X-ray luminosity and either the Hβ/[O III] ratio or the width at zero intensity of the Hβ line. However, we do find some evidence for a weak correlation between α'/sub o/x, the mean continuum spectral index between 5000 A and 2 keV, and Fe II equivalent width, Hβ equivalent width, Hβ line width at zero intensity, and the ratio of Hβ equivalent width to its line width at zero intensity. Overall, we found few strong correlations between optical spectroscopic quanitites and X-ray properties of quasars. Some of the implications of these results for models of quasars and quasar emission line regions are discussed

Quasar outflow energetics from broad absorption line variability

Science.gov (United States)

McGraw, S. M.; Shields, J. C.; Hamann, F. W.; Capellupo, D. M.; Herbst, H.

2018-03-01

Quasar outflows have long been recognized as potential contributors to the co-evolution between supermassive black holes (SMBHs) and their host galaxies. The role of outflows in active galactic nucleus (AGN) feedback processes can be better understood by placing observational constraints on wind locations and kinetic energies. We utilize broad absorption line (BAL) variability to investigate the properties of a sample of 71 BAL quasars with P V broad absorption. The presence of P V BALs indicates that other BALs like C IV are saturated, such that variability in those lines favours clouds crossing the line of sight. We use these constraints with measurements of BAL variability to estimate outflow locations and energetics. Our data set consists of multiple-epoch spectra from the Sloan Digital Sky Survey and MDM Observatory. We detect significant (4σ) BAL variations from 10 quasars in our sample over rest-frame time-scales between ≤0.2-3.8 yr. Our derived distances for the 10 variable outflows are nominally ≲ 1-10 pc from the SMBH using the transverse-motion scenario, and ≲ 100-1000 pc from the central source using ionization-change considerations. These distances, in combination with the estimated high outflow column densities (i.e. NH ≳ 1022 cm-2), yield outflow kinetic luminosities between ˜ 0.001 and 1 times the bolometric luminosity of the quasar, indicating that many absorber energies within our sample are viable for AGN feedback.

Characteristics of estrogen-induced peroxidase in mouse uterine luminal fluid

International Nuclear Information System (INIS)

Jellinck, P.H.; Newbold, R.R.; McLachlan, J.A.

1991-01-01

Peroxidase activity in the uterine luminal fluid of mice treated with diethylstilbestrol was measured by the guaiacol assay and also by the formation of 3H2O from [2-3H]estradiol. In the radiometric assay, the generation of 3H2O and 3H-labeled water-soluble products was dependent on H2O2 (25 to 100 microM), with higher concentrations being inhibitory. Tyrosine or 2,4-dichlorophenol strongly enhanced the reaction catalyzed either by the luminal fluid peroxidase or the enzyme in the CaCl2 extract of the uterus, but decreased the formation of 3H2O from [2-3H]estradiol by lactoperoxidase in the presence of H2O2 (80 microM). NADPH, ascorbate, and cytochrome c inhibited both luminal fluid and uterine tissue peroxidase activity to the same extent, while superoxide dismutase showed a marginal activating effect. Lactoferrin, a major protein component of uterine luminal fluid, was shown not to contribute to its peroxidative activity, and such an effect by prostaglandin synthase was also ruled out. However, it was not possible to exclude eosinophil peroxidase, brought to the uterus after estrogen stimulation, as being the source of peroxidase activity in uterine luminal fluid

DISCOVERING BRIGHT QUASARS AT INTERMEDIATE REDSHIFTS BASED ON OPTICAL/NEAR-INFRARED COLORS

International Nuclear Information System (INIS)

Wu, Xue-Bing; Zuo, Wenwen; Yang, Jinyi; Yang, Qian; Wang, Feige

2013-01-01

The identification of quasars at intermediate redshifts (2.2 < z < 3.5) has been inefficient in most previous quasar surveys since the optical colors of quasars are similar to those of stars. The near-IR K-band excess technique has been suggested to overcome this difficulty. Our recent study also proposed to use optical/near-IR colors for selecting z < 4 quasars. To verify the effectiveness of this method, we selected a list of 105 unidentified bright targets with i ≤ 18.5 from the quasar candidates of SDSS DR6 with both SDSS ugriz optical and UKIDSS YJHK near-IR photometric data, which satisfy our proposed Y – K/g – z criterion and have photometric redshifts between 2.2 and 3.5 estimated from the nine-band SDSS-UKIDSS data. We observed 43 targets with the BFOSC instrument on the 2.16 m optical telescope at Xinglong station of the National Astronomical Observatory of China in the spring of 2012. We spectroscopically identified 36 targets as quasars with redshifts between 2.1 and 3.4. The high success rate of discovering these quasars in the SDSS spectroscopic surveyed area further demonstrates the robustness of both the Y – K/g – z selection criterion and the photometric redshift estimation technique. We also used the above criterion to investigate the possible stellar contamination rate among the quasar candidates of SDSS DR6, and found that the rate is much higher when selecting 3 < z < 3.5 quasar candidates than when selecting lower redshift candidates (z < 2.2). The significant improvement in the photometric redshift estimation when using the nine-band SDSS-UKIDSS data over the five-band SDSS data is demonstrated and a catalog of 7727 unidentified quasar candidates in SDSS DR6 selected with optical/near-IR colors and having photometric redshifts between 2.2 and 3.5 is provided. We also tested the Y – K/g – z selection criterion with the recently released SDSS-III/DR9 quasar catalog and found that 96.2% of 17,999 DR9 quasars with UKIDSS Y- and K

Spatially Resolved Patchy Ly α Emission within the Central Kiloparsec of a Strongly Lensed Quasar Host Galaxy at z = 2.8

Energy Technology Data Exchange (ETDEWEB)

Bayliss, Matthew B.; Bordoloi, Rongmon [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Sharon, Keren; Runnoe, Jessie; Johnson, Traci; Paterno-Mahler, Rachel [Department of Astronomy, University of Michigan, 1085 S. University Avenue, Ann Arbor, MI 48109 (United States); Acharyya, Ayan; Bian, Fuyan; Kewley, Lisa [RSAA, Australian National University, Cotter Road, Weston Creek, ACT 2611 (Australia); Gladders, Michael D. [Kavli Institute for Cosmological Physics, University of Chicago, Chicago, IL 60637 (United States); Rigby, Jane R. [Astrophysics Science Division, NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Dahle, Hakon [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029, Blindern, NO-0315 Oslo (Norway); Florian, Michael, E-mail: mbayliss@mit.edu [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States)

2017-08-20

We report the detection of extended Ly α emission from the host galaxy of SDSS J2222+2745, a strongly lensed quasar at z = 2.8. Spectroscopic follow-up clearly reveals extended Ly α in emission between two images of the central active galactic nucleus (AGN). We reconstruct the lensed quasar host galaxy in the source plane by applying a strong lens model to HST imaging and resolve spatial scales as small as ∼200 pc. In the source plane, we recover the host galaxy morphology to within a few hundred parsecs of the central AGN and map the extended Ly α emission to its physical origin on one side of the host galaxy at radii ∼0.5–2 kpc from the central AGN. There are clear morphological differences between the Ly α and rest-frame ultraviolet stellar continuum emission from the quasar host galaxy. Furthermore, the relative velocity profiles of quasar Ly α , host galaxy Ly α , and metal lines in outflowing gas reveal differences in the absorbing material affecting the AGN and host galaxy. These data indicate the presence of patchy local intervening gas in front of the central quasar and its host galaxy. This interpretation is consistent with the central luminous quasar being obscured across a substantial fraction of its surrounding solid angle, resulting in strong anisotropy in the exposure of the host galaxy to ionizing radiation from the AGN. This work demonstrates the power of strong-lensing-assisted studies to probe spatial scales that are currently inaccessible by other means.

Spatially Resolved Patchy Ly α Emission within the Central Kiloparsec of a Strongly Lensed Quasar Host Galaxy at z = 2.8

International Nuclear Information System (INIS)

Bayliss, Matthew B.; Bordoloi, Rongmon; Sharon, Keren; Runnoe, Jessie; Johnson, Traci; Paterno-Mahler, Rachel; Acharyya, Ayan; Bian, Fuyan; Kewley, Lisa; Gladders, Michael D.; Rigby, Jane R.; Dahle, Hakon; Florian, Michael

2017-01-01

We report the detection of extended Ly α emission from the host galaxy of SDSS J2222+2745, a strongly lensed quasar at z = 2.8. Spectroscopic follow-up clearly reveals extended Ly α in emission between two images of the central active galactic nucleus (AGN). We reconstruct the lensed quasar host galaxy in the source plane by applying a strong lens model to HST imaging and resolve spatial scales as small as ∼200 pc. In the source plane, we recover the host galaxy morphology to within a few hundred parsecs of the central AGN and map the extended Ly α emission to its physical origin on one side of the host galaxy at radii ∼0.5–2 kpc from the central AGN. There are clear morphological differences between the Ly α and rest-frame ultraviolet stellar continuum emission from the quasar host galaxy. Furthermore, the relative velocity profiles of quasar Ly α , host galaxy Ly α , and metal lines in outflowing gas reveal differences in the absorbing material affecting the AGN and host galaxy. These data indicate the presence of patchy local intervening gas in front of the central quasar and its host galaxy. This interpretation is consistent with the central luminous quasar being obscured across a substantial fraction of its surrounding solid angle, resulting in strong anisotropy in the exposure of the host galaxy to ionizing radiation from the AGN. This work demonstrates the power of strong-lensing-assisted studies to probe spatial scales that are currently inaccessible by other means.

Analyzing polarization swings in 3C 279

Directory of Open Access Journals (Sweden)

Kiehlmann S.

2013-12-01

Full Text Available Quasar 3C 279 is known to exhibit episodes of optical polarization angle rotation. We present new, well-sampled optical polarization data for 3C 279 and introduce a method to distinguish between random and deterministic electric vector position angle (EVPA variations. We observe EVPA rotations in both directions with different amplitudes and find that the EVPA variation shows characteristics of both random and deterministic cases. Our analysis indicates that the EVPA variation is likely dominated by a random process in the low brightness state of the jet and by a deterministic process in the flaring state.

Gravitational lensing of quasars

CERN Document Server

Eigenbrod, Alexander

2013-01-01

The universe, in all its richness, diversity and complexity, is populated by a myriad of intriguing celestial objects. Among the most exotic of them are gravitationally lensed quasars. A quasar is an extremely bright nucleus of a galaxy, and when such an object is gravitationally lensed, multiple images of the quasar are produced – this phenomenon of cosmic mirage can provide invaluable insights on burning questions, such as the nature of dark matter and dark energy. After presenting the basics of modern cosmology, the book describes active galactic nuclei, the theory of gravitational lensing, and presents a particular numerical technique to improve the resolution of astronomical data. The book then enters the heart of the subject with the description of important applications of gravitational lensing of quasars, such as the measurement of the famous Hubble constant, the determination of the dark matter distribution in galaxies, and the observation of the mysterious inner parts of quasars with much higher r...

CONSTRAINING THE LIFETIME AND OPENING ANGLE OF QUASARS USING FLUORESCENT Ly α EMISSION: THE CASE OF Q0420–388

International Nuclear Information System (INIS)

Borisova, Elena; Lilly, Simon J.; Cantalupo, Sebastiano; Prochaska, J. Xavier; Rakic, Olivera; Worseck, Gabor

2016-01-01

A toy model is developed to understand how the spatial distribution of fluorescent emitters in the vicinity of bright quasars could be affected by the geometry of the quasar bi-conical radiation field and by its lifetime. The model is then applied to the distribution of high-equivalent-width Ly α emitters (with rest-frame equivalent widths above 100 Å, threshold used in, e.g., Trainor and Steidel) identified in a deep narrow-band 36 × 36 arcmin 2 image centered on the luminous quasar Q0420–388. These emitters are found near the edge of the field and show some evidence of an azimuthal asymmetry on the sky of the type expected if the quasar is radiating in a bipolar cone. If these sources are being fluorescently illuminated by the quasar, the two most distant objects require a lifetime of at least 15 Myr for an opening angle of 60° or more, increasing to more than 40 Myr if the opening angle is reduced to a minimum of 30°. However, some other expected signatures of boosted fluorescence are not seen at the current survey limits, e.g., a fall off in Ly α brightness, or equivalent width, with distance. Furthermore, to have most of the Ly α emission of the two distant sources to be fluorescently boosted would require the quasar to have been significantly brighter in the past. This suggests that these particular sources may not be fluorescent, invalidating the above lifetime constraints. This would cast doubt on the use of this relatively low equivalent width threshold and thus also on the lifetime analysis in Trainor and Steidel.

CONSTRAINING THE LIFETIME AND OPENING ANGLE OF QUASARS USING FLUORESCENT Ly α EMISSION: THE CASE OF Q0420–388

Energy Technology Data Exchange (ETDEWEB)

Borisova, Elena; Lilly, Simon J.; Cantalupo, Sebastiano [Institute for Astronomy, ETH Zurich, Zurich, CH-8093 (Switzerland); Prochaska, J. Xavier [UCO/Lick Observatory, UC Santa Cruz, Santa Cruz, CA 95064 (United States); Rakic, Olivera; Worseck, Gabor, E-mail: borisova@phys.ethz.ch [Max-Planck-Institut für Astronomie, Heidelberg, D-69117 (Germany)

2016-10-20

A toy model is developed to understand how the spatial distribution of fluorescent emitters in the vicinity of bright quasars could be affected by the geometry of the quasar bi-conical radiation field and by its lifetime. The model is then applied to the distribution of high-equivalent-width Ly α emitters (with rest-frame equivalent widths above 100 Å, threshold used in, e.g., Trainor and Steidel) identified in a deep narrow-band 36 × 36 arcmin{sup 2} image centered on the luminous quasar Q0420–388. These emitters are found near the edge of the field and show some evidence of an azimuthal asymmetry on the sky of the type expected if the quasar is radiating in a bipolar cone. If these sources are being fluorescently illuminated by the quasar, the two most distant objects require a lifetime of at least 15 Myr for an opening angle of 60° or more, increasing to more than 40 Myr if the opening angle is reduced to a minimum of 30°. However, some other expected signatures of boosted fluorescence are not seen at the current survey limits, e.g., a fall off in Ly α brightness, or equivalent width, with distance. Furthermore, to have most of the Ly α emission of the two distant sources to be fluorescently boosted would require the quasar to have been significantly brighter in the past. This suggests that these particular sources may not be fluorescent, invalidating the above lifetime constraints. This would cast doubt on the use of this relatively low equivalent width threshold and thus also on the lifetime analysis in Trainor and Steidel.

WITNESSING THE KEY EARLY PHASE OF QUASAR EVOLUTION: AN OBSCURED ACTIVE GALACTIC NUCLEUS PAIR IN THE INTERACTING GALAXY IRAS 20210+1121

International Nuclear Information System (INIS)

Piconcelli, Enrico; Fiore, Fabrizio; Maiolino, Roberto; Nicastro, Fabrizio; Vignali, Cristian; Bianchi, Stefano; Mathur, Smita; Guainazzi, Matteo; Lanzuisi, Giorgio

2010-01-01

We report the discovery of an active galactic nucleus (AGN) pair in the interacting galaxy system IRAS 20210+1121 at z = 0.056. An XMM-Newton observation reveals the presence of an obscured (N H ∼ 5 x 10 23 cm -2 ), Seyfert-like (L 2-10keV = 4.7 x 10 42 erg s -1 ) nucleus in the northern galaxy, which lacks unambiguous optical AGN signatures. Our spectral analysis also provides strong evidence that the IR-luminous southern galaxy hosts a Type 2 quasar embedded in a bright starburst emission. In particular, the X-ray primary continuum from the nucleus appears totally depressed in the XMM-Newton band as expected in the case of a Compton-thick absorber, and only the emission produced by Compton scattering ('reflection') of the continuum from circumnuclear matter is seen. As such, IRAS 20210+1121 seems to provide an excellent opportunity to witness a key, early phase in the quasar evolution predicted by the theoretical models of quasar activation by galaxy collisions.

X-ray studies of quasars with the Einstein observatory. II

International Nuclear Information System (INIS)

Zamorani, G.; Henry, J.P.; Maccacaro, T.; Tananbaum, H.; Soltan, A.; Avni, Y.; Liebert, J.; Stocke, J.; Strittmatter, P.A.; Weymann, R.J.; Smith, M.G.; Condon, J.J.

1981-01-01

Using the Einstein Observatory, we have carried out X-ray observations of 107 quasars and have detected 79. From the analysis of this sample of objects we find a correlation between optical emission and X-ray emission. Our data for radio-loud quasars also show a correlation between radio emission and X-ray emission. For a given optical luminosity, the average X-ray emission of radio-loud quasars is approx.3 times higher than that of ratio-quiet quasars. In addition, our data suggest that the radio of X-ray to optical luminosity is decreasing with increasing redshift and/or optical luminosity. Taking into account the differences in X-ray luminosity between radio-loud and radio-quiet quasars, and between low-redshift and high-redshift quasars, we estimate that approx.30% of the observed X-ray background is contributed by quasars brighter than m/sub B/roughly-equal20, while much of the remainder can be contributed by still fainter quasars. Our data also imply that the optical log N--m/sub B/ relation for quasars cannot be extrapolated much beyond m/sub B/roughly-equal20 with the steep slope used to characterize optical source counts at brighter magnitudes. This situation supports the picture in which luminosity evolution, rather than pure density evolution, describes the quasar behavior as a function of redshift. We briefly discuss the observed correlation of X-ray luminosity with radio luminosity in the context of current quasar models

Suzaku View of the Swift/BAT Active Galactic Nuclei. V. Torus Structure of Two Luminous Radio-Loud Active Galactic Nuclei (3C 206 and PKS 0707-35)

Science.gov (United States)

Tazaki, Fumie; Ueda, Yoshihiro; Terashima, Yuichi; Mushotzky, Richard F.; Tombesi, Francesco

2013-01-01

We present the results from broadband X-ray spectral analysis of 3C 206 and PKS 0707-35 with Suzaku and Swift/BAT, two of the most luminous unobscured and obscured radio-loud active galactic nuclei (AGNs) with hard X-ray luminosities of 10(sup 45.5) erg per second and 10(sup 44.9) erg per second (14-195 keV), respectively. Based on the radio core luminosity, we estimate that the X-ray spectrum of 3C 206 contains a significant (60% in the 14-195 keV band) contribution from the jet, while it is negligible in PKS 0707-35.We can successfully model the spectra with the jet component (for 3C 206), the transmitted emission, and two reflection components from the torus and the accretion disk. The reflection strengths from the torus are found to be R(sub torus)(=Omega/2pi) = 0.29 +/- 0.18 and 0.41 +/- 0.18 for 3C 206 and PKS 0707-35, respectively, which are smaller than those in typical Seyfert galaxies. Utilizing the torus model by Ikeda et al., we quantify the relation between the half-opening angle of a torus (theta(sub oa)) and the equivalent width of an iron-K line. The observed equivalent width of 3C 206, less than 71 eV, constrains the column density in the equatorial plane to N(sup eq)(sub H) lesst han 10(sup 23) per square centimeter, or the half-opening angle to theta(sub oa) greater than 80 deg. if N(sup eq)(sub H) = 10(sup 24) per square centimeter is assumed. That of PKS 0707-35, 72 +/- 36 eV, is consistent with N(sup eq)(sub H) 10(sup 23) per square centimeter. Our results suggest that the tori in luminous radio-loud AGNs are only poorly developed. The trend is similar to that seen in radio-quiet AGNs, implying that the torus structure is not different between AGNs with jets and without jets.

The X-Ray Reflection Spectrum of the Radio-Loud Quasar 4C 74.26

Science.gov (United States)

Lohfink, Ann M.; Fabian, Andrew C.; Ballantyne, David R.; Boggs, S. E.; Boorman, Peter; Christensen, F. E.; Craig, W. W.; Farrah, Duncan; Garcia, Javier; Hailey, C. J.;

Quasars and galactic evolution

CERN Document Server

Woltjer, L

1978-01-01

The evolution of quasars is discussed. It is noted that substantial clustering may be present at faint magnitudes. The relationship between quasar evolution and galactic evolution is considered. (4 refs).

Recovery and cryopreservation of epididymal sperm from agouti (Dasiprocta aguti) using powdered coconut water (ACP-109c) and Tris extenders.

Science.gov (United States)

Silva, M A; Peixoto, G C X; Santos, E A A; Castelo, T S; Oliveira, M F; Silva, A R

2011-10-01

The objective was to compare the use of powdered coconut water (ACP-109c; ACP Biotecnologia, Fortaleza, CE, Brazil) and Tris extenders for recovery and cryopreservation of epididymal sperm from agouti. The caudae epididymus and proximal ductus deferens from 10 sexually mature agoutis were subjected to retrograde washing using ACP-109c (ACP Biotecnologia) or Tris. Epididymal sperm were evaluated for motility, vigor, sperm viability, membrane integrity, and morphology. Samples were centrifuged, and extended in the same diluents plus egg yolk (20%) and glycerol (6%), frozen in liquid nitrogen, and subsequently thawed at 37°C for 1 min, followed by re-evaluation of sperm characteristics. The two extenders were similarly efficient for epididymal recovery, with regard to the number and quality of sperm recovered. However, for both extenders, sperm quality decreased (P Biotecnologia) group, which was significantly better than 9.7 ± 2.6% motile sperm with 1.2 ± 0.3 vigor in Tris. In conclusion, agouti epididymal sperm were successfully recovered using either ACP-109c (ACP Biotecnologia) or Tris extenders; however, ACP-109c (ACP Biotecnologia) was a significantly better extender for processing and cryopreserving these sperm. Copyright © 2011 Elsevier Inc. All rights reserved.

CORRELATIONS OF QUASAR OPTICAL SPECTRA WITH RADIO MORPHOLOGY

International Nuclear Information System (INIS)

Kimball, Amy E.; Ivezic, Zeljko; Wiita, Paul J.; Schneider, Donald P.

2011-01-01

Using the largest homogeneous quasar sample with high-quality optical spectra and robust radio morphology classifications assembled to date, we investigate relationships between radio and optical properties with unprecedented statistical power. The sample consists of 4714 radio quasars from FIRST with S 20 ≥ 2 mJy and with spectra from the Sloan Digital Sky Survey (SDSS). Radio morphology classes include core-only (core), core-lobe (lobe), core-jet (jet), lobe-core-lobe (triple), and double-lobe. Electronic tables of the quasar samples, along with spectral composites for individual morphology classes, are made available. We examine the optical colors of these subsamples and find that radio quasars with core emission unresolved by FIRST (on ∼5'' scale) have a redder color distribution than radio-quiet quasars (S 20 ∼ I ) are correlated, which supports the hypothesis that both parameters are indicative of line-of-sight orientation. We investigate spectral line equivalent widths (EWs) as a function of R and R I , including the O [III] narrow line doublet and the C IV λ1549 and Mg II λ2799 broad lines. We find that the rest EWs of the broad lines correlate positively with R I at the 4σ-8σ level. However, we find no strong dependence of EW on R, in contrast to previously published results. A possible interpretation of these results is that EWs of quasar emission lines increase as the line-of-sight angle to the radio-jet axis decreases. These results are in stark contrast to commonly accepted orientation-based theories, which suggest that continuum emission should increase as the angle to the radio-jet axis decreases, resulting in smaller EWs of emission lines (assumed isotropic). Finally, we observe the Baldwin effect in our sample and find that it does not depend strongly on quasar radio morphology.

High-redshift SDSS Quasars with Weak Emission Lines

DEFF Research Database (Denmark)

Diamond-Stanic, Aleksandar M.; Fan, Xiaohui; Brandt, W. N.

2009-01-01

We identify a sample of 74 high-redshift quasars (z > 3) with weak emission lines from the Fifth Data Release of the Sloan Digital Sky Survey and present infrared, optical, and radio observations of a subsample of four objects at z > 4. These weak emission-line quasars (WLQs) constitute a promine...

Proper motions and distances of quasars

International Nuclear Information System (INIS)

Varshni, Y.P.

1982-01-01

The author's theory that quasars are stars raises the question of their proper motions. From the evidence presented in a previous paper, it is hypothesised that planetary nuclei and quasars are related objects and that their distributions in the galaxy are not very different. Proper motions of 30 quasars, calculated from existing measurements, are discussed. It is shown that three of these, namely PHL 1033, LB 8956 and LB 8991, have proper motions comparable to the largest proper motion known amongst the planetary nuclei. From this it is estimated that these three quasars lie within a few hundred parsecs from the sun. The evidence presented in a previous paper and the present one clearly supports the theory that quasars are stars. The possibility of using the interstellar K and H lines as distance indicators of quasars is discussed and the available evidence summarised. The desirability of determining more accurate values of the proper motions of quasars is emphasised. (Auth.)

The statistics of radio emission from quasars

International Nuclear Information System (INIS)

Peacock, J.A.; Miller, L.; Longair, M.S.; Edinburgh Univ.

1986-01-01

The radio properties of quasars have traditionally been discussed in terms of the radio-to-optical flux-density ratio R, implying a correlation between emission in these wavebands. It is here shown that, for bright quasars, this apparent correlation is largely due to an abrupt change in the radio properties of the quasar population near absolute magnitude Msub(B)=-24. It is suggested that this change in due to the existence of two classes of quasar with differing host galaxies: a proportion of quasars brighter than Msub(B)approx.=-24 lie in elliptical galaxies and thus generate powerful radio sources, while elliptical galaxies with weaker nuclear quasar components are classified as N-galaxies rather than quasars; quasars fainter than Msub(B)approx.=-24 lie in spiral galaxies and thus are high-luminosity analogues of radio-quiet Seyfert galaxies. (author)

GALEX FAR-ULTRAVIOLET COLOR SELECTION OF UV-BRIGHT HIGH-REDSHIFT QUASARS

International Nuclear Information System (INIS)

Worseck, Gabor; Prochaska, J. Xavier

2011-01-01

We study the small population of high-redshift (z em >2.7) quasars detected by the Galaxy Evolution Explorer(GALEX), whose far-UV emission is not extinguished by intervening H I Lyman limit systems. These quasars are of particular importance to detect intergalactic He II absorption along their sight lines. We correlate almost all verified z em >2.7 quasars to the GALEX GR4 source catalog covering ∼ 25,000 deg 2 , yielding 304 sources detected at signal-to-noise ratio (S/N) >3. However, ∼50% of these are only detected in the GALEX NUV band, signaling the truncation of the FUV flux by low-redshift optically thick Lyman limit systems. We exploit the GALEX UV color m FUV - m NUV to cull the most promising targets for follow-up studies, with blue (red) GALEX colors indicating transparent (opaque) sight lines. Extensive Monte Carlo simulations indicate an He II detection rate of ∼60% for quasars with m FUV - m NUV ∼ em ∼ 3 to be most promising for Hubble Space Telescope follow-up, with an additional 114 quasars if we consider S/N >2 detections in the FUV. Combining the statistical properties of H I absorbers with the Sloan Digital Sky Survey (SDSS) quasar luminosity function, we predict a large all-sky population of ∼200 quasars with z em >2.7 and i ∼ 304 em ∼ em ∼ em ∼< 3.5 quasars have likely underestimated their space density by selecting intergalactic medium sight lines with an excess of strong H I absorbers.

Optimal combination of illusory and luminance-defined 3-D surfaces: A role for ambiguity.

Science.gov (United States)

Hartle, Brittney; Wilcox, Laurie M; Murray, Richard F

2018-04-01

The shape of the illusory surface in stereoscopic Kanizsa figures is determined by the interpolation of depth from the luminance edges of adjacent inducing elements. Despite ambiguity in the position of illusory boundaries, observers reliably perceive a coherent three-dimensional (3-D) surface. However, this ambiguity may contribute additional uncertainty to the depth percept beyond what is expected from measurement noise alone. We evaluated the intrinsic ambiguity of illusory boundaries by using a cue-combination paradigm to measure the reliability of depth percepts elicited by stereoscopic illusory surfaces. We assessed the accuracy and precision of depth percepts using 3-D Kanizsa figures relative to luminance-defined surfaces. The location of the surface peak was defined by illusory boundaries, luminance-defined edges, or both. Accuracy and precision were assessed using a depth-discrimination paradigm. A maximum likelihood linear cue combination model was used to evaluate the relative contribution of illusory and luminance-defined signals to the perceived depth of the combined surface. Our analysis showed that the standard deviation of depth estimates was consistent with an optimal cue combination model, but the points of subjective equality indicated that observers consistently underweighted the contribution of illusory boundaries. This systematic underweighting may reflect a combination rule that attributes additional intrinsic ambiguity to the location of the illusory boundary. Although previous studies show that illusory and luminance-defined contours share many perceptual similarities, our model suggests that ambiguity plays a larger role in the perceptual representation of illusory contours than of luminance-defined contours.

Companions of low-redshift radio-quiet quasars

International Nuclear Information System (INIS)

Yee, H.K.C.

1987-01-01

Using imaging data from a relatively complete subset of low-redshift radio-quiet quasars, the frequency of finding associated companion galaxies of the quasars is determined statistically. With an average completeness limit of M/sub r/ of about -19, it is found that about 40 percent of the quasars have at least one close physical companion within a projected distance of 100 kpc. The percentage of quasars with detected companions is consistent with all quasars in the sample having a companion of luminosity brighter than about -16.5 mag. It is estimated that the frequency of finding close companions to quasars is about six times higher than that expected for field galaxies. This frequency is similar to that found for lower-luminosity Seyfert galaxies. The properties of the companions appear to be uncorrelated with the level of activity in the quasars. This suggests that, for radio-quiet quasars, the companions act mainly as triggers of the activity and are probably not a strong determining factor of the detailed properties of the quasars. 28 references

A main sequence for quasars

Science.gov (United States)

Marziani, Paola; Dultzin, Deborah; Sulentic, Jack W.; Del Olmo, Ascensión; Negrete, C. A.; Martínez-Aldama, Mary L.; D'Onofrio, Mauro; Bon, Edi; Bon, Natasa; Stirpe, Giovanna M.

2018-03-01

The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

A Main Sequence for Quasars

Directory of Open Access Journals (Sweden)

Paola Marziani

2018-03-01

Full Text Available The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

HIGH-REDSHIFT SDSS QUASARS WITH WEAK EMISSION LINES

International Nuclear Information System (INIS)

Diamond-Stanic, Aleksandar M.; Fan Xiaohui; Jiang Linhua; Kim, J. Serena; Schmidt, Gary D.; Smith, Paul S.; Vestergaard, Marianne; Young, Jason E.; Brandt, W. N.; Shemmer, Ohad; Gibson, Robert R.; Schneider, Donald P.; Strauss, Michael A.; Shen Yue; Anderson, Scott F.; Carilli, Christopher L.; Richards, Gordon T.

2009-01-01

We identify a sample of 74 high-redshift quasars (z > 3) with weak emission lines from the Fifth Data Release of the Sloan Digital Sky Survey and present infrared, optical, and radio observations of a subsample of four objects at z > 4. These weak emission-line quasars (WLQs) constitute a prominent tail of the Lyα + N v equivalent width distribution, and we compare them to quasars with more typical emission-line properties and to low-redshift active galactic nuclei with weak/absent emission lines, namely BL Lac objects. We find that WLQs exhibit hot (T ∼ 1000 K) thermal dust emission and have rest-frame 0.1-5 μm spectral energy distributions that are quite similar to those of normal quasars. The variability, polarization, and radio properties of WLQs are also different from those of BL Lacs, making continuum boosting by a relativistic jet an unlikely physical interpretation. The most probable scenario for WLQs involves broad-line region properties that are physically distinct from those of normal quasars.

A z = 3 Lyα BLOB ASSOCIATED WITH A DAMPED Lyα SYSTEM PROXIMATE TO ITS BACKGROUND QUASAR

International Nuclear Information System (INIS)

Hennawi, Joseph F.; Prochaska, J. Xavier; Kollmeier, Juna; Zheng Zheng

2009-01-01

We report on the discovery of a bright Lyα blob associated with the z = 3 quasar SDSS J124020.91+145535.6 which is also coincident with strong damped Lyα absorption from a foreground galaxy (a so-called proximate damped Lyα (PDLA) system). The one-dimensional spectrum acquired by the Sloan Digital Sky Survey (SDSS) shows a broad Lyα emission line with a FWHM ≅500 km s -1 and a luminosity of L Lyα = 3.9 x 10 43 erg s -1 superposed on the trough of the PDLA. Follow-up observations using the Keck/LRIS spectrometer confirm that this source has a Lyα nebula with spatial extent exceeding 5'', corresponding to a proper size >39 kpc. Mechanisms for powering the large Lyα luminosity in this nebula are discussed. We use a Monte Carlo radiative transfer simulation to investigate the possibility that the line emission is fluorescent recombination radiation from a kpc-scale PDLA galaxy powered by the ionizing flux of the quasar, but find that the predicted Lyα flux is several orders of magnitude lower than observed. We conclude that the Lyα emission is not associated with the PDLA galaxy at all, but instead is intrinsic to the quasar's host and similar to the extended Lyα f uzzwhich is detected around many active galactic nuclei. PDLAs are natural coronagraphs that block their background quasar at Lyα and we discuss how systems similar to SDSS J124020.91+145535.6 might be used to image the neutral hydrogen in the PDLA galaxy in silhouette against the screen of extended Lyα emission from the background quasar.

The Multi-component X-ray Emission of 3C 273

Science.gov (United States)

Soldi, S.; Türler, M.; Paltani, S.; Courvoisier, T. J.-L.

2009-05-01

3C 273 is the brightest quasar in the sky and among the most extensively observed and studied AGN, therefore one of the most suitable targets for a long-term, multi-frequency study. The superposition of a thermal Comptonisation component, similar to that observed in Seyfert galaxies, and of a non-thermal component, related to the jet emission, seems to explain some of the spectral and timing properties of the X-ray emission of 3C 273. Yet, during some observations this dichotomy has not been observed and the variability properties could also be consistent with a single-component scenario, characterised by two parameters varying independently. In order to understand the nature of the X-ray emission in 3C 273, a series of observations up to 80-100 keV, possibly catching the source in different flux states, are essential. Simbol-X will be able to study the emission of 3C 273 in the broad 0.5-80 keV band with high sensitivity, allowing us to disentangle the emission from different spectral components, with 20-30 ks long observations. In addition, the shape and the origin of the high-energy emission of this quasar will be further constrained thanks to the AGILE and Fermi satellites, monitoring the γ-ray sky in the MeV-GeV energy domain.

The Halo Occupation Distribution of obscured quasars: revisiting the unification model

Science.gov (United States)

Mitra, Kaustav; Chatterjee, Suchetana; DiPompeo, Michael A.; Myers, Adam D.; Zheng, Zheng

2018-06-01

We model the projected angular two-point correlation function (2PCF) of obscured and unobscured quasars selected using the Wide-field Infrared Survey Explorer (WISE), at a median redshift of z ˜ 1 using a five parameter Halo Occupation Distribution (HOD) parametrization, derived from a cosmological hydrodynamic simulation by Chatterjee et al. The HOD parametrization was previously used to model the 2PCF of optically selected quasars and X-ray bright active galactic nuclei (AGNs) at z ˜ 1. The current work shows that a single HOD parametrization can be used to model the population of different kinds of AGN in dark matter haloes suggesting the universality of the relationship between AGN and their host dark matter haloes. Our results show that the median halo mass of central quasar hosts increases from optically selected (4.1^{+0.3}_{-0.4} × 10^{12} h^{-1} M_{⊙}) and infra-red (IR) bright unobscured populations (6.3^{+6.2}_{-2.3} × 10^{12} h^{-1} M_{⊙}) to obscured quasars (10.0^{+2.6}_{-3.7} × 10^{12} h^{-1} M_{⊙}), signifying an increase in the degree of clustering. The projected satellite fractions also increase from optically bright to obscured quasars and tend to disfavour a simple `orientation only' theory of active galactic nuclei unification. Our results also show that future measurements of the small-scale clustering of obscured quasars can constrain current theories of galaxy evolution where quasars evolve from an IR-bright obscured phase to the optically bright unobscured phase.

The statistics of quasar-galaxy separations

International Nuclear Information System (INIS)

Phillips, S.

1983-01-01

One of the arguments put forward in favor of physical associations between low redshift galaxies and high redshift quasars is shown to be void. The argument is based on the form of the relationship for 'close' pairs of quasars and galaxies and on the size of their separations. Simple statistical reasoning based on selection effects shows that the relationship for quasar-galaxy pairs is expected if the objects are not physically associated. Further, the actual separations of the closest pairs are in close agreement with those expected given the observed numbers of nearby galaxies and the total number of known quasars. This argument avoids the controversial number density of quasars

Superconducting cosmic string evolution of quasars

International Nuclear Information System (INIS)

Liu Yulin.

1988-09-01

The quasars may have been undergoing two evolutionary processes after they formed. As a result of the string loops shrinking at the first stage, the luminosities of the quasars increased gradually up to their maximum value at the redshift z ∼ 2, after then the second evolutionary stage began and the luminosity reduced. This result can be fitted by luminosity counting of quasars. Observable limit of quasars can be obtained naturally. Many phenomena, such as radiomorphology, density distribution between fuzz structure and broad line region and rotational curve may also originate from the first evolutionary stage of quasars as cosmic string. (author). 10 refs

The nature of luminous Ly α emitters at z ˜ 2-3: maximal dust-poor starbursts and highly ionizing AGN

Science.gov (United States)

Sobral, David; Matthee, Jorryt; Darvish, Behnam; Smail, Ian; Best, Philip N.; Alegre, Lara; Röttgering, Huub; Mobasher, Bahram; Paulino-Afonso, Ana; Stroe, Andra; Oteo, Iván

2018-06-01

Deep narrow-band surveys have revealed a large population of faint Ly α emitters (LAEs) in the distant Universe, but relatively little is known about the most luminous sources ({L}_{Lyα } ≳ 10^{42.7} erg s-1; L_{Lyα }≳ L^*_{Lyα }). Here we present the spectroscopic follow-up of 21 luminous LAEs at z ˜ 2-3 found with panoramic narrow-band surveys over five independent extragalactic fields (≈4 × 106 Mpc3 surveyed at z ˜ 2.2 and z ˜ 3.1). We use WHT/ISIS, Keck/DEIMOS, and VLT/X-SHOOTER to study these sources using high ionization UV lines. Luminous LAEs at z ˜ 2-3 have blue UV slopes (β =-2.0^{+0.3}_{-0.1}) and high Ly α escape fractions (50^{+20}_{-15} per cent) and span five orders of magnitude in UV luminosity (MUV ≈ -19 to -24). Many (70 per cent) show at least one high ionization rest-frame UV line such as C IV, N V, C III], He II or O III], typically blue-shifted by ≈100-200 km s-1 relative to Ly α. Their Ly α profiles reveal a wide variety of shapes, including significant blue-shifted components and widths from 200 to 4000 km s-1. Overall, 60 ± 11 per cent appear to be active galactic nucleus (AGN) dominated, and at LLyα > 1043.3 erg s-1 and/or MUV sharp transition in the nature of LAEs, from star formation dominated to AGN dominated.

The Hunt for Red Quasars: Luminous Obscured Black Hole Growth Unveiled in the Stripe 82 X-Ray Survey

Science.gov (United States)

LaMassa, Stephanie M.; Glikman, Eilat; Brusa, Marcella; Rigby, Jane R.; Tasnim Ananna, Tonima; Stern, Daniel; Lira, Paulina; Urry, C. Megan; Salvato, Mara; Alexandroff, Rachael; Allevato, Viola; Cardamone, Carolin; Civano, Francesca; Coppi, Paolo; Farrah, Duncan; Komossa, S.; Lanzuisi, Giorgio; Marchesi, Stefano; Richards, Gordon; Trakhtenbrot, Benny; Treister, Ezequiel

2017-10-01

We present results of a ground-based near-infrared campaign with Palomar TripleSpec, Keck NIRSPEC, and Gemini GNIRS to target two samples of reddened active galactic nucleus (AGN) candidates from the 31 deg2 Stripe 82 X-ray survey. One sample, which is ˜89% complete to Kprogram, and is selected to have red R - K colors (> 4, Vega). The fainter sample (K> 17, Vega) represents a pilot program to follow-up four sources from a parent sample of 34 that are not detected in the single-epoch SDSS catalog and have WISE quasar colors. All 12 sources are broad-line AGNs (at least one permitted emission line has an FWHM exceeding 1300 km s-1) and span a redshift range 0.59 0.5), and a greater percentage have high X-ray luminosities ({L}{{X},{full}}> {10}44 erg s-1). Such outflows and high luminosities may be consistent with the paradigm that reddened broad-line AGNs represent a transitory phase in AGN evolution as described by the major merger model for black hole growth. Results from our pilot program demonstrate proof of concept that our selection technique is successful in discovering reddened quasars at z> 1 missed by optical surveys.

Gaia Space Mission and Quasars

Energy Technology Data Exchange (ETDEWEB)

Zwitter, Tomaž, E-mail: tomaz.zwitter@fmf.uni-lj.si [Faculty of Mathematics and Physics, University of Ljubljana, Ljubljana (Slovenia)

2017-11-15

Quasars are often considered to be point-like objects. This is largely true and allows for an excellent alignment of the optical positional reference frame of the ongoing ESA mission Gaia with the International Celestial Reference Frame. But presence of optical jets in quasars can cause shifts of the optical photo-centers at levels detectable by Gaia. Similarly, motion of emitting blobs in the jet can be detected as proper motion shifts. Gaia's measurements of spectral energy distribution for around a million distant quasars is useful to determine their redshifts and to assess their variability on timescales from hours to years. Spatial resolution of Gaia allows to build a complete magnitude limited sample of strongly lensed quasars. The mission had its first public data release in September 2016 and is scheduled to have the next and much more comprehensive one in April 2018. Here we briefly review the capabilities and current results of the mission. Gaia's unique contributions to the studies of quasars are already being published, a highlight being a discovery of a number of quasars with optical jets.

Relativistic beaming and quasar statistics

International Nuclear Information System (INIS)

Orr, M.J.L.; Browne, I.W.A.

1982-01-01

The statistical predictions of a unified scheme for the radio emission from quasars are explored. This scheme attributes the observed differences between flat- and steep-spectrum quasars to projection and the effects of relativistic beaming of the emission from the nuclear components. We use a simple quasar model consisting of a compact relativistically beamed core with spectral index zero and unbeamed lobes, spectral index - 1, to predict the proportion of flat-spectrum sources in flux-limited samples selected at different frequencies. In our model this fraction depends on the core Lorentz factor, γ and we find that a value of approximately 5 gives satisfactory agreement with observation. In a similar way the model is used to construct the expected number/flux density counts for flat-spectrum quasars from the observed steep-spectrum counts. Again, good agreement with the observations is obtained if the average core Lorentz factor is about 5. Independent estimates of γ from observations of superluminal motion in quasars are of the same order of magnitude. We conclude that the statistical properties of quasars are entirely consistent with the predictions of simple relativistic-beam models. (author)

QUASAR PG1115+080 AND GRAVITATIONAL LENS

Science.gov (United States)

2002-01-01

Left: The light from the single quasar PG 1115+080 is split and distorted in this infrared image. PG 1115+080 is at a distance of about 8 billion light years in the constellation Leo, and it is viewed through an elliptical galaxy lens at a distance of 3 billion light years. The NICMOS frame is taken at a wavelength of 1.6 microns and it shows the four images of the quasar (the two on the left are nearly merging) surrounding the galaxy that causes the light to be lensed. The quasar is a variable light source and the light in each image travels a different path to reach the Earth. The time delay of the variations allows the distance scale to be measured directly. The linear streaks on the image are diffraction artifacts in the NICMOS instrument (NASA/Space Telescope Science Institute). Right: In this NICMOS image, the four quasar images and the lens galaxy have been subtracted, revealing a nearly complete ring of infrared light. This ring is the stretched and amplified starlight of the galaxy that contains the quasar, some 8 billion light years away. (NASA/Space Telescope Science Institute). Credit: Christopher D. Impey (University of Arizona)

Probing Extragalactic Planets Using Quasar Microlensing

Science.gov (United States)

Dai, Xinyu; Guerras, Eduardo

2018-02-01

Previously, planets have been detected only in the Milky Way galaxy. Here, we show that quasar microlensing provides a means to probe extragalactic planets in the lens galaxy, by studying the microlensing properties of emission close to the event horizon of the supermassive black hole of the background quasar, using the current generation telescopes. We show that a population of unbound planets between stars with masses ranging from Moon to Jupiter masses is needed to explain the frequent Fe Kα line energy shifts observed in the gravitationally lensed quasar RXJ 1131–1231 at a lens redshift of z = 0.295 or 3.8 billion lt-yr away. We constrain the planet mass-fraction to be larger than 0.0001 of the halo mass, which is equivalent to 2000 objects ranging from Moon to Jupiter mass per main-sequence star.

EVOLUTION OF THE MOST LUMINOUS DUSTY GALAXIES

International Nuclear Information System (INIS)

Weedman, Daniel W.; Houck, James R.

2009-01-01

A summary of mid-infrared continuum luminosities arising from dust is given for very luminous galaxies, L IR > 10 12 L sun , with 0.005 0.7 in the 9.7 μm silicate absorption feature (i.e., half of the continuum is absorbed) and having equivalent width of the 6.2 μm polycyclic aromatic hydrocarbon feature ν (8 μm) for the most luminous obscured AGNs is found to scale as (1+z) 2.6 to z = 2.8. For unobscured AGNs, the scaling with redshift is similar, but luminosities νL ν (8 μm) are approximately three times greater for the most luminous sources. Using both obscured and unobscured AGNs having total infrared fluxes from the Infrared Astronomical Satellite, empirical relations are found between νL ν (8 μm) and L IR . Combining these relations with the redshift scaling of luminosity, we conclude that the total infrared luminosities for the most luminous obscured AGNs, L IR (AGN obscured ) in L sun , scale as log L IR (AGN obscured ) = 12.3 ± 0.25 + 2.6(±0.3)log(1+z), and for the most luminous unobscured AGNs, scale as log L IR (AGN1) = 12.6(±0.15) + 2.6(±0.3)log(1+z). We previously determined that the most luminous starbursts scale as log L IR (SB) = 11.8 ± 0.3 + 2.5(±0.3)log(1+z), indicating that the most luminous AGNs are about 10 times more luminous than the most luminous starbursts. Results are consistent with obscured and unobscured AGNs having the same total luminosities with differences arising only from orientation, such that the obscured AGNs are observed through very dusty clouds which extinct about 50% of the intrinsic luminosity at 8 μm. Extrapolations of observable f ν (24 μm) to z = 6 are made using evolution results for these luminous sources. Both obscured and unobscured AGNs should be detected to z ∼ 6 by Spitzer surveys with f ν (24 μm) > 0.3 mJy, even without luminosity evolution for z > 2.5. By contrast, the most luminous starbursts cannot be detected for z > 3, even if luminosity evolution continues beyond z = 2.5.

Quasars: Cosmological evolution and x-ray background contribution

International Nuclear Information System (INIS)

Schmidt, M.; Green, R.F.

1986-01-01

The luminosity function of quasars varies with redshift or cosmic epoch. The authors discuss how the luminosity function and its evolution can be determined from complete samples of quasars. They first concentrate on optical survey of quasars. For quasars of medium luminosity, the co-moving space density rises very steeply with redshift. Quasars of lower luminosity exhibit a slower increase of density with redshift, resulting in luminosity-dependent evolution of the space density. They also discuss evidence for a cutoff of quasar redshift and for a possible dependence of the cutoff on luminosity. They evaluate X-ray counts of quasars and show the need for negative X-ray luminosity evolution in order to explain the counts and the low average redshifts of X-ray quasars. As a consequence, the quasar contribution to the X-ray background is lower than originally suspected. They discuss other extragalactic contributors to the X-ray background and conclude that they, together with the quasars, contribute about 60 percent of the observed background. About half of this is contributed by active galactic nuclei with optical luminosities below those of quasars

Two more, bright, z > 6 quasars from VST ATLAS and WISE

Science.gov (United States)

Chehade, B.; Carnall, A. C.; Shanks, T.; Diener, C.; Fumagalli, M.; Findlay, J. R.; Metcalfe, N.; Hennawi, J.; Leibler, C.; Murphy, D. N. A.; Prochaska, J. X.; Irwin, M. J.; Gonzalez-Solares, E.

2018-03-01

Recently, Carnall et al. discovered two bright high redshift quasars using the combination of the VST ATLAS and WISE surveys. The technique involved using the 3-D colour plane i - z: z - W1: W1 - W2 with the WISE W1(3.4 micron) and W2 (4.5 micron) bands taking the place of the usual NIR J band to help decrease stellar dwarf contamination. Here we report on our continued search for 5.7 6 quasars, VST-ATLAS J158.6938-14.4211 at z = 6.07 and J332.8017-32.1036 at z = 6.32 with magnitudes of zAB = 19.4 and 19.7 mag respectively. J158.6938-14.4211 was confirmed by Keck LRIS observations and J332.8017-32.1036 was confirmed by ESO NTT EFOSC-2 observations. Here we present VLT X-shooter Visible and NIR spectra for the four ATLAS quasars. We have further independently rediscovered two z > 5.7 quasars previously found by the VIKING/KiDS and PanSTARRS surveys. This means that in ATLAS we have now discovered a total of six quasars in our target 5.7 ATLAS quasars.

Interferometric follow-up of WISE hyper-luminous hot, dust-obscured galaxies

Energy Technology Data Exchange (ETDEWEB)

Wu, Jingwen; Wright, Edward L. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Bussmann, R. Shane [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., MS78, Cambridge, MA 02138 (United States); Tsai, Chao-Wei; Eisenhardt, Peter R. M.; Stern, Daniel; Moustakas, Leonidas [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Dr., Pasadena, CA 91109 (United States); Petric, Andreea [Institute for Astronomy, 2680 Woodlawn Drive, Honolulu, HI 96822-1839 (United States); Blain, Andrew [Department of Physics and Astronomy, University of Leicester, Leicester, LE1 7RH (United Kingdom); Bridge, Carrie R. [Division of Physics, Math, and Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Benford, Dominic J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Assef, Roberto J. [Núcleo de Astronomía de la Facultad de Ingeniería, Universidad Diego Portales, Av., Santiago, Ejército Libertador 441 (Chile); Gelino, Christopher R., E-mail: jingwen@astro.ucla.edu [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States)

2014-09-20

The Wide-field Infrared Survey Explorer (WISE) has discovered an extraordinary population of hyper-luminous dusty galaxies that are faint in the two bluer passbands (3.4 μm and 4.6 μm) but are bright in the two redder passbands of WISE (12 μm and 22 μm). We report on initial follow-up observations of three of these hot, dust-obscured galaxies, or Hot DOGs, using the Combined Array for Research in Millimeter-wave Astronomy and the Submillimeter Array interferometer arrays at submillimeter/millimeter wavelengths. We report continuum detections at ∼1.3 mm of two sources (WISE J014946.17+235014.5 and WISE J223810.20+265319.7, hereafter W0149+2350 and W2238+2653, respectively), and upper limits to CO line emission at 3 mm in the observed frame for two sources (W0149+2350 and WISE J181417.29+341224.8, hereafter W1814+3412). The 1.3 mm continuum images have a resolution of 1''-2'' and are consistent with single point sources. We estimate the masses of cold dust are 2.0 × 10{sup 8} M {sub ☉} for W0149+2350 and 3.9 × 10{sup 8} M {sub ☉} for W2238+2653, comparable to cold dust masses of luminous quasars. We obtain 2σ upper limits to the molecular gas masses traced by CO, which are 3.3 × 10{sup 10} M {sub ☉} and 2.3 × 10{sup 10} M {sub ☉} for W0149+2350 and W1814+3412, respectively. We also present high-resolution, near-IR imaging with the WFC3 on the Hubble Space Telescope for W0149+2653 and with NIRC2 on Keck for W2238+2653. The near-IR images show morphological structure dominated by a single, centrally condensed source with effective radius less than 4 kpc. No signs of gravitational lensing are evident.

Quasars as Cosmological Standard Candles

International Nuclear Information System (INIS)

Negrete, C. Alenka; Dultzin, Deborah; Marziani, Paola; Sulentic, Jack W.; Esparza-Arredondo, Donají; Martínez-Aldama, Mary L.; Del Olmo, Ascensión

2017-01-01

We propose the use of quasars with accretion rate near the Eddington ratio (extreme quasars) as standard candles. The selection criteria are based on the Eigenvector 1 (E1) formalism. Our first sample is a selection of 334 optical quasar spectra from the SDSS DR7 database with a S/N > 20. Using the E1, we define primary and secondary selection criteria in the optical spectral range. We show that it is possible to derive a redshift-independent estimate of luminosity for extreme Eddington ratio sources. Our results are consistent with concordance cosmology but we need to work with other spectral ranges to take into account the quasar orientation, among other constrains.

Quasars as Cosmological Standard Candles

Energy Technology Data Exchange (ETDEWEB)

Negrete, C. Alenka [CONACYT Research Fellow - Instituto de Astronomía, UNAM, Mexico City (Mexico); Dultzin, Deborah [Instituto de Astronomía, UNAM, Mexico City (Mexico); Marziani, Paola [INAF, Osservatorio Astronomico di Padova, Padua (Italy); Sulentic, Jack W. [Instituto de Astrofísica de Andalucía, IAA-CSIC, Granada (Spain); Esparza-Arredondo, Donají [Instituto de Radioastronomía y Astrofísica, Morelia (Mexico); Martínez-Aldama, Mary L.; Del Olmo, Ascensión, E-mail: alenka@astro.unam.mx [Instituto de Astrofísica de Andalucía, IAA-CSIC, Granada (Spain)

2017-12-15

We propose the use of quasars with accretion rate near the Eddington ratio (extreme quasars) as standard candles. The selection criteria are based on the Eigenvector 1 (E1) formalism. Our first sample is a selection of 334 optical quasar spectra from the SDSS DR7 database with a S/N > 20. Using the E1, we define primary and secondary selection criteria in the optical spectral range. We show that it is possible to derive a redshift-independent estimate of luminosity for extreme Eddington ratio sources. Our results are consistent with concordance cosmology but we need to work with other spectral ranges to take into account the quasar orientation, among other constrains.

The Redshifted Hydrogen Balmer and Metastable He 1 Absorption Line System in Mini-FeLoBAL Quasar SDSS J112526.12+002901.3: A Parsec-scale Accretion Inflow?

Science.gov (United States)

Shi, Xi-Heng; Jiang, Peng; Wang, Hui-Yuan; Zhang, Shao-Hua; Ji, Tuo; Liu, Wen-Juan; Zhou, Hong-Yan

2016-10-01

The accretion of the interstellar medium onto central super-massive black holes is widely accepted as the source of the gigantic energy released by the active galactic nuclei. However, few pieces of observational evidence have been confirmed directly demonstrating the existence of the inflows. The absorption line system in the spectra of quasar SDSS J112526.12+002901.3 presents an interesting example in which the rarely detected hydrogen Balmer and metastable He I absorption lines are found redshifted to the quasar's rest frame along with the low-ionization metal absorption lines Mg II, Fe II, etc. The repeated SDSS spectroscopic observations suggest a transverse velocity smaller than the radial velocity. The motion of the absorbing medium is thus dominated by infall. The He I* lines present a powerful probe to the strength of ionizing flux, while the Balmer lines imply a dense environment. With the help of photoionization simulations, we find that the absorbing medium is exposed to the radiation with ionization parameter U ≈ 10-1.8, and the density is n({{H}})≈ {10}9 {{cm}}-3. Thus the absorbing medium is located ˜4 pc away from the central engine. According to the similarity in the distance and physical conditions between the absorbing medium and the torus, we strongly propose the absorption line system as a candidate for the accretion inflow, which originates in the inner surface of the torus.

A CHARACTERISTIC DIVISION BETWEEN THE FUELING OF QUASARS AND SEYFERTS: FIVE SIMPLE TESTS

International Nuclear Information System (INIS)

Hopkins, Philip F.; Hernquist, Lars

2009-01-01

Given the existence of the M BH -σ relation, models of self-regulated black hole (BH) growth require both a fuel supply and concomitant growth of the host bulge to deepen the central potential, or else the system will either starve or immediately self-regulate without any sustained activity. This leads to a generic prediction that the brightest quasars must be triggered in major mergers: a large fraction of the galaxy mass must be added/converted to new bulge mass and a galactic supply of gas must lose angular momentum in less than a dynamical time. Low-luminosity active galactic nuclei, in contrast, require little bulge growth and small gas supplies, and could be triggered in more common nonmerger events. This leads to the expectation of a characteristic transition to merger-induced fueling around the traditional quasar-Seyfert luminosity division (growth of BH masses above/below ∼10 7 M sun ). We compile and survey a number of observations in order to test several predictions of such a division, including (1) a transition to bulge-dominated hosts (which any major merger remnant, regardless of difficult-to-observe tidal features, should be). (2) A transition between 'pseudobulges' and 'classical' bulges hosting the remnant BHs: pseudobulges are formed in secular processes and minor mergers, whereas classical bulges are relics of major mergers. (3) An increase in the amplitude of small-scale clustering (increased halo occupation of small group environments) where mergers are more efficient. (4) Different redshift evolution, with gas-rich merger rates rising to redshifts z > 2 while secular processes are relatively constant in time. (5) An increasing prominence of post-starburst features in more luminous systems. Our compilation of observations in each of these areas provides tentative evidence for the predicted division around the Seyfert-quasar threshold, and we discuss how future observations can improve these constraints and, in combination with the tests

The quasar luminosity function at redshift 4 with the Hyper Suprime-Cam Wide Survey

Science.gov (United States)

Akiyama, Masayuki; He, Wanqiu; Ikeda, Hiroyuki; Niida, Mana; Nagao, Tohru; Bosch, James; Coupon, Jean; Enoki, Motohiro; Imanishi, Masatoshi; Kashikawa, Nobunari; Kawaguchi, Toshihiro; Komiyama, Yutaka; Lee, Chien-Hsiu; Matsuoka, Yoshiki; Miyazaki, Satoshi; Nishizawa, Atsushi J.; Oguri, Masamune; Ono, Yoshiaki; Onoue, Masafusa; Ouchi, Masami; Schulze, Andreas; Silverman, John D.; Tanaka, Manobu M.; Tanaka, Masayuki; Terashima, Yuichi; Toba, Yoshiki; Ueda, Yoshihiro

2018-01-01

We present the luminosity function of z ˜ 4 quasars based on the Hyper Suprime-Cam Subaru Strategic Program Wide layer imaging data in the g, r, i, z, and y bands covering 339.8 deg2. From stellar objects, 1666 z ˜ 4 quasar candidates are selected via the g-dropout selection down to i = 24.0 mag. Their photometric redshifts cover the redshift range between 3.6 and 4.3, with an average of 3.9. In combination with the quasar sample from the Sloan Digital Sky Survey in the same redshift range, a quasar luminosity function covering the wide luminosity range of M1450 = -22 to -29 mag is constructed. The quasar luminosity function is well described by a double power-law model with a knee at M1450 = -25.36 ± 0.13 mag and a flat faint-end slope with a power-law index of -1.30 ± 0.05. The knee and faint-end slope show no clear evidence of redshift evolution from those seen at z ˜ 2. The flat slope implies that the UV luminosity density of the quasar population is dominated by the quasars around the knee, and does not support the steeper faint-end slope at higher redshifts reported at z > 5. If we convert the M1450 luminosity function to the hard X-ray 2-10 keV luminosity function using the relation between the UV and X-ray luminosity of quasars and its scatter, the number density of UV-selected quasars matches well with that of the X-ray-selected active galactic nuclei (AGNs) above the knee of the luminosity function. Below the knee, the UV-selected quasars show a deficiency compared to the hard X-ray luminosity function. The deficiency can be explained by the lack of obscured AGNs among the UV-selected quasars.

Ultraviolet spectropolarimetry of high-redshift quasars with the Hubble Space Telescope

Science.gov (United States)

Impey, C. D.; Malkan, Matthew A.; Webb, Wayne; Petry, C. E.

1995-01-01

Ultraviolet spectropolarimetry of three bright high-redshift low-polarization quasars (LPQs) was obtained with the Faint Object Spectrograph of the Hubble Space Telescope (HST). Two of the quasars, PG 1634+706 and PG 2302+029, had polarizations p approximately = 0.5%-1.0% throughout the ultraviolet, and showed no significant variation of polarization amplitude or position angle with wavelength. PG 2302+029 was also marginally (2.4 sigma) circularly polarized in the optical continuum. For the highest redshift quasar, PG 1222+228 (Ton 1530), the polarization was measured down to rest wavelengths below 800 A. Although the continuum of PG 1222+228 was weakened by Lyman limit absorption from an intergalactic gas cloud, the polarization increased sharply from 1% to about 4.5%, a change of 4 sigma significance. This abrupt rise in polarization does not appear attributable to any known instrumental artifact. These UV polarizations were only slightly less than those previously observed for these same objects in the optical. The polarization spectra were flat with a typical slope of the polarized flux pF(sub nu) proportional to nu(exp -0.8 +/- 0.5). Unlike the case of several high luminosity Seyfert 1 nuclei studied previously, polarization caused by scattering from dust grains does not provide the best fit to the polarization spectra of these luminous quasars. These observed spectra are consistent with a wavelength-independent polarization proportional to the total nonstellar light or, possibly, to the contribution of the blue thermal component. The polarization spectra have insufficient signal-to-noise to locate the scatterers with respect to the continuum source and the much larger broad line region. A decrease in amplitude and rotation of the position angle of the polarization vector at the shortest wavelengths, which could result from general relativistic effects near a spinning black hole, was not observed. In fact, in PG 1222+228, the polarization was observed to

Characterization of cytochrome P450 CYP109E1 from Bacillus megaterium as a novel vitamin D3 hydroxylase.

Science.gov (United States)

Abdulmughni, Ammar; Jóźwik, Ilona K; Putkaradze, Natalia; Brill, Elisa; Zapp, Josef; Thunnissen, Andy-Mark W H; Hannemann, Frank; Bernhardt, Rita

2017-02-10

In this study the ability of CYP109E1 from Bacillus megaterium to metabolize vitamin D 3 (VD 3 ) was investigated. In an in vitro system using bovine adrenodoxin reductase (AdR) and adrenodoxin (Adx 4-108 ), VD 3 was converted by CYP109E1 into several products. Furthermore, a whole-cell system in B. megaterium MS941 was established. The new system showed a conversion of 95% after 24h. By NMR analysis it was found that CYP109E1 catalyzes hydroxylation of VD 3 at carbons C-24 and C-25, resulting in the formation of 24(S)-hydroxyvitamin D 3 (24S(OH)VD 3 ), 25-hydroxyvitamin D 3 (25(OH)VD 3 ) and 24S,25-dihydroxyvitamin D 3 (24S,25(OH) 2 VD 3 ). Through time dependent whole-cell conversion of VD 3 , we identified that the formation of 24S,25(OH) 2 VD 3 by CYP109E1 is derived from VD 3 via the intermediate 24S(OH)VD 3 . Moreover, using docking analysis and site-directed mutagenesis, we identified important active site residues capable of determining substrate specificity and regio-selectivity. HPLC analysis of the whole-cell conversion with the I85A-mutant revealed an increased selectivity towards 25-hydroxylation of VD 3 compared with the wild type activity, resulting in an approximately 2-fold increase of 25(OH)VD 3 production (45mgl -1 day -1 ) compared to wild type (24.5mgl -1 day -1 ). Copyright © 2017 Elsevier B.V. All rights reserved.

Luminosity function of high redshift quasars

International Nuclear Information System (INIS)

Vaucher, B.G.

1982-01-01

Data from ten different emission-line surveys are included in a study of the luminosity function of high redshift quasars. Five of the surveys are analyzed through microdensitometric techniques and the data for new quasars are given. The uncertainties in magnitudes, redshifts, and line equivalent widths are assessed and found to be +-0.3 mag. +-0.04 in z and approx. 30%, respectively. Criteria for selecting the redshift range 1.8 less than or equal to z - 1 Mpc - 1 for each of two cosmologies (q 0 = 1 and q 0 = 0). For either cosmology, the function exhibits a steep increase with magnitude at high luminosities and a gentler increase at intermediate luminosities. Data from the new surveys indicate a possible turnover at the faint end of the distribution. Total volume densities of quasars are computed for each of three extrapolations of the trend of the data to low luminosities. These densities are compared to those of active galaxies and field galaxies

THE EXTENDED HIGH A ( V ) QUASAR SURVEY: SEARCHING FOR DUSTY ABSORBERS TOWARD MID-INFRARED-SELECTED QUASARS

Energy Technology Data Exchange (ETDEWEB)

Krogager, J.-K.; Noterdaeme, P. [Institut d’Astrophysique de Paris, CNRS-UPMC, UMR7095, 98bis bd Arago, F-75014 Paris (France); Fynbo, J. P. U.; Heintz, K. E.; Vestergaard, M. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø (Denmark); Geier, S. [Instituto de Astrofísica de Canarias (IAC), E-38205 La Laguna, Tenerife (Spain); Ledoux, C. [European Southern Observatory, Alonso de Córdova 3107, Vitacura, Casilla 19001, Santiago 19 (Chile); Møller, P. [European Southern Observatory, Karl-Schwarzschildstrasse 2, D-85748 Garching bei München (Germany); Venemans, B. P. [Max-Planck Institute for Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany)

2016-11-20

We present the results of a new spectroscopic survey for dusty intervening absorption systems, particularly damped Ly α absorbers (DLAs), toward reddened quasars. The candidate quasars are selected from mid-infrared photometry from the Wide-field Infrared Survey Explorer combined with optical and near-infrared photometry. Out of 1073 candidates, we secure low-resolution spectra for 108 using the Nordic Optical Telescope on La Palma, Spain. Based on the spectra, we are able to classify 100 of the 108 targets as quasars. A large fraction (50%) is observed to have broad absorption lines (BALs). Moreover, we find six quasars with strange breaks in their spectra, which are not consistent with regular dust reddening. Using template fitting, we infer the amount of reddening along each line of sight ranging from A ( V ) ≈ 0.1 to 1.2 mag (assuming a Small Magellanic Cloud extinction curve). In four cases, the reddening is consistent with dust exhibiting the 2175 Å feature caused by an intervening absorber, and for two of these, an Mg ii absorption system is observed at the best-fit absorption redshift. In the rest of the cases, the reddening is most likely intrinsic to the quasar. We observe no evidence for dusty DLAs in this survey. However, the large fraction of BAL quasars hampers the detection of absorption systems. Out of the 50 non-BAL quasars, only 28 have sufficiently high redshift to detect Ly α in absorption.

Phylogenetic Analyses of Quasars and Galaxies

Energy Technology Data Exchange (ETDEWEB)

Fraix-Burnet, Didier [University Grenoble Alpes, CNRS, IPAG, Grenoble (France); D' Onofrio, Mauro [Osservatorio Astronomico di Padova (INAF), Padua (Italy); Marziani, Paola, E-mail: didier.fraix-burnet@univ-grenoble-alpes.fr [Dipartimento di Fisica e Astronomia, Università di Padova, Padua (Italy)

2017-10-10

Phylogenetic approaches have proven to be useful in astrophysics. We have recently published a Maximum Parsimony (or cladistics) analysis on two samples of 215 and 85 low-z quasars (z < 0.7) which offer a satisfactory coverage of the Eigenvector 1-derived main sequence. Cladistics is not only able to group sources radiating at higher Eddington ratios, to separate radio-quiet (RQ) and radio-loud (RL) quasars and properly distinguishes core-dominated and lobe-dominated quasars, but it suggests a black hole mass threshold for powerful radio emission as already proposed elsewhere. An interesting interpretation from this work is that the phylogeny of quasars may be represented by the ontogeny of their central black hole, i.e. the increase of the black hole mass. However these exciting results are based on a small sample of low-z quasars, so that the work must be extended. We are here faced with two difficulties. The first one is the current lack of a larger sample with similar observables. The second one is the prohibitive computation time to perform a cladistic analysis on more that about one thousand objects. We show in this paper an experimental strategy on about 1,500 galaxies to get around this difficulty. Even if it not related to the quasar study, it is interesting by itself and opens new pathways to generalize the quasar findings.

Phylogenetic Analyses of Quasars and Galaxies

International Nuclear Information System (INIS)

Fraix-Burnet, Didier; D'Onofrio, Mauro; Marziani, Paola

2017-01-01

Phylogenetic approaches have proven to be useful in astrophysics. We have recently published a Maximum Parsimony (or cladistics) analysis on two samples of 215 and 85 low-z quasars (z < 0.7) which offer a satisfactory coverage of the Eigenvector 1-derived main sequence. Cladistics is not only able to group sources radiating at higher Eddington ratios, to separate radio-quiet (RQ) and radio-loud (RL) quasars and properly distinguishes core-dominated and lobe-dominated quasars, but it suggests a black hole mass threshold for powerful radio emission as already proposed elsewhere. An interesting interpretation from this work is that the phylogeny of quasars may be represented by the ontogeny of their central black hole, i.e. the increase of the black hole mass. However these exciting results are based on a small sample of low-z quasars, so that the work must be extended. We are here faced with two difficulties. The first one is the current lack of a larger sample with similar observables. The second one is the prohibitive computation time to perform a cladistic analysis on more that about one thousand objects. We show in this paper an experimental strategy on about 1,500 galaxies to get around this difficulty. Even if it not related to the quasar study, it is interesting by itself and opens new pathways to generalize the quasar findings.

Eight new quasars discovered by the Guoshoujing Telescope (LAMOST) in one extragalactic field

International Nuclear Information System (INIS)

Wu Xuebing; Jia Zhendong; Chen Zhaoyu; Zuo Wenwen; Zhao Yongheng; Luo Ali; Bai Zhongrui; Chen Jianjun; Zhang Haotong; Yan Hongliang; Ren Juanjuan; Sun Shiwei; Wu Hong; Zhang Yong; Li Yeping; Lu Qishuai; Wang You; Ni Jijun; Wang Hai; Kong Xu

2010-01-01

We report the discovery of eight new quasars in one extragalactic field (a five-degree field centered at RA = 08 h 58 m 08.2 s , Dec = 01 o 32'29.7') with the Guoshoujing Telescope (LAMOST) commissioning observations made on 2009 December 18. These quasars, with i magnitudes from 16.44 to 19.34 and redshifts from 0.898 to 2.773, were not identified in the SDSS spectroscopic survey, though six of them with redshifts less than 2.5 were selected as quasar targets in SDSS. Except for one source without near-IR Y-band data, seven of these eight new quasars satisfy a newly proposed quasar selection criterion involving both near-IR and optical colors. Two of them were found in the 'redshift desert' for quasars (z from 2.2 to 3), indicating that the new criterion is efficient for uncovering missing quasars with similar optical colors to stars. Although LAMOST encountered some problems during the commissioning observations, we were still able to identify 38 other known SDSS quasars in this field, with i magnitudes from 16.24 to 19.10 and redshifts from 0.297 to 4.512. Our identifications imply that a substantial fraction of quasars may be missing in previous quasar surveys. The implication of our results to the future LAMOST quasar survey is discussed. (research papers)

Evidence for the Thermal Sunyaev Zeldovich Effect Associated with Quasar Feedback

Science.gov (United States)

Crichton, Devin; Gralla, Megan B.; Hall, Kirsten; Marriage, Tobias A.; Zakamska, Nadia L.; Battaglia, Nick; Bond, J. Richard; Devlin, Mark J.; Hill, J. Colin; Hilton, Matt;

Are quasars really far away

International Nuclear Information System (INIS)

Narlikar, J.V.

1983-01-01

Most astrophysicists think that quasars are distant objects. But new data, based on red-shift anomalies, and new theories embracing non-cosmological doppler effect and gravitational effects could account for the peculiarities of quasars. (U.K.)

Models of the strongly lensed quasar DES J0408-5354

Science.gov (United States)

Agnello, A.; Lin, H.; Buckley-Geer, L.; Treu, T.; Bonvin, V.; Courbin, F.; Lemon, C.; Morishita, T.; Amara, A.; Auger, M. W.; Birrer, S.; Chan, J.; Collett, T.; More, A.; Fassnacht, C. D.; Frieman, J.; Marshall, P. J.; McMahon, R. G.; Meylan, G.; Suyu, S. H.; Castander, F.; Finley, D.; Howell, A.; Kochanek, C.; Makler, M.; Martini, P.; Morgan, N.; Nord, B.; Ostrovski, F.; Schechter, P.; Tucker, D.; Wechsler, R.; Abbott, T. M. C.; Abdalla, F. B.; Allam, S.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Burke, D. L.; Rosell, A. Carnero; Kind, M. Carrasco; Carretero, J.; Crocce, M.; Cunha, C. E.; D'Andrea, C. B.; da Costa, L. N.; Desai, S.; Dietrich, J. P.; Eifler, T. F.; Flaugher, B.; Fosalba, P.; García-Bellido, J.; Gaztanaga, E.; Gill, M. S.; Goldstein, D. A.; Gruen, D.; Gruendl, R. A.; Gschwend, J.; Gutierrez, G.; Honscheid, K.; James, D. J.; Kuehn, K.; Kuropatkin, N.; Li, T. S.; Lima, M.; Maia, M. A. G.; March, M.; Marshall, J. L.; Melchior, P.; Menanteau, F.; Miquel, R.; Ogando, R. L. C.; Plazas, A. A.; Romer, A. K.; Sanchez, E.; Schindler, R.; Schubnell, M.; Sevilla-Noarbe, I.; Smith, M.; Smith, R. C.; Sobreira, F.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Thomas, D.; Walker, A. R.

2017-12-01

We present detailed modelling of the recently discovered, quadruply lensed quasar J0408-5354, with the aim of interpreting its remarkable configuration: besides three quasar images (A,B,D) around the main deflector (G1), a fourth image (C) is significantly reddened and dimmed by a perturber (G2) which is not detected in the Dark Energy Survey imaging data. From lens models incorporating (dust-corrected) flux ratios, we find a perturber Einstein radius 0.04 arcsec ≲ RE, G2 ≲ 0.2 arcsec and enclosed mass Mp(RE, G2) ≲ 1.0 × 1010 M⊙. The main deflector has stellar mass log _{10}(M_{\\star }/M_{⊙})=11.49^{+0.46}_{-0.32}, a projected mass Mp(RE, G1) ≈ 6 × 1011 M⊙ within its Einstein radius RE, G1 = (1.85 ± 0.15) arcsec and predicted velocity dispersion 267-280 km s-1. Follow-up images from a companion monitoring campaign show additional components, including a candidate second source at a redshift between the quasar and G1. Models with free perturbers, and dust-corrected and delay-corrected flux ratios, are also explored. The predicted time-delays (ΔtAB = (135.0 ± 12.6) d, ΔtBD = (21.0 ± 3.5) d) roughly agree with those measured, but better imaging is required for proper modelling and comparison. We also discuss some lessons learnt from J0408-5354 on lensed quasar finding strategies, due to its chromaticity and morphology.

Quasar production: Topological defect formation due to a phase transition linked with massive neutrinos

International Nuclear Information System (INIS)

Singh, A.

1994-01-01

Recent observations of the space distribution of quasars indicate a very notable peak in space density at a redshift of 2 to 3. It is pointed out in this article that this may be the result of a phase transition which has a critical temperature of roughly a few meV (in the cosmological units h=c=k=1). It is further pointed out that such a phase transition is natural in the context of massive neutrinos. In fact, the neutrino masses required for quasar production and those required to solve the solar neutrino problem by the Mikheyev-Smirnov-Wolfenstein mechanism are consistent with each other

The most luminous heavily obscured quasars have a high merger fraction: morphological study of wise -selected hot dust-obscured galaxies

Energy Technology Data Exchange (ETDEWEB)

Fan, Lulu; Gao, Ying; Zhang, Dandan; Jiang, Xiaoming; Wu, Qiaoqian; Yang, Jun; Li, Zhao [Shandong Provincial Key Lab of Optical Astronomy and Solar-Terrestrial Environment, Institute of Space Science, Shandong University, Weihai 264209 (China); Han, Yunkun [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Fang, Guanwen, E-mail: llfan@sdu.edu.cn, E-mail: hanyk@ynao.ac.cn [Institute for Astronomy and History of Science and Technology, Dali University, Dali 671003 (China)

2016-05-10

Previous studies have shown that Wide-field Infrared Survey Explorer -selected hyperluminous, hot dust-obscured galaxies (Hot DOGs) are powered by highly dust-obscured, possibly Compton-thick active galactic nuclei (AGNs). High obscuration provides us a good chance to study the host morphology of the most luminous AGNs directly. We analyze the host morphology of 18 Hot DOGs at z ∼ 3 using Hubble Space Telescope /WFC3 imaging. We find that Hot DOGs have a high merger fraction (62 ± 14%). By fitting the surface brightness profiles, we find that the distribution of Sérsic indices in our Hot DOG sample peaks around 2, which suggests that most Hot DOGs have transforming morphologies. We also derive the AGN bolometric luminosity (∼10{sup 14} L {sub ⊙}) of our Hot DOG sample by using IR spectral energy distributions decomposition. The derived merger fraction and AGN bolometric luminosity relation is well consistent with the variability-based model prediction. Both the high merger fraction in an IR-luminous AGN sample and relatively low merger fraction in a UV/optical-selected, unobscured AGN sample can be expected in the merger-driven evolutionary model. Finally, we conclude that Hot DOGs are merger-driven and may represent a transit phase during the evolution of massive galaxies, transforming from the dusty starburst-dominated phase to the unobscured QSO phase.

Radio-continuum emission from quasar host galaxies

International Nuclear Information System (INIS)

Condon, J. J.; Gower, A. C.; Hutchings, J. B.; Victoria Univ., Canada; Dominion Astrophysical Observatory, Victoria)

1987-01-01

Seven low-redshift quasars that are likely to be in spiral galaxies have been observed in a search for radio-continuum emission from the host galaxies of quasars. The properties of the individual quasars are listed, and 1.49 GHz contour maps of the seven quasar fields are presented. Map parameters and radio source parameters are given along with optical images of three of the objects. The results indicate that these quasars probably do reside in spiral galaxies. The radio luminosities, sizes, orientations, and u values all indicate that relativistic beaming alone cannot be used to explain the differences between the present sources and the far stronger radio sources seen in blazars or larger optically selected quasar samples. However, an apparent correlation between the radio luminosity and the ratio of the optical nuclear to host-galaxy luminosity is consistent with some beaming of nuclear radiation. 26 references

Outshining the quasars at reionization

DEFF Research Database (Denmark)

Watson, D.; Reeves, J.N.; Hjorth, J.

2006-01-01

Gamma Rays: Bursts, Galaxies: Intergalactic Medium, Galaxies: Quasars: Absorption Lines, X-Rays: Galaxies, X-Rays: General Udgivelsesdato: 19 January......Gamma Rays: Bursts, Galaxies: Intergalactic Medium, Galaxies: Quasars: Absorption Lines, X-Rays: Galaxies, X-Rays: General Udgivelsesdato: 19 January...

Cosmological implications of a large complete quasar sample.

Science.gov (United States)

Segal, I E; Nicoll, J F

1998-04-28

Objective and reproducible determinations of the probabilistic significance levels of the deviations between theoretical cosmological prediction and direct model-independent observation are made for the Large Bright Quasar Sample [Foltz, C., Chaffee, F. H., Hewett, P. C., MacAlpine, G. M., Turnshek, D. A., et al. (1987) Astron. J. 94, 1423-1460]. The Expanding Universe model as represented by the Friedman-Lemaitre cosmology with parameters qo = 0, Lambda = 0 denoted as C1 and chronometric cosmology (no relevant adjustable parameters) denoted as C2 are the cosmologies considered. The mean and the dispersion of the apparent magnitudes and the slope of the apparent magnitude-redshift relation are the directly observed statistics predicted. The C1 predictions of these cosmology-independent quantities are deviant by as much as 11sigma from direct observation; none of the C2 predictions deviate by >2sigma. The C1 deviations may be reconciled with theory by the hypothesis of quasar "evolution," which, however, appears incapable of being substantiated through direct observation. The excellent quantitative agreement of the C1 deviations with those predicted by C2 without adjustable parameters for the results of analysis predicated on C1 indicates that the evolution hypothesis may well be a theoretical artifact.

HUBBLE CAPTURES MERGER BETWEEN QUASAR AND GALAXY

Science.gov (United States)

2002-01-01

This NASA Hubble Space Telescope image shows evidence fo r a merger between a quasar and a companion galaxy. This surprising result might require theorists to rethink their explanations for the nature of quasars, the most energetic objects in the universe. The bright central object is the quasar itself, located several billion light-years away. The two wisps on the (left) of the bright central object are remnants of a bright galaxy that have been disrupted by the mutual gravitational attraction between the quasar and the companion galaxy. This provides clear evidence for a merger between the two objects. Since their discovery in 1963, quasars (quasi-stellar objects) have been enigmatic because they emit prodigious amounts of energy from a very compact source. The most widely accepted model is that a quasar is powered by a supermassive black hole in the core of a galaxy. These new observations proved a challenge for theorists as no current models predict the complex quasar interactions unveiled by Hubble. The image was taken with the Wide Field Planetary Camera-2. Credit: John Bahcall, Institute for Advanced Study, NASA.

Quasar Parallax: a Method for Determining Direct Geometrical Distances to Quasars

OpenAIRE

Elvis, Martin; Karovska, Margarita

2002-01-01

We describe a novel method to determine direct geometrical distances to quasars that can measure the cosmological constant, Lambda, with minimal assumptions. This method is equivalent to geometric parallax, with the `standard length' being the size of the quasar broad emission line region (BELR) as determined from the light travel time measurements of reverberation mapping. The effect of non-zero Lambda on angular diameter is large, 40% at z=2, so mapping angular diameter distances vs. redshi...

What makes red quasars red?. Observational evidence for dust extinction from line ratio analysis

Science.gov (United States)

Kim, Dohyeong; Im, Myungshin

2018-02-01

Red quasars are very red in the optical through near-infrared (NIR) wavelengths, which is possibly due to dust extinction in their host galaxies as expected in a scenario in which red quasars are an intermediate population between merger-driven star-forming galaxies and unobscured type 1 quasars. However, alternative mechanisms also exist to explain their red colors: (i) an intrinsically red continuum; (ii) an unusual high covering factor of the hot dust component, that is, CFHD = LHD/Lbol, where the LHD is the luminosity from the hot dust component and the Lbol is the bolometric luminosity; and (iii) a moderate viewing angle. In order to investigate why red quasars are red, we studied optical and NIR spectra of 20 red quasars at z 0.3 and 0.7, where the usage of the NIR spectra allowed us to look into red quasar properties in ways that are little affected by dust extinction. The Paschen to Balmer line ratios were derived for 13 red quasars and the values were found to be 10 times higher than unobscured type 1 quasars, suggesting a heavy dust extinction with AV > 2.5 mag. Furthermore, the Paschen to Balmer line ratios of red quasars are difficult to explain with plausible physical conditions without adopting the concept of the dust extinction. The CFHD of red quasars are similar to, or marginally higher than, those of unobscured type 1 quasars. The Eddington ratios, computed for 19 out of 20 red quasars, are higher than those of unobscured type 1 quasars (by factors of 3-5), and hence the moderate viewing angle scenario is disfavored. Consequently, these results strongly suggest the dust extinction that is connected to an enhanced nuclear activity as the origin of the red color of red quasars, which is consistent with the merger-driven quasar evolution scenario. Full Table A.1 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/610/A31

Far-infrared properties of optically selected quasars

International Nuclear Information System (INIS)

Edelson, R.A.

1986-01-01

The far-infrared properties of 10, optically selected quasars were studied on the basis of pointed IRAS observations and ground-based near-infrared and radio measurements. Nine of these quasars were detected in at least three IRAS bands. The flat spectral energy distributions characterizing these optically selected quasars together with large 60-100-micron luminosities suggest that the infrared emission is dominated by nonthermal radiation. Seven of the nine quasars with far-infrared detections were found to have low-frequency turnovers. 12 references

Dust-deficient Palomar-Green Quasars and the Diversity of AGN Intrinsic IR Emission

Energy Technology Data Exchange (ETDEWEB)

Lyu, Jianwei; Rieke, G. H. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Shi, Yong, E-mail: jianwei@email.arizona.edu [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China)

2017-02-01

To elucidate the intrinsic broadband infrared (IR) emission properties of active galactic nuclei (AGNs), we analyze the spectral energy distributions (SEDs) of 87 z ≲ 0.5 Palomar-Green (PG) quasars. While the Elvis AGN template with a moderate far-IR correction can reasonably match the SEDs of the AGN components in ∼60% of the sample (and is superior to alternatives such as that by Assef), it fails on two quasar populations: (1) hot-dust-deficient (HDD) quasars that show very weak emission thoroughly from the near-IR to the far-IR, and (2) warm-dust-deficient (WDD) quasars that have similar hot dust emission as normal quasars but are relatively faint in the mid- and far-IR. After building composite AGN templates for these dust-deficient quasars, we successfully fit the 0.3–500 μm SEDs of the PG sample with the appropriate AGN template, an infrared template of a star-forming galaxy, and a host galaxy stellar template. 20 HDD and 12 WDD quasars are identified from the SED decomposition, including seven ambiguous cases. Compared with normal quasars, the HDD quasars have AGNs with relatively low Eddington ratios and the fraction of WDD quasars increases with AGN luminosity. Moreover, both the HDD and WDD quasar populations show relatively stronger mid-IR silicate emission. Virtually identical SED properties are also found in some quasars from z = 0.5 to 6. We propose a conceptual model to demonstrate that the observed dust deficiency of quasars can result from a change of structures of the circumnuclear tori that can occur at any cosmic epoch.

A kiloparsec-scale hyper-starburst in a quasar host less than 1 gigayear after the Big Bang.

Science.gov (United States)

Walter, Fabian; Riechers, Dominik; Cox, Pierre; Neri, Roberto; Carilli, Chris; Bertoldi, Frank; Weiss, Axel; Maiolino, Roberto

2009-02-05

The host galaxy of the quasar SDSS J114816.64+525150.3 (at redshift z = 6.42, when the Universe was less than a billion years old) has an infrared luminosity of 2.2 x 10(13) times that of the Sun, presumably significantly powered by a massive burst of star formation. In local examples of extremely luminous galaxies, such as Arp 220, the burst of star formation is concentrated in a relatively small central region of <100 pc radius. It is not known on which scales stars are forming in active galaxies in the early Universe, at a time when they are probably undergoing their initial burst of star formation. We do know that at some early time, structures comparable to the spheroidal bulge of the Milky Way must have formed. Here we report a spatially resolved image of [C ii] emission of the host galaxy of J114816.64+525150.3 that demonstrates that its star-forming gas is distributed over a radius of about 750 pc around the centre. The surface density of the star formation rate averaged over this region is approximately 1,000 year(-1) kpc(-2). This surface density is comparable to the peak in Arp 220, although about two orders of magnitude larger in area. This vigorous star-forming event is likely to give rise to a massive spheroidal component in this system.

The Low-Resolution Spectrograph of the Hobby-Eberly Telescope. II. Observations of Quasar Candidates from the Sloan Digital Sky Survey

International Nuclear Information System (INIS)

Schneider, D. P.; Hill, Gary J.; Fan, X.; Ramsey, L. W.; MacQueen, P. J.; Weedman, D. W.; Booth, J. A.; Eracleous, M.; Gunn, J. E.; Lupton, R. H.

2000-01-01

This paper describes spectra of quasar candidates acquired during the commissioning phase of the Low-Resolution Spectrograph of the Hobby-Eberly Telescope. The objects were identified as possible quasars from multicolor image data from the Sloan Digital Sky Survey. The 10 sources had typical r' magnitudes of 19-20, except for one extremely red object with r ' ≅23. The data, obtained with exposure times between 10 and 25 minutes, reveal that the spectra of four candidates are essentially featureless and are not quasars, five are quasars with redshifts between 2.92 and 4.15 (including one broad absorption line quasar), and the red source is a very late M star or early L dwarf. (c) (c) 2000. The Astronomical Society of the Pacific

Observational Constraints on Quasar Black Hole Mass Distributions, Eddington Ratio Distributions, and Lifetimes

DEFF Research Database (Denmark)

Kelly, Brandon C.; Vestergaard, Marianne; Fan, X.

2010-01-01

I will present the black hole mass function (BHMF) of broad line quasars in the SDSS DR3. We employ a powerful Bayesian statistical technique that corrects for incompleteness and the statistical uncertainty in the mass estimates. We find evidence that the most massive black hole appeared as quasars...... earlier in the universe, and that most quasars are not radiating at or near the Eddington limit. I will also present constraints on the quasar lifetime and maximum black hole mass, derived from the mass functions....

Phylogenetic Analyses of Quasars and Galaxies

Science.gov (United States)

Fraix-Burnet, Didier; D'Onofrio, Mauro; Marziani, Paola

2017-10-01

Phylogenetic approaches have proven to be useful in astrophysics. We have recently published a Maximum Parsimony (or cladistics) analysis on two samples of 215 and 85 low-z quasars (z phylogeny of quasars may be represented by the ontogeny of their central black hole, i.e. the increase of the black hole mass. However these exciting results are based on a small sample of low-z quasars, so that the work must be extended. We are here faced with two difficulties. The first one is the current lack of a larger sample with similar observables. The second one is the prohibitive computation time to perform a cladistic analysis on more that about one thousand objects. We show in this paper an experimental strategy on about 1500 galaxies to get around this difficulty. Even if it not related to the quasar study, it is interesting by itself and opens new pathways to generalize the quasar findings.

X-ray Spectral Survey of WGACAT Quasars, II: Optical and Radio Properties of Quasars with Low Energy X-ray Cut-offs

OpenAIRE

Elvis, Martin; Fiore, Fabrizio; Giommi, Paolo; Padovani, Paolo

1997-01-01

We have selected quasars with X-ray colors suggestive of a low energy cut-off, from the ROSAT PSPC pointed archive. We examine the radio and optical properties of these 13 quasars. Five out of the seven quasars with good optical spectra show associated optical absorption lines, with two having high delta-v candidate systems. Two other cut-off quasars show reddening associated with the quasar. We conclude that absorption is highly likely to be the cause of the X-ray cut-offs, and that the abso...

Are quasars local

International Nuclear Information System (INIS)

Terrell, J.

1974-01-01

The problems of interpreting quasars as galaxies, at distances of billions of light-years, seem to be increasing with time and with observational knowledge. The incredibly large energy and brightness requirements, the very small size and thus high surface brightness required by their rapid fluctuations in luminosity, the recently-discovered radio-source separation speeds apparently much greater than the speed of light, their general lack of association with distant galaxies, and many other properties are all very difficult to explain on the basis of cosmological distance. The very local quasar model, involving much less massive and bright objects--perhaps similar to Type O stars--emitted at relativistic speeds by the center of our own galaxy, greatly eases these difficulties. Since such ejected objects also seem necessary to explain the similarly strange properties of radio galaxies, the emission of local quasars from some galaxies might be deduced on this basis alone. (6 figures) (U.S.)

Comparison of clinical outcomes between luminal invasive ductal carcinoma and luminal invasive lobular carcinoma.

Science.gov (United States)

Adachi, Yayoi; Ishiguro, Junko; Kotani, Haruru; Hisada, Tomoka; Ichikawa, Mari; Gondo, Naomi; Yoshimura, Akiyo; Kondo, Naoto; Hattori, Masaya; Sawaki, Masataka; Fujita, Takashi; Kikumori, Toyone; Yatabe, Yasushi; Kodera, Yasuhiro; Iwata, Hiroji

2016-03-25

The pathological and clinical features of invasive lobular carcinoma (ILC) differ from those of invasive ductal carcinoma (IDC). Several studies have indicated that patients with ILC have a better prognosis than those with ductal carcinoma. However, no previous study has considered the molecular subtypes and histological subtypes of ILC. We compared prognosis between IDC and classical, luminal type ILC and developed prognostic factors for early breast cancer patients with classical luminal ILC. Four thousand one hundred ten breast cancer patients were treated at the Aichi Cancer Center Hospital from 2003 to 2012. We identified 1,661 cases with luminal IDC and 105 cases with luminal classical ILC. We examined baseline characteristics, clinical outcomes, and prognostic factors of luminal ILC. The prognosis of luminal ILC was significantly worse than that of luminal IDC. The rates of 5-year disease free survival (DFS) were 91.9% and 88.4% for patients with luminal IDC and luminal ILC, respectively (P = 0.008). The rates of 5-year overall survival (OS) were 97.6% and 93.1% for patients with luminal IDC and luminal ILC respectively (P = 0.030). Although we analyzed prognosis according to stratification by tumor size, luminal ILC tended to have worse DFS than luminal IDC in the large tumor group. In addition, although our analysis was performed according to matching lymph node status, luminal ILC had a significantly worse DFS and OS than luminal IDC in node-positive patients. Survival curves showed that the prognosis for ILC became worse than IDC over time. Multivariate analysis showed that ILC was an important factor related to higher risk of recurrence of luminal type breast cancer, even when tumor size, lymph node status and histological grade were considered. Luminal ILC had worse outcomes than luminal IDC. Consequently, different treatment approaches should be used for luminal ILC than for luminal IDC.

AGN feedback on molecular gas reservoirs in quasars at z 2.4

Science.gov (United States)

Carniani, S.; Marconi, A.; Maiolino, R.; Feruglio, C.; Brusa, M.; Cresci, G.; Cano-Díaz, M.; Cicone, C.; Balmaverde, B.; Fiore, F.; Ferrara, A.; Gallerani, S.; La Franca, F.; Mainieri, V.; Mannucci, F.; Netzer, H.; Piconcelli, E.; Sani, E.; Schneider, R.; Shemmer, O.; Testi, L.

2017-09-01

We present new ALMA observations aimed at mapping molecular gas reservoirs through the CO(3-2) transition in three quasars at z ≃ 2.4, LBQS 0109+0213, 2QZ J002830.4-281706, and [HB89] 0329-385. Previous [Oiii]λ5007 observations of these quasars showed evidence for ionised outflows quenching star formation in their host galaxies. Systemic CO(3-2) emission has been detected only in one quasar, LBQS 0109+0213, where the CO(3-2) emission is spatially anti-correlated with the ionised outflow, suggesting that most of the molecular gas may have been dispersed or heated in the region swept by the outflow. In all three sources, including the one detected in CO, our constraints on the molecular gas mass indicate a significantly reduced reservoir compared to main-sequence galaxies at the same redshift, supporting a negative feedback scenario. In the quasar 2QZ J002830.4-281706, we tentatively detect an emission line blob blue-shifted by v - 2000 km s-1 with respect to the galaxy systemic velocity and spatially offset by 0.2'' (1.7 kpc) with respect to the ALMA continuum peak. Interestingly, such emission feature is coincident in both velocity and space with the ionised outflow as seen in [Oiii]λ5007. This tentative detection must be confirmed with deeper observations but, if real, it could represent the molecular counterpart of the ionised gas outflow driven by the Active Galactic Nucleus (AGN). Finally, in all ALMA maps we detect the presence of serendipitous line emitters within a projected distance 160 kpc from the quasars. By identifying these features with the CO(3-2) transition, we find that the serendipitous line emitters would be located within | Δv | < 500 km s-1 from the quasars, hence suggesting an overdensity of galaxies in two out of three quasars.

Using quasars as standard clocks for measuring cosmological redshift.

Science.gov (United States)

Dai, De-Chang; Starkman, Glenn D; Stojkovic, Branislav; Stojkovic, Dejan; Weltman, Amanda

2012-06-08

We report hitherto unnoticed patterns in quasar light curves. We characterize segments of the quasar's light curves with the slopes of the straight lines fit through them. These slopes appear to be directly related to the quasars' redshifts. Alternatively, using only global shifts in time and flux, we are able to find significant overlaps between the light curves of different pairs of quasars by fitting the ratio of their redshifts. We are then able to reliably determine the redshift of one quasar from another. This implies that one can use quasars as standard clocks, as we explicitly demonstrate by constructing two independent methods of finding the redshift of a quasar from its light curve.

A Hubble Diagram for Quasars

Directory of Open Access Journals (Sweden)

Susanna Bisogni

2018-01-01

Full Text Available The cosmological model is at present not tested between the redshift of the farthest observed supernovae (z ~ 1.4 and that of the Cosmic Microwave Background (z ~ 1,100. Here we introduce a new method to measure the cosmological parameters: we show that quasars can be used as “standard candles” by employing the non-linear relation between their intrinsic UV and X-ray emission as an absolute distance indicator. We built a sample of ~1,900 quasars with available UV and X-ray observations, and produced a Hubble Diagram up to z ~ 5. The analysis of the quasar Hubble Diagram, when used in combination with supernovae, provides robust constraints on the matter and energy content in the cosmos. The application of this method to forthcoming, larger quasar samples, will also provide tight constraints on the dark energy equation of state and its possible evolution with time.

A Candidate Tidal Disruption Event in a Quasar at z = 2.359 from Abundance Ratio Variability

Science.gov (United States)

Liu, Xin; Dittmann, Alexander; Shen, Yue; Jiang, Linhua

2018-05-01

A small fraction of quasars show an unusually high nitrogen-to-carbon ratio (N/C) in their spectra. These “nitrogen-rich” (N-rich) quasars are a long-standing puzzle because their interstellar medium implies stellar populations with abnormally high metallicities. It has recently been proposed that N-rich quasars may result from tidal disruption events (TDEs) of stars by supermassive black holes. The rapid enhancement of nitrogen and the depletion of carbon due to the carbon–nitrogen–oxygen cycle in supersolar mass stars could naturally produce high N/C. However, the TDE hypothesis predicts that the N/C should change with time, which has never hitherto been observed. Here we report the discovery of the first N-rich quasar with rapid N/C variability that could be caused by a TDE. Two spectra separated by 1.7 years (rest-frame) show that the N III] λ1750/C III] λ1909 intensity ratio decayed by ∼86% ± 14% (1σ). Optical (rest-frame UV) light-curve and X-ray observations are qualitatively consistent with the TDE hypothesis; though, the time baseline falls short of a definitive proof. Putting the single-object discovery into context, statistical analyses of the ∼80 known N-rich quasars with high-quality archival spectra show evidence (at a 5σ significance level) of a decrease in N/C on timescales of >1 year (rest-frame) and a constant level of ionization (indicated by the C III] λ1909/C IV λ1549 intensity ratio). If confirmed, our results demonstrate the method of identifying TDE candidates in quasars via abundance ratio variability, opening a new window of TDE observations at high redshift (z > 2) with upcoming large-scale time-domain spectroscopic surveys.

A Long-Term Space Astrophysics Research Program: The Evolution of the Quasar Continuum

Science.gov (United States)

Elvis, M.; Oliversen, Ronald K. (Technical Monitor)

2002-01-01

Four papers have been written. One reports on the major study funded by this grant: a pan-chromatic study of the quasar continuum at redshift 3. Two others make use of the quasar continuum shapes to find the minimum total accretion luminosity of the Universe, and hence the efficiency and spin of supermassive black holes; the second shows that the reemission of absorbed quasar radiation alleviates a major problem with galaxy formation and the FIR background. The last paper recognizes the role quasars may play in the initial formation of dust in the early Universe.

Intergalactic dust and quasar distribution

International Nuclear Information System (INIS)

Soltan, A.

1979-01-01

Non-homogeneous intergalactic extinction may considerably affect the quasar distribution. Especially samples of quasars isolated on the basis of B-V colours are subject to this phenomenon. Apparent grouping and close pairs of quasars reported in the literature may be a result of intergalactic dust. Using surface distribution of faint blue objects selected by Hawkins and Reddish it is estimated that intergalactic extinction in B should reach approximately 1 mag out to the redshift of approximately 1. This is slightly larger than predicted by theory and comparable to the mean dust density derived from observations. (Author)

redMaGiC: selecting luminous red galaxies from the DES Science Verification data

Energy Technology Data Exchange (ETDEWEB)

Rozo, E. [Univ. of Arizona, Tucson, AZ (United States). et al.

2016-05-30

We introduce redMaGiC, an automated algorithm for selecting Luminous Red Galaxies (LRGs). The algorithm was developed to minimize photometric redshift uncertainties in photometric large-scale structure studies. redMaGiC achieves this by self-training the color-cuts necessary to produce a luminosity-thresholded LRG sam- ple of constant comoving density. Additionally, we demonstrate that redMaGiC photo-zs are very nearly as accurate as the best machine-learning based methods, yet they require minimal spectroscopic training, do not suffer from extrapolation biases, and are very nearly Gaussian. We apply our algorithm to Dark Energy Survey (DES) Science Verification (SV) data to produce a redMaGiC catalog sampling the redshift range z ϵ [0.2,0.8]. Our fiducial sample has a comoving space density of 10^-3 (h^-1Mpc)^-3, and a median photo-z bias (z_spec z_photo) and scatter (σ_z=(1 + z)) of 0.005 and 0.017 respectively.The corresponding 5σ outlier fraction is 1.4%. We also test our algorithm with Sloan Digital Sky Survey (SDSS) Data Release 8 (DR8) and Stripe 82 data, and discuss how spectroscopic training can be used to control photo-z biases at the 0.1% level.

Crystal structure of AFV3-109, a highly conserved protein from crenarchaeal viruses

Directory of Open Access Journals (Sweden)

Quevillon-Cheruel Sophie

2007-01-01

Full Text Available Abstract The extraordinary morphologies of viruses infecting hyperthermophilic archaea clearly distinguish them from bacterial and eukaryotic viruses. Moreover, their genomes code for proteins that to a large extend have no related sequences in the extent databases. However, a small pool of genes is shared by overlapping subsets of these viruses, and the most conserved gene, exemplified by the ORF109 of the Acidianus Filamentous Virus 3, AFV3, is present on genomes of members of three viral familes, the Lipothrixviridae, Rudiviridae, and "Bicaudaviridae", as well as of the unclassified Sulfolobus Turreted Icosahedral Virus, STIV. We present here the crystal structure of the protein (Mr = 13.1 kD, 109 residues encoded by the AFV3 ORF 109 in two different crystal forms at 1.5 and 1.3 Å resolution. The structure of AFV3-109 is a five stranded β-sheet with loops on one side and three helices on the other. It forms a dimer adopting the shape of a cradle that encompasses the best conserved regions of the sequence. No protein with a related fold could be identified except for the ortholog from STIV1, whose structure was deposited at the Protein Data Bank. We could clearly identify a well bound glycerol inside the cradle, contacting exclusively totally conserved residues. This interaction was confirmed in solution by fluorescence titration. Although the function of AFV3-109 cannot be deduced directly from its structure, structural homology with the STIV1 protein, and the size and charge distribution of the cavity suggested it could interact with nucleic acids. Fluorescence quenching titrations also showed that AFV3-109 interacts with dsDNA. Genomic sequence analysis revealed bacterial homologs of AFV3-109 as a part of a putative previously unidentified prophage sequences in some Firmicutes.

Objective-prism spectrophotometry of quasars

International Nuclear Information System (INIS)

Clowes, R.G.

1980-01-01

A procedure is derived for obtaining low-resolution spectrophotometry of quasars directly from the objective-prism plates on which they were discovered. Measurements with a PDS microdensitometer of approximately 130 quasar candidates in approximately the central 19 square degrees of the UK Schmidt prism plate UJ3682P were used in the application of the procedure. The success of the objective-prism spectrophotometry is demonstrated in a comparison with 12 slit spectra. Redshifts and equivalent widths can be determined with typical discrepancies of 1% and 40% respectively. This work on objective-prism spectrophotometry leads to a quantification of the selection effects that operate in the searches for emission-line objects on objective-prism plates. The quantification successfully explains an apparent discrepancy in the detection efficiencies of the CTIO-4m and Curtis Schmidt surveys for quasars. Spectra of quasars that were observed with the Image Photon Counting System on the Anglo-Australian Telescope are presented. The observations of quasars with broad absorption troughs indicate the ejection of matter with velocities up to approximately 22000kms -1 and with velocity dispersions up to approximately 11000kms -1 . Data on the wavelength dependences of the contrast γ and the grain response function g of the Kodak emulsion IIIaJ are presented. (author)

Comparison of clinical outcomes between luminal invasive ductal carcinoma and luminal invasive lobular carcinoma

International Nuclear Information System (INIS)

Adachi, Yayoi; Ishiguro, Junko; Kotani, Haruru; Hisada, Tomoka; Ichikawa, Mari; Gondo, Naomi; Yoshimura, Akiyo; Kondo, Naoto; Hattori, Masaya; Sawaki, Masataka; Fujita, Takashi; Kikumori, Toyone; Yatabe, Yasushi; Kodera, Yasuhiro; Iwata, Hiroji

2016-01-01

The pathological and clinical features of invasive lobular carcinoma (ILC) differ from those of invasive ductal carcinoma (IDC). Several studies have indicated that patients with ILC have a better prognosis than those with ductal carcinoma. However, no previous study has considered the molecular subtypes and histological subtypes of ILC. We compared prognosis between IDC and classical, luminal type ILC and developed prognostic factors for early breast cancer patients with classical luminal ILC. Four thousand one hundred ten breast cancer patients were treated at the Aichi Cancer Center Hospital from 2003 to 2012. We identified 1,661 cases with luminal IDC and 105 cases with luminal classical ILC. We examined baseline characteristics, clinical outcomes, and prognostic factors of luminal ILC. The prognosis of luminal ILC was significantly worse than that of luminal IDC. The rates of 5-year disease free survival (DFS) were 91.9 % and 88.4 % for patients with luminal IDC and luminal ILC, respectively (P = 0.008). The rates of 5-year overall survival (OS) were 97.6 % and 93.1 % for patients with luminal IDC and luminal ILC respectively (P = 0.030). Although we analyzed prognosis according to stratification by tumor size, luminal ILC tended to have worse DFS than luminal IDC in the large tumor group. In addition, although our analysis was performed according to matching lymph node status, luminal ILC had a significantly worse DFS and OS than luminal IDC in node-positive patients. Survival curves showed that the prognosis for ILC became worse than IDC over time. Multivariate analysis showed that ILC was an important factor related to higher risk of recurrence of luminal type breast cancer, even when tumor size, lymph node status and histological grade were considered. Luminal ILC had worse outcomes than luminal IDC. Consequently, different treatment approaches should be used for luminal ILC than for luminal IDC. The online version of this article (doi:10.1186/s12885

Constraining the Evolution of the Ionizing Background and the Epoch of Reionization with z~6 Quasars. II. A Sample of 19 Quasars

Science.gov (United States)

Fan, Xiaohui; Strauss, Michael A.; Becker, Robert H.; White, Richard L.; Gunn, James E.; Knapp, Gillian R.; Richards, Gordon T.; Schneider, Donald P.; Brinkmann, J.; Fukugita, Masataka

2006-07-01

We study the evolution of the ionization state of the intergalactic medium (IGM) at the end of the reionization epoch using moderate-resolution spectra of a sample of 19 quasars at 5.745.7: the GP optical depth evolution changes from τeffGP~(1+z)4.3 to (1+z)>~11, and the average length of dark gaps with τ>3.5 increases from 80 comoving Mpc. The dispersion of IGM properties along different lines of sight also increases rapidly, implying fluctuations by a factor of >~4 in the UV background at z>6, when the mean free path of UV photons is comparable to the correlation length of the star-forming galaxies that are thought to have caused reionization. The mean length of dark gaps shows the most dramatic increase at z~6, as well as the largest line-of-sight variations. We suggest using dark gap statistics as a powerful probe of the ionization state of the IGM at yet higher redshift. The sizes of H II regions around luminous quasars decrease rapidly toward higher redshift, suggesting that the neutral fraction of the IGM has increased by a factor of >~10 from z=5.7 to 6.4, consistent with the value derived from the GP optical depth. The mass-averaged neutral fraction is 1%-4% at z~6.2 based on the GP optical depth and H II region size measurements. The observations suggest that z~6 is the end of the overlapping stage of reionization and are inconsistent with a mostly neutral IGM at z~6, as indicated by the finite length of the dark absorption gaps. Based on observations obtained with the Sloan Digital Sky Survey at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, made possible by the generous financial support of the W. M. Keck Foundation, with the MMT Observatory, a joint facility of the University of Arizona and the Smithsonian Institution, and with the Kitt Peak National Observatory 4 m Mayall Telescope. This paper

Very-high-energy gamma rays from a distant quasar: how transparent is the universe?

Science.gov (United States)

Albert, J; Aliu, E; Anderhub, H; Antonelli, L A; Antoranz, P; Backes, M; Baixeras, C; Barrio, J A; Bartko, H; Bastieri, D; Becker, J K; Bednarek, W; Berger, K; Bernardini, E; Bigongiari, C; Biland, A; Bock, R K; Bonnoli, G; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Covino, S; Curtef, V; Dazzi, F; De Angelis, A; De Cea Del Pozo, E; de Los Reyes, R; De Lotto, B; De Maria, M; De Sabata, F; Mendez, C Delgado; Dominguez, A; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fernández, E; Firpo, R; Fonseca, M V; Font, L; Galante, N; López, R J García; Garczarczyk, M; Gaug, M; Goebel, F; Hayashida, M; Herrero, A; Höhne, D; Hose, J; Hsu, C C; Huber, S; Jogler, T; Kneiske, T M; Kranich, D; La Barbera, A; Laille, A; Leonardo, E; Lindfors, E; Lombardi, S; Longo, F; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Mariotti, M; Martínez, M; Mazin, D; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moles, M; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Otte, N; Oya, I; Panniello, M; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R G; Perez-Torres, M A; Persic, M; Peruzzo, L; Piccioli, A; Prada, F; Prandini, E; Puchades, N; Raymers, A; Rhode, W; Ribó, M; Rico, J; Rissi, M; Robert, A; Rügamer, S; Saggion, A; Saito, T Y; Salvati, M; Sanchez-Conde, M; Sartori, P; Satalecka, K; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sierpowska-Bartosik, A; Sillanpää, A; Sobczynska, D; Spanier, F; Stamerra, A; Stark, L S; Takalo, L; Tavecchio, F; Temnikov, P; Tescaro, D; Teshima, M; Tluczykont, M; Torres, D F; Turini, N; Vankov, H; Venturini, A; Vitale, V; Wagner, R M; Wittek, W; Zabalza, V; Zandanel, F; Zanin, R; Zapatero, J

2008-06-27

The atmospheric Cherenkov gamma-ray telescope MAGIC, designed for a low-energy threshold, has detected very-high-energy gamma rays from a giant flare of the distant Quasi-Stellar Radio Source (in short: radio quasar) 3C 279, at a distance of more than 5 billion light-years (a redshift of 0.536). No quasar has been observed previously in very-high-energy gamma radiation, and this is also the most distant object detected emitting gamma rays above 50 gigaelectron volts. Because high-energy gamma rays may be stopped by interacting with the diffuse background light in the universe, the observations by MAGIC imply a low amount for such light, consistent with that known from galaxy counts.

BROAD ABSORPTION LINE VARIABILITY ON MULTI-YEAR TIMESCALES IN A LARGE QUASAR SAMPLE

Energy Technology Data Exchange (ETDEWEB)

Filiz Ak, N.; Brandt, W. N.; Schneider, D. P. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Hall, P. B. [Department of Physics and Astronomy, York University, 4700 Keele St., Toronto, Ontario, M3J 1P3 (Canada); Anderson, S. F. [Astronomy Department, University of Washington, Seattle, WA 98195 (United States); Hamann, F. [Department of Astronomy, University of Florida, Gainesville, FL 32611-2055 (United States); Lundgren, B. F. [Department of Astronomy, University of Wisconsin, Madison, WI 53706 (United States); Myers, Adam D. [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States); Pâris, I. [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Petitjean, P. [Universite Paris 6, Institut d' Astrophysique de Paris, 75014, Paris (France); Ross, Nicholas P. [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 92420 (United States); Shen, Yue [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., MS-51, Cambridge, MA 02138 (United States); York, Don, E-mail: nfilizak@astro.psu.edu [The University of Chicago, Department of Astronomy and Astrophysics, Chicago, IL 60637 (United States)

2013-11-10

We present a detailed investigation of the variability of 428 C IV and 235 Si IV broad absorption line (BAL) troughs identified in multi-epoch observations of 291 quasars by the Sloan Digital Sky Survey-I/II/III. These observations primarily sample rest-frame timescales of 1-3.7 yr over which significant rearrangement of the BAL wind is expected. We derive a number of observational results on, e.g., the frequency of BAL variability, the velocity range over which BAL variability occurs, the primary observed form of BAL-trough variability, the dependence of BAL variability upon timescale, the frequency of BAL strengthening versus weakening, correlations between BAL variability and BAL-trough profiles, relations between C IV and Si IV BAL variability, coordinated multi-trough variability, and BAL variations as a function of quasar properties. We assess implications of these observational results for quasar winds. Our results support models where most BAL absorption is formed within an order-of-magnitude of the wind-launching radius, although a significant minority of BAL troughs may arise on larger scales. We estimate an average lifetime for a BAL trough along our line-of-sight of a few thousand years. BAL disappearance and emergence events appear to be extremes of general BAL variability, rather than being qualitatively distinct phenomena. We derive the parameters of a random-walk model for BAL EW variability, finding that this model can acceptably describe some key aspects of EW variability. The coordinated trough variability of BAL quasars with multiple troughs suggests that changes in 'shielding gas' may play a significant role in driving general BAL variability.

Various Approaches for Targeting Quasar Candidates

Science.gov (United States)

Zhang, Y.; Zhao, Y.

2015-09-01

With the establishment and development of space-based and ground-based observational facilities, the improvement of scientific output of high-cost facilities is still a hot issue for astronomers. The discovery of new and rare quasars attracts much attention. Different methods to select quasar candidates are in bloom. Among them, some are based on color cuts, some are from multiwavelength data, some rely on variability of quasars, some are based on data mining, and some depend on ensemble methods.

DISCLOSING THE RADIO LOUDNESS DISTRIBUTION DICHOTOMY IN QUASARS: AN UNBIASED MONTE CARLO APPROACH APPLIED TO THE SDSS-FIRST QUASAR SAMPLE

Energy Technology Data Exchange (ETDEWEB)

Balokovic, M. [Department of Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Smolcic, V. [Argelander-Institut fuer Astronomie, Auf dem Hugel 71, D-53121 Bonn (Germany); Ivezic, Z. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Zamorani, G. [INAF-Osservatorio Astronomico di Bologna, via Ranzani 1, I-40127 Bologna (Italy); Schinnerer, E. [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany); Kelly, B. C. [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93106 (United States)

2012-11-01

We investigate the dichotomy in the radio loudness distribution of quasars by modeling their radio emission and various selection effects using a Monte Carlo approach. The existence of two physically distinct quasar populations, the radio-loud and radio-quiet quasars, is controversial and over the last decade a bimodal distribution of radio loudness of quasars has been both affirmed and disputed. We model the quasar radio luminosity distribution with simple unimodal and bimodal distribution functions. The resulting simulated samples are compared to a fiducial sample of 8300 quasars drawn from the SDSS DR7 Quasar Catalog and combined with radio observations from the FIRST survey. Our results indicate that the SDSS-FIRST sample is best described by a radio loudness distribution which consists of two components, with (12 {+-} 1)% of sources in the radio-loud component. On the other hand, the evidence for a local minimum in the loudness distribution (bimodality) is not strong and we find that previous claims for its existence were probably affected by the incompleteness of the FIRST survey close to its faint limit. We also investigate the redshift and luminosity dependence of the radio loudness distribution and find tentative evidence that at high redshift radio-loud quasars were rarer, on average louder, and exhibited a smaller range in radio loudness. In agreement with other recent work, we conclude that the SDSS-FIRST sample strongly suggests that the radio loudness distribution of quasars is not a universal function, and that more complex models than presented here are needed to fully explain available observations.

DISCLOSING THE RADIO LOUDNESS DISTRIBUTION DICHOTOMY IN QUASARS: AN UNBIASED MONTE CARLO APPROACH APPLIED TO THE SDSS-FIRST QUASAR SAMPLE

International Nuclear Information System (INIS)

Baloković, M.; Smolčić, V.; Ivezić, Ž.; Zamorani, G.; Schinnerer, E.; Kelly, B. C.

2012-01-01

We investigate the dichotomy in the radio loudness distribution of quasars by modeling their radio emission and various selection effects using a Monte Carlo approach. The existence of two physically distinct quasar populations, the radio-loud and radio-quiet quasars, is controversial and over the last decade a bimodal distribution of radio loudness of quasars has been both affirmed and disputed. We model the quasar radio luminosity distribution with simple unimodal and bimodal distribution functions. The resulting simulated samples are compared to a fiducial sample of 8300 quasars drawn from the SDSS DR7 Quasar Catalog and combined with radio observations from the FIRST survey. Our results indicate that the SDSS-FIRST sample is best described by a radio loudness distribution which consists of two components, with (12 ± 1)% of sources in the radio-loud component. On the other hand, the evidence for a local minimum in the loudness distribution (bimodality) is not strong and we find that previous claims for its existence were probably affected by the incompleteness of the FIRST survey close to its faint limit. We also investigate the redshift and luminosity dependence of the radio loudness distribution and find tentative evidence that at high redshift radio-loud quasars were rarer, on average louder, and exhibited a smaller range in radio loudness. In agreement with other recent work, we conclude that the SDSS-FIRST sample strongly suggests that the radio loudness distribution of quasars is not a universal function, and that more complex models than presented here are needed to fully explain available observations.

A DESCRIPTION OF QUASAR VARIABILITY MEASURED USING REPEATED SDSS AND POSS IMAGING

International Nuclear Information System (INIS)

MacLeod, Chelsea L.; Ivezić, Željko; Becker, Andrew C.; Anderson, Scott F.; Sesar, Branimir; De Vries, Wim; Kochanek, Christopher S.; Kelly, Brandon C.; Lupton, Robert H.; Hall, Patrick B.; Richards, Gordon T.; Schneider, Donald P.

2012-01-01

We provide a quantitative description and statistical interpretation of the optical continuum variability of quasars. The Sloan Digital Sky Survey (SDSS) has obtained repeated imaging in five UV-to-IR photometric bands for 33,881 spectroscopically confirmed quasars. About 10,000 quasars have an average of 60 observations in each band obtained over a decade along Stripe 82 (S82), whereas the remaining ∼25,000 have 2-3 observations due to scan overlaps. The observed time lags span the range from a day to almost 10 years, and constrain quasar variability at rest-frame time lags of up to 4 years, and at rest-frame wavelengths from 1000 Å to 6000 Å. We publicly release a user-friendly catalog of quasars from the SDSS Data Release 7 that have been observed at least twice in SDSS or once in both SDSS and the Palomar Observatory Sky Survey, and we use it to analyze the ensemble properties of quasar variability. Based on a damped random walk (DRW) model defined by a characteristic timescale and an asymptotic variability amplitude that scale with the luminosity, black hole mass, and rest wavelength for individual quasars calibrated in S82, we can fully explain the ensemble variability statistics of the non-S82 quasars such as the exponential distribution of large magnitude changes. All available data are consistent with the DRW model as a viable description of the optical continuum variability of quasars on timescales of ∼5-2000 days in the rest frame. We use these models to predict the incidence of quasar contamination in transient surveys such as those from the Palomar Transient Factory and Large Synoptic Survey Telescope.

THE STRUCTURE AND LINEAR POLARIZATION OF THE KILOPARSEC-SCALE JET OF THE QUASAR 3C 345

Energy Technology Data Exchange (ETDEWEB)

Roberts, David H.; Wardle, John F. C.; Marchenko, Valerie V., E-mail: roberts@brandeis.edu [Department of Physics MS-057, Brandeis University, Waltham, MA 02454-0911 (United States)

2013-02-01

Deep Very Large Array imaging of the quasar 3C 345 at 4.86 and 8.44 GHz has been used to study the structure and linear polarization of its radio jet on scales ranging from 2 to 30 kpc. There is a 7-8 Jy unresolved core with spectral index {alpha} {approx_equal} -0.24 (I{sub {nu}}{proportional_to}{nu}{sup {alpha}}). The jet (typical intensity 15 mJy beam{sup -1}) consists of a 2.''5 straight section containing two knots, and two additional non-co-linear knots at the end. The jet's total projected length is about 27 kpc. The spectral index of the jet varies over -1.1 {approx}< {alpha} {approx}< -0.5. The jet diverges with a semi-opening angle of about 9 Degree-Sign , and is nearly constant in integrated brightness over its length. A faint feature northeast of the core does not appear to be a true counter-jet, but rather an extended lobe of this FR-II radio source seen in projection. The absence of a counter-jet is sufficient to place modest constraints on the speed of the jet on these scales, requiring {beta} {approx}> 0.5. Despite the indication of jet precession in the total intensity structure, the polarization images suggest instead a jet re-directed at least twice by collisions with the external medium. Surprisingly, the electric vector position angles in the main body of the jet are neither longitudinal nor transverse, but make an angle of about 55 Degree-Sign with the jet axis in the middle while along the edges the vectors are transverse, suggesting a helical magnetic field. There is no significant Faraday rotation in the source, so that is not the cause of the twist. The fractional polarization in the jet averages 25% and is higher at the edges. In a companion paper, Roberts and Wardle show that differential Doppler boosting in a diverging relativistic velocity field can explain the electric vector pattern in the jet.

The FIRST-2MASS Red Quasar Survey

International Nuclear Information System (INIS)

Glikman, E; Helfand, D J; White, R L; Becker, R H; Gregg, M D; Lacy, M

2007-01-01

Combining radio observations with optical and infrared color selection--demonstrated in our pilot study to be an efficient selection algorithm for finding red quasars--we have obtained optical and infrared spectroscopy for 120 objects in a complete sample of 156 candidates from a sky area of 2716 square degrees. Consistent with our initial results, we find our selection criteria--J-K > 1.7,R-K > 4.0--yield a ∼ 50% success rate for discovering quasars substantially redder than those found in optical surveys. Comparison with UVX- and optical color-selected samples shows that ∼> 10% of the quasars are missed in a magnitude-limited survey. Simultaneous two-frequency radio observations for part of the sample indicate that a synchrotron continuum component is ruled out as a significant contributor to reddening the quasars spectra. We go on to estimate extinctions for our objects assuming their red colors are caused by dust. Continuum fits and Balmer decrements suggest E(B-V) values ranging from near zero to 2.5 magnitudes. Correcting the K-band magnitudes for these extinctions, we find that for K (le) 14.0, red quasars make up between 25% and 60% of the underlying quasar population; owing to the incompleteness of the 2MASS survey at fainter K-band magnitudes, we can only set a lower limit to the radio-detected red quasar population of > 20-30%

Dust reddened quasars in first and UKIDSS: Beyond the tip of the iceberg

Energy Technology Data Exchange (ETDEWEB)

Glikman, Eilat [Department of Physics, Middlebury College, Middlebury, VT 05753 (United States); Urrutia, Tanya [Leibniz Institut fr Astrophysik, An der Sternwarte 16, D-14482 Potsdam (Germany); Lacy, Mark [National Radio Astronomy Observatory, Charlottesville, VA (United States); Djorgovski, S. G.; Mahabal, Ashish; Graham, Matthew [California Institute of Technology, Pasadena, CA 91125 (United States); Urry, Meg [Department of Physics and Yale Center for Astronomy and Astrophysics, Yale University, P.O. Box 208121, New Haven, CT 06520-8121 (United States); Croom, Scott [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Ge, Jian, E-mail: eglikman@middlebury.edu [Astronomy Department, University of Florida, 211 Bryant Space Science Center, P.O. Box 112055, Gainesville, FL 32611 (United States)

2013-12-01

We present the results of a pilot survey to find dust-reddened quasars by matching the Faint Images of the Radio Sky at Twenty-Centimeters (FIRST) radio catalog to the UKIDSS near-infrared survey and using optical data from Sloan Digital Sky Survey to select objects with very red colors. The deep K-band limit provided by UKIDSS allows for finding more heavily reddened quasars at higher redshifts as compared with previous work using FIRST and Two Micron All Sky Survey (2MASS). We selected 87 candidates with K ≤ 17.0 from the UKIDSS Large Area Survey (LAS) First Data Release (DR1), which covers 190 deg{sup 2}. These candidates reach up to ∼1.5 mag below the 2MASS limit and obey the color criteria developed to identify dust-reddened quasars. We have obtained 61 spectroscopic observations in the optical and/or near-infrared, as well as classifications in the literature, and have identified 14 reddened quasars with E(B – V) > 0.1, including 3 at z > 2. We study the infrared properties of the sample using photometry from the Wide-Field Infrared Survey Explorer and find that infrared colors improve the efficiency of red quasar selection, removing many contaminants in an infrared-to-optical color-selected sample alone. The highest-redshift quasars (z ≳ 2) are only moderately reddened, with E(B – V) ∼ 0.2-0.3. We find that the surface density of red quasars rises sharply with faintness, comprising up to 17% of blue quasars at the same apparent K-band flux limit. We estimate that to reach more heavily reddened quasars (i.e., E(B – V) ≳ 0.5) at z > 2 and a depth of K = 17, we would need to survey at least ∼2.5 times more area.

THE X-RAY PROPERTIES OF THE OPTICALLY BRIGHTEST MINI-BAL QUASARS FROM THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

Wu Jianfeng; Brandt, W. N.; Comins, M. L.; Garmire, Gordon P.; Schneider, Donald P.; Gibson, Robert R.; Shemmer, Ohad

2010-01-01

We have compiled a sample of 14 of the optically brightest radio-quiet quasars (m i ≤ 17.5 and z ≥ 1.9) in the Sloan Digital Sky Survey Data Release 5 quasar catalog that have C IV mini-broad absorption lines (mini-BALs) present in their spectra. X-ray data for 12 of the objects were obtained via a Chandra snapshot survey using ACIS-S, while data for the other two quasars were obtained from archival XMM-Newton observations. Joint X-ray spectral analysis shows that the mini-BAL quasars have a similar average power-law photon index (Γ ∼ 1.9) and level of intrinsic absorption (N H ∼ 21 cm -2 ) as non-BMB (neither BAL nor mini-BAL) quasars. Mini-BAL quasars are more similar to non-BMB quasars than to BAL quasars in their distribution of relative X-ray brightness (assessed with Δα ox ). Relative colors indicate mild dust reddening in the optical spectra of mini-BAL quasars. Significant correlations between Δα ox and UV absorption properties are confirmed for a sample of 56 sources combining mini-BAL and BAL quasars with high signal-to-noise ratio rest-frame UV spectra, which generally supports models in which X-ray absorption is important in enabling driving of the UV absorption-line wind. We also propose alternative parameterizations of the UV absorption properties of mini-BAL and BAL quasars, which may better describe the broad absorption troughs in some respects.

Influence of Spatial and Chromatic Noise on Luminance Discrimination.

Science.gov (United States)

Miquilini, Leticia; Walker, Natalie A; Odigie, Erika A; Guimarães, Diego Leite; Salomão, Railson Cruz; Lacerda, Eliza Maria Costa Brito; Cortes, Maria Izabel Tentes; de Lima Silveira, Luiz Carlos; Fitzgerald, Malinda E C; Ventura, Dora Fix; Souza, Givago Silva

2017-12-05

Pseudoisochromatic figures are designed to base discrimination of a chromatic target from a background solely on the chromatic differences. This is accomplished by the introduction of luminance and spatial noise thereby eliminating these two dimensions as cues. The inverse rationale could also be applied to luminance discrimination, if spatial and chromatic noise are used to mask those cues. In this current study estimate of luminance contrast thresholds were conducted using a novel stimulus, based on the use of chromatic and spatial noise to mask the use of these cues in a luminance discrimination task. This was accomplished by presenting stimuli composed of a mosaic of circles colored randomly. A Landolt-C target differed from the background only by the luminance. The luminance contrast thresholds were estimated for different chromatic noise saturation conditions and compared to luminance contrast thresholds estimated using the same target in a non-mosaic stimulus. Moreover, the influence of the chromatic content in the noise on the luminance contrast threshold was also investigated. Luminance contrast threshold was dependent on the chromaticity noise strength. It was 10-fold higher than thresholds estimated from non-mosaic stimulus, but they were independent of colour space location in which the noise was modulated. The present study introduces a new method to investigate luminance vision intended for both basic science and clinical applications.

Extreme Variability Quasars from the Sloan Digital Sky Survey and the Dark Energy Survey

Energy Technology Data Exchange (ETDEWEB)

Rumbaugh, N.; Shen, Yue; Morganson, Eric; Liu, Xin; Banerji, M.; McMahon, R. G.; Abdalla, F. B.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Buckley-Geer, E.; Capozzi, D.; Carnero Rosell, A.; Carrasco Kind, M.; Carretero, J.; Cunha, C. E.; D’Andrea, C. B.; da Costa, L. N.; DePoy, D. L.; Desai, S.; Doel, P.; Frieman, J.; García-Bellido, J.; Gruen, D.; Gruendl, R. A.; Gschwend, J.; Gutierrez, G.; Honscheid, K.; James, D. J.; Kuehn, K.; Kuhlmann, S.; Kuropatkin, N.; Lima, M.; Maia, M. A. G.; Marshall, J. L.; Martini, P.; Menanteau, F.; Plazas, A. A.; Reil, K.; Roodman, A.; Sanchez, E.; Scarpine, V.; Schindler, R.; Schubnell, M.; Sheldon, E.; Smith, M.; Soares-Santos, M.; Sobreira, F.; Suchyta, E.; Swanson, M. E. C.; Walker, A. R.; Wester, W.

2018-02-20

We perform a systematic search for long-term extreme variability quasars (EVQs) in the overlapping Sloan Digital Sky Survey (SDSS) and 3-Year Dark Energy Survey (DES) imaging, which provide light curves spanning more than 15 years. We identified ~1000 EVQs with a maximum g band magnitude change of more than 1 mag over this period, about 10% of all quasars searched. The EVQs have L_bol~10^45-10^47 erg/s and L/L_Edd~0.01-1. Accounting for selection effects, we estimate an intrinsic EVQ fraction of ~30-50% among all g<~22 quasars over a baseline of ~15 years. These EVQs are good candidates for so-called "changing-look quasars", where a spectral transition between the two types of quasars (broad-line and narrow-line) is observed between the dim and bright states. We performed detailed multi-wavelength, spectral and variability analyses for the EVQs and compared to their parent quasar sample. We found that EVQs are distinct from a control sample of quasars matched in redshift and optical luminosity: (1) their UV broad emission lines have larger equivalent widths; (2) their Eddington ratios are systematically lower; and (3) they are more variable on all timescales. The intrinsic difference in quasar properties for EVQs suggest that internal processes associated with accretion are the main driver for the observed extreme long-term variability. However, despite their different properties, EVQs seem to be in the tail of a continuous distribution of quasar properties, rather than standing out as a distinct population. We speculate that EVQs are normal quasars accreting at relatively low accretion rates, where the accretion flow is more likely to experience instabilities that drive the factor of few changes in flux on multi-year timescales.

Cross-Correlations in Quasar Radio Emission

Science.gov (United States)

Nefedyev, Yuri; Panischev, Oleg; Demin, Sergey

The main factors forming the complex evolution of the accretive astrophysical systems are nonlinearity, intermittency, nonstationarity and also collective phenomena. To discover the dynamic processes in these objects and to detain understanding their properties we need to use all the applicable analyzing methods. Here we use the Flicker-Noise Spectroscopy (FNS) as a phenomenological approach to analyzing and parameterizing the auto- and cross-correlations in time series of astrophysical objects dynamics. As an example we consider the quasar flux radio spectral density at frequencies 2.7 GHz and 8.1 GHz. Data have been observed by Dr. N. Tanizuka (Laboratory for Complex Systems Analysis, Osaka Prefecture University) in a period of 1979 to 1988 (3 309 days). According to mental habits quasar is a very energetic and distant active galactic nucleus containing a supermassive black hole by size 10-10,000 times the Schwarzschild radius. The quasar is powered by an accretion disc around the black hole. The accretion disc material layers, moving around the black hole, are under the influence of gravitational and frictional forces. It results in raising the high temperature and arising the resonant and collective phenomena reflected in quasar emission dynamics. Radio emission dynamics of the quasar 0215p015 is characterized by three quasi-periodic processes, which are prevalent in considering dynamics. By contrast the 1641p399's emission dynamics have not any distinguish processes. It means the presence of high intermittency in accretive modes. The second difference moment allows comparing the degree of manifesting of resonant and chaotic components in initial time series of the quasar radio emission. The comparative analysis shows the dominating of chaotic part of 1641p399's dynamics whereas the radio emission of 0215p015 has the predominance of resonant component. Analyzing the collective features of the quasar radio emission intensity demonstrates the significant

Spectroscopy of the fuzz associated with four quasars

International Nuclear Information System (INIS)

Balick, B.; Heckman, T.M.

1983-01-01

The spectroscopic properties of the ''fuzz'' near four quasars are consistent with starlight in a galactic environment at essentially the same redshift as the quasar. Apparently, then, the same processes that determine the redshifts of galaxies also determine the redshifts of quasars

Manifestations of a cosmological density of compact objects in quasar light

International Nuclear Information System (INIS)

Canizares, C.R.

1982-01-01

The gravitational lens effects of a cosmological density of compact objects with masses in the range 0.01 0 and quasar redshift. Comparison of the expected manifestations with a variety of quasar data suggests that the density of compact objects in the 0.01--10 5 M/sub sun/ range is not sufficient to close the universe if quasar continuum emission comes from a region -3 pc. This would exclude nuclear burning stars and their remnants. This conclusion is based on several scant and heterogeneous data sets, but it can be refined and strengthened with further data. As gravitational lensing predicts a minimum scatter in various observed quantities, upper limits to the cosmological density of compact objects are not invalidated by the unknown evolution of intrinsic quasar properties

Microlensing of quasar ultraviolet iron emission

Energy Technology Data Exchange (ETDEWEB)

Guerras, E.; Mediavilla, E. [Instituto de Astrofísica de Canarias, Vía Láctea S/N, La Laguna 38200, Tenerife (Spain); Jimenez-Vicente, J. [Departamento de Física Teórica y del Cosmos, Universidad de Granada, Campus de Fuentenueva, 18071 Granada (Spain); Kochanek, C. S. [Department of Astronomy and the Center for Cosmology and Astroparticle Physics, The Ohio State University, 4055 McPherson Lab, 140 West 18th Avenue, Columbus, OH 43221 (United States); Muñoz, J. A. [Departamento de Astronomía y Astrofísica, Universidad de Valencia, 46100 Burjassot, Valencia (Spain); Falco, E. [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Motta, V.; Rojas, K. [Departamento de Física y Astronomía, Universidad de Valparaíso, Avda. Gran Bretaña 1111, Valparaíso (Chile)

2013-12-01

We measure the differential microlensing of the UV Fe II and Fe III emission line blends between 14 quasar image pairs in 13 gravitational lenses. We find that the UV iron emission is strongly microlensed in four cases with amplitudes comparable to that of the continuum. Statistically modeling the magnifications, we infer a typical size of r{sub s}∼4√(M/M{sub ⊙}) light-days for the Fe line-emitting regions, which is comparable to the size of the region generating the UV continuum (∼3-7 light-days). This may indicate that a significant part of the UV Fe II and Fe III emission originates in the quasar accretion disk.

Summary of the workshop on active galaxies and quasars

International Nuclear Information System (INIS)

Weistrop, D.

1981-01-01

The paper reports highlights of discussions carried out at the Tenth Texas Symposium on Relativistic Astrophysics concerning BL Lacertae objects and quasars and their relationship to active galactic nuclei. The discussions considered X-ray, optical and radio observations of active galaxies and quasars showing features which may be interpreted as jets or beams, and X-ray and VLBI observations of core-jet structures exhibiting apparent supraluminal expansion. Attention was also given to the properties of the energy source in the center of the active galaxies and quasars, the nature of quasar emission line regions, the production of the continuum in quasars and active galactic nuclei, and evidence for the association of quasars and BL Lac objects with galaxies

Overdensity of galaxies in the environment of quasar pairs

Science.gov (United States)

Sandrinelli, A.; Falomo, R.; Treves, A.; Scarpa, R.; Uslenghi, M.

2018-03-01

We report on a study of the galaxy environments of low redshift physical quasars pairs. We selected 20 pairs having projected separation Survey images, we evaluated the galaxy overdensity around these quasars in pairs and then compare it with that of a sample of isolated quasars with same redshift and luminosity. It is found that on average there is a systematic larger overdensity of galaxies around quasars in pairs with respect to that of isolated quasars. This may represent a significant link between nuclear activity and galaxy environment. However, at odds with that, the closest quasar pairs seem to inhabit poorer environments. Implications of present results and perspectives for future work are briefly discussed.

THINK OUTSIDE THE COLOR BOX: PROBABILISTIC TARGET SELECTION AND THE SDSS-XDQSO QUASAR TARGETING CATALOG

International Nuclear Information System (INIS)

Bovy, Jo; Hogg, David W.; Weaver, Benjamin A.; Hennawi, Joseph F.; Myers, Adam D.; Kirkpatrick, Jessica A.; Schlegel, David J.; Ross, Nicholas P.; Sheldon, Erin S.; McGreer, Ian D.; Schneider, Donald P.

2011-01-01

We present the SDSS-XDQSO quasar targeting catalog for efficient flux-based quasar target selection down to the faint limit of the Sloan Digital Sky Survey (SDSS) catalog, even at medium redshifts (2.5 ∼ 3.5) quasar probabilities for all 160,904,060 point sources with dereddened i-band magnitude between 17.75 and 22.45 mag in the 14,555 deg 2 of imaging from SDSS Data Release 8. The catalog can be used to define a uniformly selected and efficient low- or medium-redshift quasar survey, such as that needed for the SDSS-III's Baryon Oscillation Spectroscopic Survey project. We show that the XDQSO technique performs as well as the current best photometric quasar-selection technique at low redshift, and outperforms all other flux-based methods for selecting the medium-redshift quasars of our primary interest. We make code to reproduce the XDQSO quasar target selection publicly available.

Think Outside The Color Box: Probabilistic Target Selection And The SDSS-XDQSO Quasar Targeting Catalog

International Nuclear Information System (INIS)

Bovy, J.; Sheldon, E.; Hennawi, J.F.; Hogg, D.W.; Myers, A.D.

2011-01-01

We present the SDSS-XDQSO quasar targeting catalog for efficient flux-based quasar target selection down to the faint limit of the Sloan Digital Sky Survey (SDSS) catalog, even at medium redshifts (2.5 ∼ 3.5) quasar probabilities for all 160,904,060 point sources with dereddened i-band magnitude between 17.75 and 22.45 mag in the 14,555 deg 2 of imaging from SDSS Data Release 8. The catalog can be used to define a uniformly selected and efficient low- or medium-redshift quasar survey, such as that needed for the SDSS-III's Baryon Oscillation Spectroscopic Survey project. We show that the XDQSO technique performs as well as the current best photometric quasar-selection technique at low redshift, and outperforms all other flux-based methods for selecting the medium-redshift quasars of our primary interest. We make code to reproduce the XDQSO quasar target selection publicly available.

Luminous Quasars Do Not Live in Overdense Regions of LBGS at z 4

Science.gov (United States)

Uchiyama, Hisakazu

2017-07-01

We present the cross-correlation between 151 luminous QSOs and 179 protoclustercandidates at z 4 using Hyper Suprime-Cam data. We found that only 2 QSOs reside inregions that are more overdense compared to the average field at > 4σ. The distributionsof the distance between QSOs and the nearest protoclusters and the signicance of theoverdensity at the position of QSOs are statistically identical to those found for LBGs,suggesting that QSOs tend to reside in almost the same environment as LBGs at thisredshift. Using stacking analysis, we found that the average density of LBGs around QSOsis slightly higher than that around LBGs on 1.0-2.5 pMpc scales, while at anti-correlated with overdensity. These findings are consistentwith a scenario in which the average QSO at z 4 resides in structures that are lessmassive than those expected for the progenitors of today's rich clusters, and possibly thatluminous QSOs may be suppressing star formation in their close vicinity.

Multi-Frequency VLBA Polarimetry and the Twin-Jet Quasar 0850+581

Directory of Open Access Journals (Sweden)

Evgeniya Kravchenko

2017-11-01

Full Text Available We present the first multi-frequency VLBA study of the quasar 0850+581 which appears to have a two-sided relativistic jet. Apparent velocity in the approaching jet changes from 3.4c to 7c with the separation from the core. The jet-to-counter-jet ratio of about 5 and apparent superluminal velocities suggest that the observing angle of the inner jet is ≤ 17 ∘ . It is likely that this orientation significantly changes downstream due to an interaction of the jet with the surrounding medium; signs of this are seen in polarization. A dense inhomogeneous Faraday screen is detected in the innermost regions of this quasar. We suggest that there is a presence of ionized gas in its nucleus, which might be responsible for the free-free absorption of the synchrotron emission in the jet and counter-jet at frequencies below 8.4 GHz. The experiment makes use of slowly varying instrumental polarisation factors (polarization leakage or D-terms in time. We report application of the “D-term connection” technique for the calibration of an absolute orientation of electric vector position angle (EVPA observed by VLBA at 4.6, 5.0, 8.1, 8.4, 15.4, 22.3, and 43.3 GHz bands during the 2007–2011.

VizieR Online Data Catalog: Radio-loud and radio-quiet quasars sample (Gupta+, 2016)

Science.gov (United States)

Gupta, M.; Sikora, M.; Nalewajko, K.

2017-11-01

We performed matching of the FR II quasar sample of van Velzen et al. (2015, Cat. J/MNRAS/446/2985) (1108 sources) with the SDSS DR7 quasar catalogue (Schneider et al., 2010AJ....139.2360S, Cat. VII/260) (105 783 sources). We used a matching radius of 5 arcsec and obtained 899 objects. This resulting sample of FR II quasars was then matched with the sample of SDSS DR7 quasars detected by the Wide-field Infrared Survey Explorer (WISE) (Wu et al., 2012, Cat. J/AJ/144/49). This gave us 895 FR II quasars detected in the MIR band. The RQ sample with MIR data is constructed by matching the DR7 quasar catalogue (Schneider et al., 2010AJ....139.2360S, Cat. VII/260) and Wise all-sky catalogue (Wu et al., 2012, Cat. J/AJ/144/49), using a matching radius of 1 arcsec, resulting in 101 853 objects. From these we remove the 899 RL quasars matched with the catalogue by van Velzen et al. (2015, Cat. J/MNRAS/446/2985), this leaves us with 100 958 quasars. We then remove objects that were detected by the FIRST survey (Becker et al. 1995ApJ...450..559B, Cat. VIII/92), this gives us 92 648. We repeat the same process with the NVSS (Condon, Cotton & Broderick, 1998AJ....115.1693C, Cat. VIII/65) and end up with 92 445 objects. We also removed those objects that were outside the FIRST observation region. (2 data files).

Models of the Strongly Lensed Quasar DES J0408-5354

Energy Technology Data Exchange (ETDEWEB)

Agnello, A.; et al.

2017-02-01

We present gravitational lens models of the multiply imaged quasar DES J0408-5354, recently discovered in the Dark Energy Survey (DES) footprint, with the aim of interpreting its remarkable quad-like configuration. We first model the DES single-epoch $grizY$ images as a superposition of a lens galaxy and four point-like objects, obtaining spectral energy distributions (SEDs) and relative positions for the objects. Three of the point sources (A,B,D) have SEDs compatible with the discovery quasar spectra, while the faintest point-like image (G2/C) shows significant reddening and a `grey' dimming of $\\approx0.8$mag. In order to understand the lens configuration, we fit different models to the relative positions of A,B,D. Models with just a single deflector predict a fourth image at the location of G2/C but considerably brighter and bluer. The addition of a small satellite galaxy ($R_{\\rm E}\\approx0.2$") in the lens plane near the position of G2/C suppresses the flux of the fourth image and can explain both the reddening and grey dimming. All models predict a main deflector with Einstein radius between $1.7"$ and $2.0",$ velocity dispersion $267-280$km/s and enclosed mass $\\approx 6\\times10^{11}M_{\\odot},$ even though higher resolution imaging data are needed to break residual degeneracies in model parameters. The longest time-delay (B-A) is estimated as $\\approx 85$ (resp. $\\approx125$) days by models with (resp. without) a perturber near G2/C. The configuration and predicted time-delays of J0408-5354 make it an excellent target for follow-up aimed at understanding the source quasar host galaxy and substructure in the lens, and measuring cosmological parameters. We also discuss some lessons learnt from J0408-5354 on lensed quasar finding strategies, due to its chromaticity and morphology.

PHOTOMETRIC REDSHIFTS AND QUASAR PROBABILITIES FROM A SINGLE, DATA-DRIVEN GENERATIVE MODEL

International Nuclear Information System (INIS)

Bovy, Jo; Hogg, David W.; Weaver, Benjamin A.; Myers, Adam D.; Hennawi, Joseph F.; McMahon, Richard G.; Schiminovich, David; Sheldon, Erin S.; Brinkmann, Jon; Schneider, Donald P.

2012-01-01

We describe a technique for simultaneously classifying and estimating the redshift of quasars. It can separate quasars from stars in arbitrary redshift ranges, estimate full posterior distribution functions for the redshift, and naturally incorporate flux uncertainties, missing data, and multi-wavelength photometry. We build models of quasars in flux-redshift space by applying the extreme deconvolution technique to estimate the underlying density. By integrating this density over redshift, one can obtain quasar flux densities in different redshift ranges. This approach allows for efficient, consistent, and fast classification and photometric redshift estimation. This is achieved by combining the speed obtained by choosing simple analytical forms as the basis of our density model with the flexibility of non-parametric models through the use of many simple components with many parameters. We show that this technique is competitive with the best photometric quasar classification techniques—which are limited to fixed, broad redshift ranges and high signal-to-noise ratio data—and with the best photometric redshift techniques when applied to broadband optical data. We demonstrate that the inclusion of UV and NIR data significantly improves photometric quasar-star separation and essentially resolves all of the redshift degeneracies for quasars inherent to the ugriz filter system, even when included data have a low signal-to-noise ratio. For quasars spectroscopically confirmed by the SDSS 84% and 97% of the objects with Galaxy Evolution Explorer UV and UKIDSS NIR data have photometric redshifts within 0.1 and 0.3, respectively, of the spectroscopic redshift; this amounts to about a factor of three improvement over ugriz-only photometric redshifts. Our code to calculate quasar probabilities and redshift probability distributions is publicly available.

Facile and Low-Temperature Fabrication of Thermochromic Cr2O3/VO2 Smart Coatings: Enhanced Solar Modulation Ability, High Luminous Transmittance and UV-Shielding Function.

Science.gov (United States)

Chang, Tianci; Cao, Xun; Li, Ning; Long, Shiwei; Gao, Xiang; Dedon, Liv R; Sun, Guangyao; Luo, Hongjie; Jin, Ping

2017-08-09

In the pursuit of energy efficient materials, vanadium dioxide (VO 2 ) based smart coatings have gained much attention in recent years. For smart window applications, VO 2 thin films should be fabricated at low temperature to reduce the cost in commercial fabrication and solve compatibility problems. Meanwhile, thermochromic performance with high luminous transmittance and solar modulation ability, as well as effective UV shielding function has become the most important developing strategy for ideal smart windows. In this work, facile Cr 2 O 3 /VO 2 bilayer coatings on quartz glasses were designed and fabricated by magnetron sputtering at low temperatures ranging from 250 to 350 °C as compared with typical high growth temperatures (>450 °C). The bottom Cr 2 O 3 layer not only provides a structural template for the growth of VO 2 (R), but also serves as an antireflection layer for improving the luminous transmittance. It was found that the deposition of Cr 2 O 3 layer resulted in a dramatic enhancement of the solar modulation ability (56.4%) and improvement of luminous transmittance (26.4%) when compared to single-layer VO 2 coating. According to optical measurements, the Cr 2 O 3 /VO 2 bilayer structure exhibits excellent optical performances with an enhanced solar modulation ability (ΔT sol = 12.2%) and a high luminous transmittance (T lum,lt = 46.0%), which makes a good balance between ΔT sol and T lum for smart windows applications. As for UV-shielding properties, more than 95.8% UV radiation (250-400 nm) can be blocked out by the Cr 2 O 3 /VO 2 structure. In addition, the visualized energy-efficient effect was modeled by heating a beaker of water using infrared imaging method with/without a Cr 2 O 3 /VO 2 coating glass.

Dust in the Quasar Wind (Artist Concept)

Science.gov (United States)

2007-01-01

Dusty grains -- including tiny specks of the minerals found in the gemstones peridot, sapphires and rubies -- can be seen blowing in the winds of a quasar, or active black hole, in this artist's concept. The quasar is at the center of a distant galaxy. Astronomers using NASA's Spitzer Space Telescope found evidence that such quasar winds might have forged these dusty particles in the very early universe. The findings are another clue in an ongoing cosmic mystery: where did all the dust in our young universe come from? Dust is crucial for efficient star formation as it allows the giant clouds where stars are born to cool quickly and collapse into new stars. Once a star has formed, dust is also needed to make planets and living creatures. Dust has been seen as far back as when the universe was less than a tenth of its current age, but how did it get there? Most dust in our current epoch forms in the winds of evolved stars that did not exist when the universe was young. Theorists had predicted that winds from quasars growing in the centers of distant galaxies might be a source of this dust. While the environment close to a quasar is too hot for large molecules like dust grains to survive, dust has been found in the cooler, outer regions. Astronomers now have evidence that dust is created in these outer winds. Using Spitzer's infrared spectrograph instrument, scientists found a wealth of dust grains in a quasar called PG2112+059 located at the center of a galaxy 8 billion light-years away. The grains - including corundum (sapphires and rubies); forsterite (peridot); and periclase (naturally occurring in marble) - are not typically found in galaxies without quasars, suggesting they might have been freshly formed in the quasar's winds.

Black hole mass estimates and emission-line properties of a sample of redshift z > 6.5 quasars

Energy Technology Data Exchange (ETDEWEB)

De Rosa, Gisella; Peterson, Bradley M.; Frank, Stephan [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Venemans, Bram P.; Decarli, Roberto; Walter, Fabian [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Gennaro, Mario [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Simcoe, Robert A. [MIT-Kavli Center for Astrophysics and Space Research, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Dietrich, Matthias [Department of Physics and Astronomy, Ohio University, Clippinger Lab 251B, Athens, OH 45701 (United States); McMahon, Richard G.; Hewett, Paul C. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Mortlock, Daniel J. [Astrophysics Group, Imperial College London, Blackett Laboratory, Prince Consort Road, London, SW7 2AZ (United Kingdom); Simpson, Chris [Astrophysics Research Institute, Liverpool John Moores University, Liverpool Science Park, 146 Brownlow Hill, Liverpool L3 5RF (United Kingdom)

2014-08-01

We present the analysis of optical and near-infrared spectra of the only four z > 6.5 quasars known to date, discovered in the UKIDSS-LAS and VISTA-VIKING surveys. Our data set consists of new Very Large Telescope/X-Shooter and Magellan/FIRE observations. These are the best optical/NIR spectroscopic data that are likely to be obtained for the z > 6.5 sample using current 6-10 m facilities. We estimate the black hole (BH) mass, the Eddington ratio, and the Si IV/C IV, C III]/C IV, and Fe II/Mg II emission-line flux ratios. We perform spectral modeling using a procedure that allows us to derive a probability distribution for the continuum components and to obtain the quasar properties weighted upon the underlying distribution of continuum models. The z > 6.5 quasars show the same emission properties as their counterparts at lower redshifts. The z > 6.5 quasars host BHs with masses of ∼10{sup 9} M{sub ☉} that are accreting close to the Eddington luminosity ((log(L{sub Bol}/L{sub Edd})) = –0.4 ± 0.2), in agreement with what has been observed for a sample of 4.0 < z < 6.5 quasars. By comparing the Si IV/C IV and C III]/C IV flux ratios with the results obtained from luminosity-matched samples at z ∼ 6 and 2 ≤ z ≤ 4.5, we find no evidence of evolution of the line ratios with cosmic time. We compare the measured Fe II/Mg II flux ratios with those obtained for a sample of 4.0 < z < 6.4 sources. The two samples are analyzed using a consistent procedure. There is no evidence that the Fe II/Mg II flux ratio evolves between z = 7 and z = 4. Under the assumption that the Fe II/Mg II traces the Fe/Mg abundance ratio, this implies the presence of major episodes of chemical enrichment in the quasar hosts in the first ∼0.8 Gyr after the Big Bang.

Quasar-Lyman α forest cross-correlation from BOSS DR11: Baryon Acoustic Oscillations

Energy Technology Data Exchange (ETDEWEB)

Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Kirkby, David; Blomqvist, Michael [Department of Physics and Astronomy, University of California, 4129 Frederick Reines Hall, Irvine, CA, 92697 (United States); Busca, Nicolas; Aubourg, Éric; Bautista, Julian [APC, Université Paris Diderot-Paris 7, CNRS/IN2P3, CEA, Observatoire de Paris, 10, rue A. Domon and L. Duquet, Paris (France); Miralda-Escudé, Jordi [Institut de Ciències del Cosmos (IEEC/UB), Martí i Franquès 1, Barcelona, 08028 Catalonia (Spain); Ross, Nicholas P.; Bailey, Stephen; Beutler, Florian; Carithers, Bill [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA (United States); Slosar, Anže [Brookhaven National Laboratory, Blgd 510, Upton, NY, 11375 (United States); Rich, James; Delubac, Timothée [CEA, Centre de Saclay, IRFU, Gif-sur-Yvette, 91191 France (France); Bhardwaj, Vaishali; Bizyaev, Dmitry [Department of Astronomy, University of Washington, Box 351580, Seattle, WA, 98195 (United States); Brewington, Howard; Brinkmann, Jon [Apache Point Observatory and New Mexico State University, P.O. Box 59, Sunspot, NM, 88349-0059 (United States); Brownstein, Joel R.; Dawson, Kyle S., E-mail: font@physik.uzh.ch [Department of Physics and Astronomy, University of Utah, 115 S 1400 E, Salt Lake City, UT, 84112 (United States); and others

2014-05-01

We measure the large-scale cross-correlation of quasars with the Lyα forest absorption, using over 164,000 quasars from Data Release 11 of the SDSS-III Baryon Oscillation Spectroscopic Survey. We extend the previous study of roughly 60,000 quasars from Data Release 9 to larger separations, allowing a measurement of the Baryonic Acoustic Oscillation (BAO) scale along the line of sight c/(H(z = 2.36)r{sub s}) = 9.0±0.3 and across the line of sight D{sub A}(z = 2.36)/r{sub s} = 10.8±0.4, consistent with CMB and other BAO data. Using the best fit value of the sound horizon from Planck data (r{sub s} = 147.49 Mpc), we can translate these results to a measurement of the Hubble parameter of H(z = 2.36) = 226±8 km s{sup −1} Mpc{sup −1} and of the angular diameter distance of D{sub A}(z = 2.36) = 1590±60 Mpc. The measured cross-correlation function and an update of the code to fit the BAO scale (baofit) are made publicly available.

Discovery of a bright quasar without a massive host galaxy.

Science.gov (United States)

Magain, Pierre; Letawe, Géraldine; Courbin, Frédéric; Jablonka, Pascale; Jahnke, Knud; Meylan, Georges; Wisotzki, Lutz

2005-09-15

A quasar is thought to be powered by the infall of matter onto a supermassive black hole at the centre of a massive galaxy. Because the optical luminosity of quasars exceeds that of their host galaxy, disentangling the two components can be difficult. This led in the 1990s to the controversial claim of the discovery of 'naked' quasars. Since then, the connection between quasars and galaxies has been well established. Here we report the discovery of a quasar lying at the edge of a gas cloud, whose size is comparable to that of a small galaxy, but whose spectrum shows no evidence for stars. The gas in the cloud is excited by the quasar itself. If a host galaxy is present, it is at least six times fainter than would normally be expected for such a bright quasar. The quasar is interacting dynamically with a neighbouring galaxy, whose gas might be feeding the black hole.

Discovery of two gravitationally lensed quasars with image separations of 3 arcseconds from the Sloan Digital Sky Survey

Energy Technology Data Exchange (ETDEWEB)

Oguri, Masamune; Inada, Naohisa; Hennawi, Joseph F.; Richards, Gordon T.; Johnston, David E.; Frieman, Joshua A.; Pindor, Bartosz; Strauss, Michael A.; Brunner, Robert; Becker, Robert H.; Castander, Francisco J.; Gregg, Michael D.; Hall, Patrick B.; Rix, Hans-Walter; Schneider, Donald P.; Bahcall, Neta A.; Brinkmann, Jonathan; York, Donald G.

2004-11-01

We report the discovery of two doubly-imaged quasars, SDSS J100128.61+502756.9 and SDSS J120629.65+433217.6, at redshifts of 1.838 and 1.789 and with image separations of 2.86'' and 2.90'', respectively. The objects were selected as lens candidates from the Sloan Digital Sky Survey (SDSS). Based on the identical nature of the spectra of the two quasars in each pair and the identification of the lens galaxies, we conclude that the objects are gravitational lenses. The lenses are complicated; in both systems there are several galaxies in the fields very close to the quasars, in addition to the lens galaxies themselves. The lens modeling implies that these nearby galaxies contribute significantly to the lens potentials. On larger scales, we have detected an enhancement in the galaxy density near SDSS J100128.61+502756.9. The number of lenses with image separation of {approx} 3'' in the SDSS already exceeds the prediction of simple theoretical models based on the standard Lambda-dominated cosmology and observed velocity function of galaxies.

VLBI observations of the quasars CTD20 (0234+285), OJ248 (0827+243), and 4C19.44 (1354+195), and the millimeter-x-ray connection

International Nuclear Information System (INIS)

Marscher, A.P.; Broderick, J.J.

1983-01-01

We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray

One millimeter continuum observations of high redshift quasars

International Nuclear Information System (INIS)

Ennis, D.J.; Soifer, B.T.

1981-01-01

Upper limits to the one-millimeter continuum flux densities of the high redshift quasars B2 1225 + 31, Ton 490, and PHL 957 are presented. The upper limit to the power observed from these quasars at 1 mm is, on the average, one half of the observed power in the continuum at L-alpha. These observations are used to constrain the temperature of a hypothetical dust shell which reddens the quasar line and continuum emission by an extinction optical depth sufficient to account for the anomalously low L-alpha/H-alpha emission line ratio observed in each of these quasars. For the quasars studied, dust shell temperatures between 25 K and 50 to 95 K are prohibited by the present data. A dust shell at a temperature within this span reradiating all the power absorbed from the quasar ultraviolet continuum would produce a one-millimeter flux density greater than the measured upper limit. The average radius of the model dust shell cannot be between 70 kpc and 1 Mpc

QUASAR CLUSTERING FROM SDSS DR5: DEPENDENCES ON PHYSICAL PROPERTIES

International Nuclear Information System (INIS)

Shen Yue; Strauss, Michael A.; Lin, Yen-Ting; Bahcall, Neta A.; Ross, Nicholas P.; Schneider, Donald P.; Vanden Berk, Daniel E.; Hall, Patrick B.; Richards, Gordon T.; Weinberg, David H.; Shankar, Francesco; Connolly, Andrew J.; Fan Xiaohui; Hennawi, Joseph F.; Brunner, Robert J.

2009-01-01

Using a homogenous sample of 38,208 quasars with a sky coverage of ∼4000 deg. 2 drawn from the Sloan Digital Sky Survey Data Release Five quasar catalog, we study the dependence of quasar clustering on luminosity, virial black hole (BH) mass, quasar color, and radio loudness. At z 13 h -1 M sun , compared to ∼2 x 10 12 h -1 M sun for radio-quiet quasar hosts at z ∼ 1.5.

The large-scale quasar-Lyman α forest cross-correlation from BOSS

Energy Technology Data Exchange (ETDEWEB)

Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Arnau, Eduard [Institut de Ciències del Cosmos (IEEC/UB), Martí i Franquès 1, 08028 Barcelona, Catalonia (Spain); Miralda-Escudé, Jordi, E-mail: font@physik.uzh.ch, E-mail: edu.arnau.lazaro@gmail.com, E-mail: miralda@icc.ub.edu [Institució Catalana de Recerca i Estudis Avançats, Passeig Lluís Companys 23, 08010 Barcelona, Catalonia (Spain); and others

2013-05-01

We measure the large-scale cross-correlation of quasars with the Lyα forest absorption in redshift space, using ∼ 60000 quasar spectra from Data Release 9 (DR9) of the Baryon Oscillation Spectroscopic Survey (BOSS). The cross-correlation is detected over a wide range of scales, up to comoving separations r of 80 h{sup −1}Mpc. For r > 15 h{sup −1}Mpc, we show that the cross-correlation is well fitted by the linear theory prediction for the mean overdensity around a quasar host halo in the standard ΛCDM model, with the redshift distortions indicative of gravitational evolution detected at high confidence. Using previous determinations of the Lyα forest bias factor obtained from the Lyα autocorrelation, we infer the quasar bias factor to be b{sub q} = 3.64{sup +0.13}{sub −0.15} at a mean redshift z = 2.38, in agreement with previous measurements from the quasar auto-correlation. We also obtain a new estimate of the Lyα forest redshift distortion factor, β{sub F} = 1.1±0.15, slightly larger than but consistent with the previous measurement from the Lyα forest autocorrelation. The simple linear model we use fails at separations r < 15h{sup −1}Mpc, and we show that this may reasonably be due to the enhanced ionization due to radiation from the quasars. We also provide the expected correction that the mass overdensity around the quasar implies for measurements of the ionizing radiation background from the line-of-sight proximity effect.

The large-scale quasar-Lyman α forest cross-correlation from BOSS

International Nuclear Information System (INIS)

Font-Ribera, Andreu; Arnau, Eduard; Miralda-Escudé, Jordi

2013-01-01

We measure the large-scale cross-correlation of quasars with the Lyα forest absorption in redshift space, using ∼ 60000 quasar spectra from Data Release 9 (DR9) of the Baryon Oscillation Spectroscopic Survey (BOSS). The cross-correlation is detected over a wide range of scales, up to comoving separations r of 80 h −1 Mpc. For r > 15 h −1 Mpc, we show that the cross-correlation is well fitted by the linear theory prediction for the mean overdensity around a quasar host halo in the standard ΛCDM model, with the redshift distortions indicative of gravitational evolution detected at high confidence. Using previous determinations of the Lyα forest bias factor obtained from the Lyα autocorrelation, we infer the quasar bias factor to be b q = 3.64 +0.13 −0.15 at a mean redshift z = 2.38, in agreement with previous measurements from the quasar auto-correlation. We also obtain a new estimate of the Lyα forest redshift distortion factor, β F = 1.1±0.15, slightly larger than but consistent with the previous measurement from the Lyα forest autocorrelation. The simple linear model we use fails at separations r −1 Mpc, and we show that this may reasonably be due to the enhanced ionization due to radiation from the quasars. We also provide the expected correction that the mass overdensity around the quasar implies for measurements of the ionizing radiation background from the line-of-sight proximity effect

Connecting the Interstellar Gas and Dust Properties in Distant Galaxies Using Quasar Absorption Systems

Science.gov (United States)

Aller, Monique C.; Dwek, Eliahu; Kulkarni, Varsha P.; York, Donald G.; Welty, Daniel E.; Vladilo, Giovanni; Som, Debopam; Lackey, Kyle; Dwek, Eli; Beiranvand, Nassim;

The Sloan Digital Sky Survey Quasar Catalog: Fourteenth data release

Science.gov (United States)

Pâris, Isabelle; Petitjean, Patrick; Aubourg, Éric; Myers, Adam D.; Streblyanska, Alina; Lyke, Brad W.; Anderson, Scott F.; Armengaud, Éric; Bautista, Julian; Blanton, Michael R.; Blomqvist, Michael; Brinkmann, Jonathan; Brownstein, Joel R.; Brandt, William Nielsen; Burtin, Étienne; Dawson, Kyle; de la Torre, Sylvain; Georgakakis, Antonis; Gil-Marín, Héctor; Green, Paul J.; Hall, Patrick B.; Kneib, Jean-Paul; LaMassa, Stephanie M.; Le Goff, Jean-Marc; MacLeod, Chelsea; Mariappan, Vivek; McGreer, Ian D.; Merloni, Andrea; Noterdaeme, Pasquier; Palanque-Delabrouille, Nathalie; Percival, Will J.; Ross, Ashley J.; Rossi, Graziano; Schneider, Donald P.; Seo, Hee-Jong; Tojeiro, Rita; Weaver, Benjamin A.; Weijmans, Anne-Marie; Yèche, Christophe; Zarrouk, Pauline; Zhao, Gong-Bo

2018-05-01

We present the data release 14 Quasar catalog (DR14Q) from the extended Baryon Oscillation Spectroscopic Survey (eBOSS) of the Sloan Digital Sky Survey IV (SDSS-IV). This catalog includes all SDSS-IV/eBOSS objects that were spectroscopically targeted as quasar candidates and that are confirmed as quasars via a new automated procedure combined with a partial visual inspection of spectra, have luminosities Mi [z = 2] < -20.5 (in a Λ CDM cosmology with H0 = 70 km s-1 Mpc-1, Ω M =0.3, and Ω Λ = 0.7), and either display at least one emission line with a full width at half maximum larger than 500 km s-1 or, if not, have interesting/complex absorption features. The catalog also includes previously spectroscopically-confirmed quasars from SDSS-I, II, and III. The catalog contains 526 356 quasars (144 046 are new discoveries since the beginning of SDSS-IV) detected over 9376 deg2 (2044 deg2 having new spectroscopic data available) with robust identification and redshift measured by a combination of principal component eigenspectra. The catalog is estimated to have about 0.5% contamination. Redshifts are provided for the Mg II emission line. The catalog identifies 21 877 broad absorption line quasars and lists their characteristics. For each object, the catalog presents five-band (u, g, r, i, z) CCD-based photometry with typical accuracy of 0.03 mag. The catalog also contains X-ray, ultraviolet, near-infrared, and radio emission properties of the quasars, when available, from other large-area surveys. The calibrated digital spectra, covering the wavelength region 3610-10 140 Å at a spectral resolution in the range 1300 < R < 2500, can be retrieved from the SDSS Science Archiver Server. http://www.sdss.org/dr14/algorithms/qso_catalog

On The Dark Side of Quasar Evolution

OpenAIRE

Menou, Kristen; Haiman, Zoltan

2004-01-01

Recent improved determinations of the mass density rho_BH of supermassive black holes (SMBHs) in the local universe have allowed accurate comparisons of rho_BH with the amount of light received from past quasar activity. These comparisons support the notion that local SMBHs are ``dead quasars'' and yield a value epsilon >~ 0.1 for the average radiative efficiency of cosmic SMBH accretion. BH coalescences may represent an important component of the quasar mass assembly and yet not produce any ...

VARIATIONS OF ABSORPTION TROUGHS IN THE QUASAR SDSS J125216.58+052737.7

Energy Technology Data Exchange (ETDEWEB)

Chen, Zhi-Fu [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China); Qin, Yi-Ping, E-mail: zhichenfu@126.com [Department of Physics and Telecommunication Engineering, Baise University, Baise 533000 (China)

2015-01-20

In this work, we analyze the spectra of quasar J125216.58+052737.7 (z {sub em} = 1.9035) which was observed by SDSS-I/II on 2003 January 30 and by BOSS on 2011 April 2. Both the continuum and the absorption spectra of this quasar show obvious variations between the two epochs. In the SDSS-I/II spectrum, we detect 8 C IV λλ1548,1551 absorption systems, which are detected at z {sub abs} = 1.9098, 1.8948, 1.8841, 1.8770, 1.8732, 1.8635, 1.8154, and 1.7359, respectively, and one Mg II λλ2796,2803 absorption system at z {sub abs} = 0.9912. Among these absorption systems, two C IV λλ1548,1551 absorption systems at z {sub abs} = 1.9098 and 1.7359 and the Mg II λλ2796,2803 absorption system are imprinted on the BOSS spectrum as well, and have similar absorption strengths when compared to those measured from the SDSS-I/II spectrum. Three C IV λλ1548,1551 absorption systems at z {sub abs} = 1.8948, 1.8841, and 1.8770 are also detected in the BOSS spectrum, while their absorption strengths are much weaker than those measured from the SDSS-I/II spectrum; three systems at z {sub abs} = 1.8732, 1.8635, and 1.8154 disappeared from the BOSS spectrum. Based on the variability analysis, the absorption systems that disappeared and weakened are likely to be intrinsic to the quasar. If these intrinsic absorption gases are blown away from the central region of the quasar, with respect to the quasar system, the absorption systems that disappeared would have separation velocities of 3147 kms{sup –1}, 4161 km s{sup –1}, and 9241 km s{sup –1}, while the absorption systems that weakened would have separation velocities of 900 km s{sup –1}, 2011 km s{sup –1}, and 2751 km s{sup –1}. Well-coordinated variations of the six C IV λλ1548,1551 absorption systems that disappeared and weakened, occurring on a timescale of 1026.7 days at the quasar rest frame, can be interpreted as a result of global changes in the ionization state of the absorbing gas.

A pro-cathepsin L mutant is a luminal substrate for endoplasmic-reticulum-associated degradation in C. elegans.

Directory of Open Access Journals (Sweden)

Mark T Miedel

Full Text Available Endoplasmic-reticulum associated degradation (ERAD is a major cellular misfolded protein disposal pathway that is well conserved from yeast to mammals. In yeast, a mutant of carboxypeptidase Y (CPY* was found to be a luminal ER substrate and has served as a useful marker to help identify modifiers of the ERAD pathway. Due to its ease of genetic manipulation and the ability to conduct a genome wide screen for modifiers of molecular pathways, C. elegans has become one of the preferred metazoans for studying cell biological processes, such as ERAD. However, a marker of ERAD activity comparable to CPY* has not been developed for this model system. We describe a mutant of pro-cathepsin L fused to YFP that no longer targets to the lysosome, but is efficiently eliminated by the ERAD pathway. Using this mutant pro-cathepsin L, we found that components of the mammalian ERAD system that participate in the degradation of ER luminal substrates were conserved in C. elegans. This transgenic line will facilitate high-throughput genetic or pharmacological screens for ERAD modifiers using widefield epifluorescence microscopy.

A ROBUST DETERMINATION OF THE SIZE OF QUASAR ACCRETION DISKS USING GRAVITATIONAL MICROLENSING

International Nuclear Information System (INIS)

Jiménez-Vicente, J.; Mediavilla, E.; Muñoz, J. A.; Kochanek, C. S.

2012-01-01

Using microlensing measurements for a sample of 27 image pairs of 19 lensed quasars we determine a maximum likelihood estimate for the accretion disk size of an average quasar of r s = 4.0 +2.4 –3.1 lt-day at rest frame (λ) = 1736 Å for microlenses with a mean mass of (M) = 0.3 M ☉ . This value, in good agreement with previous results from smaller samples, is roughly a factor of five greater than the predictions of the standard thin disk model. The individual size estimates for the 19 quasars in our sample are also in excellent agreement with the results of the joint maximum likelihood analysis.

Extreme Variability Quasars from the Sloan Digital Sky Survey and the Dark Energy Survey

Science.gov (United States)

Rumbaugh, N.; Shen, Yue; Morganson, Eric; Liu, Xin; Banerji, M.; McMahon, R. G.; Abdalla, F. B.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Buckley-Geer, E.; Capozzi, D.; Carnero Rosell, A.; Carrasco Kind, M.; Carretero, J.; Cunha, C. E.; D’Andrea, C. B.; da Costa, L. N.; DePoy, D. L.; Desai, S.; Doel, P.; Frieman, J.; García-Bellido, J.; Gruen, D.; Gruendl, R. A.; Gschwend, J.; Gutierrez, G.; Honscheid, K.; James, D. J.; Kuehn, K.; Kuhlmann, S.; Kuropatkin, N.; Lima, M.; Maia, M. A. G.; Marshall, J. L.; Martini, P.; Menanteau, F.; Plazas, A. A.; Reil, K.; Roodman, A.; Sanchez, E.; Scarpine, V.; Schindler, R.; Schubnell, M.; Sheldon, E.; Smith, M.; Soares-Santos, M.; Sobreira, F.; Suchyta, E.; Swanson, M. E. C.; Walker, A. R.; Wester, W.; (DES Collaboration

2018-02-01

We perform a systematic search for long-term extreme variability quasars (EVQs) in the overlapping Sloan Digital Sky Survey and 3 Year Dark Energy Survey imaging, which provide light curves spanning more than 15 years. We identified ∼1000 EVQs with a maximum change in g-band magnitude of more than 1 mag over this period, about 10% of all quasars searched. The EVQs have L bol ∼ 1045–1047 erg s‑1 and L/L Edd ∼ 0.01–1. Accounting for selection effects, we estimate an intrinsic EVQ fraction of ∼30%–50% among all g≲ 22 quasars over a baseline of ∼15 yr. We performed detailed multi-wavelength, spectral, and variability analyses for the EVQs and compared them to their parent quasar sample. We found that EVQs are distinct from a control sample of quasars matched in redshift and optical luminosity: (1) their UV broad emission lines have larger equivalent widths; (2) their Eddington ratios are systematically lower; and (3) they are more variable on all timescales. The intrinsic difference in quasar properties for EVQs suggests that internal processes associated with accretion are the main driver for the observed extreme long-term variability. However, despite their different properties, EVQs seem to be in the tail of a continuous distribution of quasar properties, rather than standing out as a distinct population. We speculate that EVQs are normal quasars accreting at relatively low rates, where the accretion flow is more likely to experience instabilities that drive the changes in flux by a factor of a few on multi-year timescales.

SPITZER OBSERVATIONS OF YOUNG RED QUASARS

International Nuclear Information System (INIS)

Urrutia, Tanya; Lacy, Mark; Spoon, Henrik; Glikman, Eilat; Petric, Andreea; Schulz, Bernhard

2012-01-01

We present mid-infrared spectra and photometry of 13 redshift 0.4 < z < 1 dust reddened quasars obtained with Spitzer IRS and MIPS. We compare properties derived from their infrared spectral energy distributions (intrinsic active galactic nucleus (AGN) luminosity and far-infrared luminosity from star formation) to the host luminosities and morphologies from Hubble Space Telescope imaging, and black hole masses estimated from optical and/or near-infrared spectroscopy. Our results are broadly consistent with models in which most dust reddened quasars are an intermediate phase between a merger-driven starburst triggering a completely obscured AGN, and a normal, unreddened quasar. We find that many of our objects have high accretion rates, close to the Eddington limit. These objects tend to fall below the black hole mass-bulge luminosity relation as defined by local galaxies, whereas most of our low accretion rate objects are slightly above the local relation, as typical for normal quasars at these redshifts. Our observations are therefore most readily interpreted in a scenario in which galaxy stellar mass growth occurs first by about a factor of three in each merger/starburst event, followed sometime later by black hole growth by a similar amount. We do not, however, see any direct evidence for quasar feedback affecting star formation in our objects, for example, in the form of a relationship between accretion rate and star formation. Five of our objects, however, do show evidence for outflows in the [O III]5007 Å emission line profile, suggesting that the quasar activity is driving thermal winds in at least some members of our sample.

49 CFR 1580.109 - Preemptive effect.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Preemptive effect. 1580.109 Section 1580.109 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION... Materials Receivers, and Private Cars § 1580.109 Preemptive effect. Under 49 U.S.C. 20106, issuance of the...

The essential signature of a massive starburst in a distant quasar.

Science.gov (United States)

Solomon, P; Vanden Bout, P; Carilli, C; Guelin, M

2003-12-11

Observations of carbon monoxide emission in high-redshift (zeta > 2) galaxies indicate the presence of large amounts of molecular gas. Many of these galaxies contain an active galactic nucleus powered by accretion of gas onto a supermassive black hole, and a key question is whether their extremely high infrared luminosities result from the active galactic nucleus, from bursts of massive star formation (associated with the molecular gas), or both. In the Milky Way, high-mass stars form in the dense cores of interstellar molecular clouds, where gas densities are n(H2) > 10(5) cm(-3) (refs 1, 2). Recent surveys show that virtually all galactic sites of high-mass star formation have similarly high densities. The bulk of the cloud material traced by CO observations, however, is at a much lower density. For galaxies in the local Universe, the HCN molecule is an effective tracer of high-density molecular gas. Here we report observations of HCN emission from the infrared-luminous 'Cloverleaf' quasar (at a redshift zeta = 2.5579). The HCN line luminosity indicates the presence of 10 billion solar masses of very dense gas, an essential feature of an immense starburst, which contributes, together with the active galactic nucleus it harbours, to its high infrared luminosity.

Galaxy correlations at high redshift and the environment of quasars

International Nuclear Information System (INIS)

Phillipps, Steven

1986-01-01

In close line-of-sight pairs of quasars absorption lines may be seen in the spectrum of the further quasar at a redshift corresponding to that of the nearer quasar. This is indicative of the presence of an intervening galaxy belonging to the same cluster as the (galaxy containing the) nearer quasar. The likelihood of this occurring is calculated in terms of the galaxy correlation function and it is found that present results already suggest that quasars at redshifts above one must be associated with rich clusters. (author)

The X-ray emission mechanism of large scale powerful quasar jets: Fermi rules out IC/CMB for 3C 273.

Directory of Open Access Journals (Sweden)

Georganopoulos Markos

2013-12-01

Full Text Available The process responsible for the Chandra-detected X-ray emission from the large-scale jets of powerful quasars is not clear yet. The two main models are inverse Compton scattering off the cosmic microwave background photons (IC/CMB and synchrotron emission from a population of electrons separate from those producing the radio-IR emission. These two models imply radically different conditions in the large scale jet in terms of jet speed, kinetic power, and maximum energy of the particle acceleration mechanism, with important implications for the impact of the jet on the larger-scale environment. Georganopoulos et al. (2006 proposed a diagnostic based on a fundamental difference between these two models: the production of synchrotron X-rays requires multi-TeV electrons, while the EC/CMB model requires a cutoff in the electron energy distribution below TeV energies. This has significant implications for the γ-ray emission predicted by these two models. Here we present new Fermi observations that put an upper limit on the gamma-ray flux from the large-scale jet of 3C 273 that clearly violates the flux expected from the IC/CMB X-ray interpretation found by extrapolation of the UV to X-ray spectrum of knot A, thus ruling out the IC/CMB interpretation entirely for this source. Further, the upper limit from Fermi puts a limit on the Doppler beaming factor of at least δ <9, assuming equipartition fields, and possibly as low as δ <5 assuming no major deceleration of the jet from knots A through D1.

The intrinsic far-UV spectrum of the high-redshift quasar B1422+231

Science.gov (United States)

O'Dowd, M.; Bate, N. F.; Webster, R. L.; Labrie, K.; King, A. L.; Yong, S.-. Y.

2018-02-01

We present new spectroscopy of the z = 3.62 gravitationally lensed quasar B1422+117 from the Gemini North GMOS integral field spectrograph. We observe significant differential magnifications between the broad emission lines and the continuum, as well as across the velocity structure of the Lyman-α line. We take advantage of this differential microlensing to algebraically decompose the quasar spectrum into the absorbed broad emission line and absorbed continuum components. We use the latter to derive the intrinsic Ly α forest absorption spectrum. The proximity effect is clearly detected, with a proximity zone edge of 8.6-17.3 Mpc from the quasar, implying (perhaps intermittent) activity over at least 28 Myr. The Ly α line profile exhibits a blue excess that is inconsistent with a symmetric fit to the unabsorbed red side. This has important implications for the use of this fitting technique in estimating the absorbed blue Ly α wings of Gunn-Peterson trough quasars.

Outflow and hot dust emission in broad absorption line quasars

Energy Technology Data Exchange (ETDEWEB)

Zhang, Shaohua; Zhou, Hongyan [Polar Research Institute of China, 451 Jinqiao Road, Shanghai 200136 (China); Wang, Huiyuan; Wang, Tinggui; Xing, Feijun; Jiang, Peng [Key Laboratory for Research in Galaxies and Cosmology, University of Science and Technology of China, Chinese Academy of Sciences, Hefei, Anhui 230026 (China); Zhang, Kai, E-mail: zhangshaohua@pric.gov.cn, E-mail: whywang@mail.ustc.edu.cn [Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Shanghai 200030 (China)

2014-05-01

We have investigated a sample of 2099 broad absorption line (BAL) quasars with z = 1.7-2.2 built from the Sloan Digital Sky Survey Data Release Seven and the Wide-field Infrared Survey. This sample is collected from two BAL quasar samples in the literature and is refined by our new algorithm. Correlations of outflow velocity and strength with a hot dust indicator (β{sub NIR}) and other quasar physical parameters—such as an Eddington ratio, luminosity, and a UV continuum slope—are explored in order to figure out which parameters drive outflows. Here β{sub NIR} is the near-infrared continuum slope, which is a good indicator of the amount of hot dust emission relative to the accretion disk emission. We confirm previous findings that outflow properties moderately or weakly depend on the Eddington ratio, UV slope, and luminosity. For the first time, we report moderate and significant correlations of outflow strength and velocity with β{sub NIR} in BAL quasars. It is consistent with the behavior of blueshifted broad emission lines in non-BAL quasars. The statistical analysis and composite spectra study both reveal that outflow strength and velocity are more strongly correlated with β{sub NIR} than the Eddington ratio, luminosity, and UV slope. In particular, the composites show that the entire C IV absorption profile shifts blueward and broadens as β{sub NIR} increases, while the Eddington ratio and UV slope only affect the high and low velocity part of outflows, respectively. We discuss several potential processes and suggest that the dusty outflow scenario, i.e., that dust is intrinsic to outflows and may contribute to the outflow acceleration, is most likely.

On the periodicity in the distribution of quasar redshifts

International Nuclear Information System (INIS)

Kjaergaard, P.

1978-01-01

The periodicity in the distribution of quasar redshifts is explained in terms of selection effects. Special attention is drawn to a selection effect caused by the redshift dependent influence of the strong emission lines on the limiting magnitude for detecting quasars. This is especially important since the number of quasars increases with a large factor per magnitude. The limiting magnitude effect applies both to spectroscopic and to UV-excess surveys. It is shown that the redshift distribution of quasars selected by a combination of UV-excess information and agreement between radio and optical position is intermediate between the redshift distribution of the two groups of quasars selected by one of the two criteria. It is also shown that the distribution of redshifts for UV-excess selected quasars is very similar to the variation of the ultrsviolet excess as a function of redshift. This evidence indicates that strong selection effects are in play. (Auth.)

14 CFR 417.109 - Ground safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...

Extreme Variability in a Broad Absorption Line Quasar

Energy Technology Data Exchange (ETDEWEB)

Stern, Daniel; Jun, Hyunsung D. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Mail Stop 169-221, Pasadena, CA 91109 (United States); Graham, Matthew J.; Djorgovski, S. G.; Donalek, Ciro; Drake, Andrew J.; Mahabal, Ashish A.; Steidel, Charles C. [California Institute of Technology, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Arav, Nahum; Chamberlain, Carter [Department of Physics, Virginia Tech, Blacksburg, VA 24061 (United States); Barth, Aaron J. [Department of Physics and Astronomy, 4129 Frederick Reines Hall, University of California, Irvine, CA 92697 (United States); Glikman, Eilat, E-mail: daniel.k.stern@jpl.nasa.gov [Department of Physics, Middlebury College, Middlebury, VT 05753 (United States)

2017-04-20

CRTS J084133.15+200525.8 is an optically bright quasar at z = 2.345 that has shown extreme spectral variability over the past decade. Photometrically, the source had a visual magnitude of V ∼ 17.3 between 2002 and 2008. Then, over the following five years, the source slowly brightened by approximately one magnitude, to V ∼ 16.2. Only ∼1 in 10,000 quasars show such extreme variability, as quantified by the extreme parameters derived for this quasar assuming a damped random walk model. A combination of archival and newly acquired spectra reveal the source to be an iron low-ionization broad absorption line quasar with extreme changes in its absorption spectrum. Some absorption features completely disappear over the 9 years of optical spectra, while other features remain essentially unchanged. We report the first definitive redshift for this source, based on the detection of broad H α in a Keck/MOSFIRE spectrum. Absorption systems separated by several 1000 km s{sup −1} in velocity show coordinated weakening in the depths of their troughs as the continuum flux increases. We interpret the broad absorption line variability to be due to changes in photoionization, rather than due to motion of material along our line of sight. This source highlights one sort of rare transition object that astronomy will now be finding through dedicated time-domain surveys.

Lens-Aided Multi-Angle Spectroscopy (LAMAS) Reveals Small-Scale Outflow Structure in Quasars

Science.gov (United States)

Green, Paul J.

2006-06-01

Spectral differences between lensed quasar image components are common. Since lensing is intrinsically achromatic, these differences are typically explained as the effect of either microlensing, or as light path time delays sampling intrinsic quasar spectral variability. Here we advance a novel third hypothesis: some spectral differences are due to small line-of-sight differences through quasar disk wind outflows. In particular, we propose that variable spectral differences seen only in component A of the widest separation lens SDSS J1004+4112 are due to differential absorption along the sight lines. The absorber properties required by this hypothesis are akin to known broad absorption line (BAL) outflows but must have a broader, smoother velocity profile. We interpret the observed C IV emission-line variability as further evidence for spatial fine structure transverse to the line of sight. Since outflows are likely to be rotating, such absorber fine structure can consistently explain some of the UV and X-ray variability seen in AGNs. The implications are many: (1) Spectroscopic differences in other lensed objects may be due to this ``lens-aided multi-angle spectroscopy'' (LAMAS). (2) Outflows have fine structure on size scales of arcseconds, as seen from the nucleus. (3) Assuming either broad absorption line region sizes proposed in recent wind models, or typically assumed continuum emission region sizes, LAMAS and/or variability provide broadly consistent absorber size scale estimates of ~1015 cm. (4) Very broad smooth absorption may be ubiquitous in quasar spectra, even when no obvious troughs are seen.

The murine choroid plexus epithelium expresses the 2Cl-/H+-exchanger ClC-7 and Na+/H+ exchanger NHE6 in the luminal membrane domain

DEFF Research Database (Denmark)

Damkier, Helle H; Christensen, Henriette L; Christensen, Inga B

2017-01-01

, but the pH value seems nonetheless maintained within narrow limits, even when faced with acid/base challenges. The involvement of choroid plexus acid/base transporters in CSF pH regulation is highlighted by the expression of several acid/base transporters in the epithelium. The aim of the current study...... was to identify novel acid/base transporters expressed in the luminal membrane of the choroid plexus epithelium to pave the way for systematic investigations of each candidate transporter in the regulation of CSF pH. Mass spectrometry analysis of proteins from epithelial cells isolated by fluorescence activated...... cell sorting identified the Cl-/H+ exchangers ClC-3, -4, -5, and -7 in addition to known choroid plexus acid/base transporters. RT-PCR on FACS isolated epithelial cells confirmed the expression of the corresponding mRNAs, as well as NHE6 mRNA. Both NHE6 and ClC-7 were immunolocalized to the luminal...

SIZES AND TEMPERATURE PROFILES OF QUASAR ACCRETION DISKS FROM CHROMATIC MICROLENSING

International Nuclear Information System (INIS)

Blackburne, Jeffrey A.; Pooley, David; Rappaport, Saul; Schechter, Paul L.

2011-01-01

Microlensing perturbations to the flux ratios of gravitationally lensed quasar images can vary with wavelength because of the chromatic dependence of the accretion disk's apparent size. Multiwavelength observations of microlensed quasars can thus constrain the temperature profiles of their accretion disks, a fundamental test of an important astrophysical process which is not currently possible using any other method. We present single-epoch broadband flux ratios for 12 quadruply lensed quasars in 8 bands ranging from 0.36 to 2.2 μm, as well as Chandra 0.5-8 keV flux ratios for five of them. We combine the optical/IR and X-ray ratios, together with X-ray ratios from the literature, using a Bayesian approach to constrain the half-light radii of the quasars in each filter. Comparing the overall disk sizes and wavelength slopes to those predicted by the standard thin accretion disk model, we find that on average the disks are larger than predicted by nearly an order of magnitude, with sizes that grow with wavelength with an average slope of ∼0.2 rather than the slope of 4/3 predicted by the standard thin disk theory. Though the error bars on the slope are large for individual quasars, the large sample size lends weight to the overall result. Our results present severe difficulties for a standard thin accretion disk as the main source of UV/optical radiation from quasars.

Research on the calibration methods of the luminance parameter of radiation luminance meters

Science.gov (United States)

Cheng, Weihai; Huang, Biyong; Lin, Fangsheng; Li, Tiecheng; Yin, Dejin; Lai, Lei

2017-10-01

This paper introduces standard diffusion reflection white plate method and integrating sphere standard luminance source method to calibrate the luminance parameter. The paper compares the effects of calibration results by using these two methods through principle analysis and experimental verification. After using two methods to calibrate the same radiation luminance meter, the data obtained verifies the testing results of the two methods are both reliable. The results show that the display value using standard white plate method has fewer errors and better reproducibility. However, standard luminance source method is more convenient and suitable for on-site calibration. Moreover, standard luminance source method has wider range and can test the linear performance of the instruments.

High-resolution observations of quasars from the Parkes +- 40 sample

International Nuclear Information System (INIS)

Booth, R.S.; Spencer, R.E.; Stannard, D.; Baath, L.B.

1979-01-01

VLBI observations of 20 compact quasars have been made between Jodrell Bank and Onsala at a frequency of 1666 MHz. Twelve of the quasars have inverted or peaked spectra at centimetre wavelengths and these are all unresolved, having angular diameters of < 0.015 arcsec. Two out of five quasars with overall flat spectra are partially resolved on this scale size, as are three steep-spectrum quasars. (author)

Sn-doped polyhedral In2O3 particles: Synthesis, characterization, and origins of luminous emission in wide visible range

International Nuclear Information System (INIS)

Zhu Yunqing; Chen Yiqing

2012-01-01

Sn-doped octahedronal and tetrakaidecahedronal In 2 O 3 particles were successfully synthesized by simple thermal evaporation of indium grains using SnO as dopant. Structural characterization results demonstrated that the Sn-doped tetrakaidecahedronal In 2 O 3 particle had additional six {001} crystal surfaces compared with the octahedronal one. The luminous properties of both samples were characterized by photoluminescence (PL) and cathodoluminescence (CL) spectroscopy. A broad visible luminous emission around 570 nm was observed. Studies revealed that the emission consisted of three peaks of 511 nm, 564 nm, and 622 nm, which were attributed to radioactive recombination centers such as single ionized oxygen vacancy, indium interstitial, and antisite oxygen, respectively. We believe that the Sn donor level plays an important role in the visible luminous emission. - Graphical abstract: With more oxygen vacancies and tin doping. ITO particles can exhibit a better CL performance. Sn donor level near the conduction band edge plays an important role in luminous emission in wide visible range. Highlights: ► Polyhedral ITO particles synthesized by thermal evaporation using SnO as dopant. ► Broad visible luminous emission around 570 nm. ► Sn donor level plays an important role in the visible emission. ► ITO particles with more oxygen vacancies have better CL performance in visible range.

A POPULATION OF X-RAY WEAK QUASARS: PHL 1811 ANALOGS AT HIGH REDSHIFT

International Nuclear Information System (INIS)

Wu Jianfeng; Brandt, W. N.; Schneider, Donald P.; Hall, Patrick B.; Gibson, Robert R.; Schmidt, Sarah J.; Richards, Gordon T.; Shemmer, Ohad; Just, Dennis W.

2011-01-01

We report the results from Chandra and XMM-Newton observations of a sample of 10 type 1 quasars selected to have unusual UV emission-line properties (weak and blueshifted high-ionization lines; strong UV Fe emission) similar to those of PHL 1811, a confirmed intrinsically X-ray weak quasar. These quasars were identified by the Sloan Digital Sky Survey at high redshift (z ∼ 2.2); eight are radio quiet while two are radio intermediate. All of the radio-quiet PHL 1811 analogs, without exception, are notably X-ray weak by a mean factor of ∼13. These sources lack broad absorption lines and have blue UV/optical continua, supporting the hypothesis that they are intrinsically X-ray weak like PHL 1811 itself. However, their average X-ray spectrum appears to be harder than those of typical quasars, which may indicate the presence of heavy intrinsic X-ray absorption. Our sample of radio-quiet PHL 1811 analogs supports a connection between an X-ray weak spectral energy distribution and PHL 1811-like UV emission lines; this connection provides an economical way to identify X-ray weak type 1 quasars. The fraction of radio-quiet PHL 1811 analogs in the radio-quiet quasar population is estimated to be ∼< 1.2%. We have investigated correlations between relative X-ray brightness and UV emission-line properties (e.g., C IV equivalent width and blueshift) for a sample combining our radio-quiet PHL 1811 analogs, PHL 1811 itself, and typical type 1 quasars. These correlation analyses suggest that PHL 1811 analogs may have extreme wind-dominated broad emission-line regions. Observationally, the radio-quiet PHL 1811 analogs appear to be a subset (∼30%) of radio-quiet weak-line quasars (WLQs). The existence of a subset of quasars in which high-ionization 'shielding gas' covers most of the broad emission-line region (BELR), but little more than the BELR, could potentially unify the PHL 1811 analogs and WLQs. The two radio-intermediate PHL 1811 analogs are X-ray bright. X

Intrinsic variations of the double quasar 0957 + 56 AB

International Nuclear Information System (INIS)

Lloyd, C.

1981-01-01

Observations of the two components of the quasar 0957 + 56A and B are reported which show a variation of approximately 1 mag in both components and behaviour typical of intrinsically variable quasars with similar radio structure. It is argued that the near constancy of the magnitude difference between the components at several epochs, despite overall variations, favours all the variations being intrinsic to the quasar and also supports the hypothesis that the two images are produced by the gravitational lensing of a single distant quasar. (U.K.)

The Sloan Digital Sky Survey Quasar Catalog V. Seventh Data Release

Energy Technology Data Exchange (ETDEWEB)

Schneider, Donald P.; /Penn State U.; Richards, Gordon T.; /Drexel U.; Hall, Patrick B.; /York U., Canada; Strauss, Michael A.; /Princeton U. Observ.; Anderson, Scott F.; /Washington U., Seattle, Astron. Dept.; Boroson, Todd A.; /Kitt Peak Observ.; Ross, Nicholas P.; /Penn State U.; Shen, Yue; /Princeton U. Observ.; Brandt, W.N.; /Penn State U.; Fan, Xiaohui; /Arizona U., Astron. Dept. - Steward Observ.; Inada, Naohisa; /Wako, RIKEN /Southampton U. /Heidelberg, Max Planck Inst. Astron.

2010-04-01

We present the fifth edition of the Sloan Digital Sky Survey (SDSS) Quasar Catalog, which is based upon the SDSS Seventh Data Release. The catalog, which contains 105,783 spectroscopically confirmed quasars, represents the conclusion of the SDSS-I and SDSS-II quasar survey. The catalog consists of the SDSS objects that have luminosities larger than M{sub i} = -22.0 (in a cosmology with H{sub 0} = 70 km s{sup -1} Mpc{sup -1}, {Omega}{sub M} = 0.3, and {Omega}{sub {Lambda}} = 0.7), have at least one emission line with FWHM larger than 1000 km s{sup -1} or have interesting/complex absorption features, are fainter than i {approx} 15.0, and have highly reliable redshifts. The catalog covers an area of {approx} 9380 deg{sup 2}. The quasar redshifts range from 0.065 to 5.46, with a median value of 1.49; the catalog includes 1248 quasars at redshifts greater than 4, of which 56 are at redshifts greater than 5. The catalog contains 9210 quasars with i < 18; slightly over half of the entries have i < 19. For each object the catalog presents positions accurate to better than 0.1-inch rms per coordinate, five-band (ugriz) CCD-based photometry with typical accuracy of 0.03 mag, and information on the morphology and selection method. The catalog also contains radio, near-infrared, and X-ray emission properties of the quasars, when available, from other large-area surveys. The calibrated digital spectra cover the wavelength region 3800-9200 {angstrom} at a spectral resolution of {approx_equal} 2000; the spectra can be retrieved from the SDSS public database using the information provided in the catalog. Over 96% of the objects in the catalog were discovered by the SDSS. We also include a supplemental list of an additional 207 quasars with SDSS spectra whose archive photometric information is incomplete.

THE FIFTH DATA RELEASE SLOAN DIGITAL SKY SURVEY/XMM-NEWTON QUASAR SURVEY

International Nuclear Information System (INIS)

Young, M.; Elvis, M.; Risaliti, G.

2009-01-01

We present a catalog of 792 Fifth Data Release Sloan Digital Sky Survey quasars with optical spectra that have been observed serendipitously in the X-rays with the XMM-Newton. These quasars cover a redshift range of z = 0.11-5.41 and a magnitude range of i = 15.3-20.7. Substantial numbers of radio-loud (70) and broad absorption line (51) quasars exist within this sample. Significant X-ray detections at ≥2σ account for 87% of the sample (685 quasars), and 473 quasars are detected at ≥6σ, sufficient to allow X-ray spectral fits. For detected sources, ∼60% have X-ray fluxes between F 2-10keV = (1-10) x10 -14 erg cm -2 s -1 . We fit a single power law, a fixed power law with intrinsic absorption left free to vary, and an absorbed power-law model to all quasars with X-ray signal-to-noise ratio ≥ 6, resulting in a weighted mean photon index Γ = 1.91 ± 0.08, with an intrinsic dispersion σ Γ = 0.38. For the 55 sources (11.6%) that prefer intrinsic absorption, we find a weighted mean N H = 1.5 ± 0.3 x 10 21 cm -2 . We find that Γ correlates significantly with optical color, Δ(g - i), the optical-to-X-ray spectral index (α ox ), and the X-ray luminosity. While the first two correlations can be explained as artifacts of undetected intrinsic absorption, the correlation between Γ and X-ray luminosity appears to be a real physical correlation, indicating a pivot in the X-ray slope.

Quasars: Active nuclei of young galaxies

Science.gov (United States)

Komberg, B. V.

1980-01-01

The hypothetical properties of 'young' galaxies and possible methods of observing them are discussed. It is proposed that star formation first takes place in the central regions of protogalaxies which may appear as quasar-like objects. An evolutionary scheme is outlined in which the radio quasars are transformed in time into the nuclei of radio galaxies.

A Sample of Quasars with Strong Nitrogen Emission Lines from the Sloan Digital Sky Survey

DEFF Research Database (Denmark)

Jiang, Linhua; Fan, Xiaohui; Vestergaard, Marianne

2008-01-01

We report on 293 quasars with strong NIV] lambda 1486 or NIII] lambda 1750 emission lines (rest-frame equivalent width > 3 \\AA) at 1.7......We report on 293 quasars with strong NIV] lambda 1486 or NIII] lambda 1750 emission lines (rest-frame equivalent width > 3 \\AA) at 1.7...

Images of four compact steep-spectrum quasars with a resolution of 20 milliarcseconds at 329.1 MHz

International Nuclear Information System (INIS)

Simon, R.S.; Readhead, A.C.S.; Wilkinson, P.N.; Booth, R.; Moffet, A.T.

1990-01-01

Four compact steep-spectrum quasars (3C 48, 3C 147, 3C 309.1, and 3C 380) have been mapped with a resolution of 20 mas at 329 MHz. The structures of all four objects are asymmetric and complex, but they are shown here to be consistent with a basic one-sided jet morphology. In this, they are quite similar to other classes of radio sources; however, their small scales and convoluted structures suggest that in these objects, other factors such as the interaction with the interstellar medium and/or variations in the initial jet direction significantly affect the morphology. 43 refs

Measuring Quasar Spin via X-ray Continuum Fitting

Science.gov (United States)

Jenkins, Matthew; Pooley, David; Rappaport, Saul; Steiner, Jack

2018-01-01

We have identified several quasars whose X-ray spectra appear very soft. When fit with power-law models, the best-fit indices are greater than 3. This is very suggestive of thermal disk emission, indicating that the X-ray spectrum is dominated by the disk component. Galactic black hole binaries in such states have been successfully fit with disk-blackbody models to constrain the inner radius, which also constrains the spin of the black hole. We have fit those models to XMM-Newton spectra of several of our identified soft X-ray quasars to place constraints on the spins of the supermassive black holes.

THE z = 5 QUASAR LUMINOSITY FUNCTION FROM SDSS STRIPE 82

International Nuclear Information System (INIS)

McGreer, Ian D.; Fan Xiaohui; Jiang Linhua; Richards, Gordon T.; Strauss, Michael A.; Ross, Nicholas P.; White, Martin; Shen Yue; Schneider, Donald P.; Brandt, W. Niel; Myers, Adam D.; DeGraf, Colin; Glikman, Eilat; Ge Jian; Streblyanska, Alina

2013-01-01

We present a measurement of the Type I quasar luminosity function at z = 5 using a large sample of spectroscopically confirmed quasars selected from optical imaging data. We measure the bright end (M 1450 2 , then extend to lower luminosities (M 1450 2 of deep, coadded imaging in the SDSS Stripe 82 region (the celestial equator in the Southern Galactic Cap). The faint sample includes 14 quasars with spectra obtained as ancillary science targets in the SDSS-III Baryon Oscillation Spectroscopic Survey, and 59 quasars observed at the MMT and Magellan telescopes. We construct a well-defined sample of 4.7 1450 * ∼-27). The bright-end slope is steep (β ∼ 1450 < –26) from z = 5 to z = 6 than from z = 4 to z = 5, suggesting a more rapid decline in quasar activity at high redshift than found in previous surveys. Our model for the quasar luminosity function predicts that quasars generate ∼30% of the ionizing photons required to keep hydrogen in the universe ionized at z = 5.

Optical spectra and radio properties of quasars

International Nuclear Information System (INIS)

Wills, B.J.

1982-01-01

Using high quality spectrophotometric scans obtained at the McDonald Observatory, and data from the literature the author shows that, for quasars, the relative strength of optical Fe II emission (the broad blended feature lambda4570) may be roughly inversely proportional to line widths (full width at half maximum, FWHM). A similar relation between the relative intensity of the UV Fe II blend between 2300 and 2600 A (the lambda2500 feature) and the widths of Mg II and Hβ is shown. She distinguishes between compact and extended radio sources and includes radio quiet quasars, Seyfert 1 galaxies and BLRG's. The quasars associated with extended radio sources have the broadest emission lines and the weakest Fe II, falling close to the region occupied by BLRG's which also have extended radio structure. Those quasars with strong Fe II and compact radio structure are most similar to the Seyfert 1 galaxies. (Auth.)

A Long-Term Space Astrophysics Research Program: The Evolution of the Quasar Continuum

Science.gov (United States)

Elvis, M.; Oliversen, Ronald K. (Technical Monitor)

2001-01-01

Four papers have been written. One reports on the major study funded by this grant: a pan-chromatic study of the quasar continuum at redshift 3. Two others make use of the quasar continuum shapes to find the minimum total accretion luminosity of the Universe, and hence the efficiency and spin of supermassive black holes; the second shows that the reemission of absorbed quasar radiation alleviates a major problem with galaxy formation and the FIR background. The last paper recognizes the role quasars may play in the initial formation of dust in the early Universe. The major study of a sample of z=3 and its comparison with a sample of z=0.l quasars across the whole X-ray to radio spectrum was completed and accepted for publication in ApJ Supplements. This study comprises the thesis work of Olga Kuhn. The two samples are matched in evolved luminosity, and so should be sampling the same black hole population at different z, and in different accretion states. Despite this no strong differences were found between the samples, except in the 'small bump' region of the optical/UV. This region is dominated by FeII emission, and may indicate abundance evolution in quasars. The lack of overall spectral changes argues strongly against a single population of quasars fading over cosmic time, and for a multiple generation, or multiple outburst model for quasars. A study of the total luminosity absorbed from quasars and re-emitted in the infrared produced two results (reported in two papers): The minimum intrinsic luminosity/Gpc(3) from AGN compared with the measured mass density in supermassive black holes [Gpc(-3)] requires a conversion efficiency of accreted mass into luminosity of greater than 15%. Non-rotating black holes cannot exceed 5% efficiency, while rapidly rotating black holes can reach 47%. Hence our result requires that most supermassive black holes must be rapidly rotating. The second result comes from considering the contribution that the re-radiated quasar

IRAS observations of radio-quiet and radio-loud quasars

Science.gov (United States)

Neugebauer, G.; Soifer, B. T.; Miley, G.; Habing, H. J.; Young, E.; Low, F. J.; Beichman, C. A.; Clegg, P. E.; Harris, S.; Rowan-Robinson, M.

1984-01-01

Observations from 12 to 100 microns are presented of two radio-quiet and three radio-loud quasars. Over this wavelength range, all five have grossly similar continuum energy distributions. The continua of the radio-loud quasars are consistent with synchrotron radiation. There is an indication, however, of excess 100 micron emission in the two radio-quiet quasars.

X-RAYS FROM A RADIO-LOUD COMPACT BROAD ABSORPTION LINE QUASAR 1045+352 AND THE NATURE OF OUTFLOWS IN RADIO-LOUD BROAD ABSORPTION LINE QUASARS

International Nuclear Information System (INIS)

Kunert-Bajraszewska, Magdalena; Katarzynski, Krzysztof; Siemiginowska, Aneta; Janiuk, Agnieszka

2009-01-01

We present new results on X-ray properties of radio-loud broad absorption line (BAL) quasars and focus on broadband spectral properties of a high-ionization BAL (HiBAL) compact steep spectrum (CSS) radio-loud quasar 1045+352. This HiBAL quasar has a very complex radio morphology indicating either strong interactions between a radio jet and the surrounding interstellar medium or a possible re-start of the jet activity. We detected 1045+352 quasar in a short 5 ksec Chandra ACIS-S observation. We applied theoretical models to explain spectral energy distribution of 1045+352 and argue that non-thermal, inverse-Compton (IC) emission from the innermost parts of the radio jet can account for a large fraction of the observed X-ray emission. In our analysis, we also consider a scenario in which the observed X-ray emission from radio-loud BAL quasars can be a sum of IC jet X-ray emission and optically thin corona X-ray emission. We compiled a sample of radio-loud BAL quasars that were observed in X-rays to date and report no correlation between their X-ray and radio luminosity. However, the radio-loud BAL quasars show a large range of X-ray luminosities and absorption columns. This is consistent with the results obtained earlier for radio-quiet BAL quasars and may indicate an orientation effect in BAL quasars or more complex dependence between X-ray emission, radio emission, and an orientation based on the radio morphology.

DOUBLE QUASARS: PROBES OF BLACK HOLE SCALING RELATIONSHIPS AND MERGER SCENARIOS

International Nuclear Information System (INIS)

Foreman, G.; Volonteri, M.; Dotti, M.

2009-01-01

We analyze the available sample of double quasars, and investigate their physical properties. Our sample comprises 85 pairs, selected from the Sloan Digital Sky Survey (SDSS). We derive physical parameters for the engine and the host, and model the dynamical evolution of the pair. First, we compare different scaling relationships between massive black holes and their hosts (bulge mass, velocity dispersion, and their possible redshift dependences), and discuss their consistency. We then compute dynamical friction timescales for the double quasar systems to investigate their frequency and their agreement with the m erger drivenscenario for quasar triggering. In optical surveys, such as the SDSS, N double,qso /N qso ∼ 0.1%. Comparing typical merging timescales to expected quasar lifetimes, the fraction of double quasars should be roughly a factor of 10 larger than observed. Additionally, we find that, depending on the correlations between black holes and their hosts, the occurrence of double quasars could be redshift dependent. Comparison of our models to the SDSS quasar catalog suggests that double quasars should be more common at high redshift. We compare the typical separations at which double quasars are observed to the predictions of merger simulations. We find that the distribution of physical separations peaks at ∼30 kpc, with a tail at larger separations (∼100-200 kpc). The peak of the distribution is roughly consistent with the first episode of quasar activity found in equal mass mergers simulations. The tail of the quasar pairs distribution at large separations is instead inconsistent with any quasar activity predicted by published simulations. These large separation pairs are instead consistent with unequal mass mergers where gas is dynamically perturbed during the first pericentric passage, but the gas reaches the black hole only at the next apocenter, where the pair is observed.

The Atacama Cosmology Telescope: Cross-Correlation of Cosmic Microwave Background Lensing and Quasars

Science.gov (United States)

Sherwin, Blake D; Das, Sudeep; Haijian, Amir; Addison, Graeme; Bond, Richard; Crichton, Devin; Devlin, Mark J.; Dunkley, Joanna; Gralla, Megan B.; Halpern, Mark;

X-ray ionization of the intergalactic medium by quasars

Science.gov (United States)

Graziani, Luca; Ciardi, B.; Glatzle, M.

2018-06-01

We investigate the impact of quasars on the ionization of the surrounding intergalactic medium (IGM) with the radiative transfer code CRASH4, now accounting for X-rays and secondary electrons. After comparing with analytic solutions, we post-process a cosmic volume (≈1.5 × 104 Mpc3h-3) containing a ULAS J1120+0641-like quasar (QSO) hosted by a 5 × 1011M⊙h-1 dark matter (DM) halo. We find that: (i) the average HII region (R ˜ 3.2 pMpc in a lifetime tf = 107 yrs) is mainly set by UV flux, in agreement with semi-analytic scaling relations; (ii) a largely neutral (xHII < 0.001), warm (T ˜ 103 K) tail extends up to few Mpc beyond the ionization front, as a result of the X-ray flux; (iii) LyC-opaque inhomogeneities induce a line of sight (LOS) scatter in R as high as few physical Mpc, consistent with the DLA scenario proposed to explain the anomalous size of the ULAS J1120+0641 ionized region. On the other hand, with an ionization rate \\dot{N}_{γ ,0} ˜ 10^{57} s-1, the assumed DLA clustering and gas opacity, only one LOS shows an HII region compatible with the observed one. We deduce that either the ionization rate of the QSO is at least one order of magnitude lower or the ULAS J1120+0641 bright phase is shorter than 107 yrs.

Relationship between luminous fish and symbiosis. I. Comparative studies of lipopolysaccharides isolated from symbiotic luminous bacteria of the luminous marine fish, Physiculus japonicus.

Science.gov (United States)

Kuwae, T; Andoh, M; Fukasawa, S; Kurata, M

1983-01-01

In order to investigate the relationship between host and symbiosis in the luminous marine fish, Physiculus japonicus, the bacterial lipopolysaccharides (LPS) of symbiotic luminous bacteria were compared serologically and electrophoretically. Five symbiotic luminous bacteria (PJ strains) were separately isolated from five individuals of this fish species caught at three points, off the coasts of Chiba, Nakaminato, and Oharai. LPS preparations were made from these bacteria by Westphal's phenol-water method and highly purified by repeated ultracentrifugation. These LPSs contained little or no 2-keto-3-deoxyoctonate and had powerful mitogenic activity. In sodium dodecylsulfate polyacrylamide gel electrophoresis, these PJ-1 to -5 LPSs were separated by their electrophoretic patterns into three groups; the first group included PJ-1 and PJ-4, the second group PJ-2 and PJ-3, and the third group PJ-5 alone. The results agreed with those of the double immunodiffusion test; precipitin lines completely coalesced within each group but not with other groups. In immunoelectrophoresis, one precipitin line was observed between anti PJ-2 LPS serum and PJ-5 LPS but the electrophoretic mobility of PJ-5 LPS was clearly different from that of the PJ-2 LPS group. Furthermore, in a 50% inhibition test with PJ-2 LPS by the passive hemolysis system, the doses of PJ-2 LPS, PJ-3 LPS, and PJ-5 LPS required for 50% inhibition (ID50) in this system were 0.25, 0.25, and 21.6 micrograms/ml for each alkali-treated LPS, respectively, and the ID50's of both PJ-1 LPS and PJ-4 LPS were above 1,000 micrograms/ml. These results indicate that PJ-5 LPS has an antigenic determinant partially in common with LPS from the PJ-2 group but not with LPS from the PJ-1 group and that the symbiotic luminous bacterium PJ-5 is more closely related to the PJ-2 group than to the PJ-1 group. These results show that the species Physiculus japonicus is symbiotically associated with at least three immunologically different

VizieR Online Data Catalog: UV-bright quasars (Syphers+, 2009)

Science.gov (United States)

Syphers, D.; Anderson, S. F.; Zheng, W.; Haggard, D.; Meiksin, A.; Schneider, D. P.; York, D. G.

2010-03-01

Absorption along quasar sightlines remains among the most sensitive direct measures of HeII reionization in much of the intergalactic medium (IGM). Until recently, fewer than a half-dozen unobscured quasar sightlines suitable for the HeII Gunn-Peterson test were known; although these handful demonstrated great promise, the small sample size limited confidence in cosmological inferences. We have recently added nine more such clean HeII quasars, exploiting Sloan Digital Sky Survey (SDSS) quasar samples, broadband ultraviolet (UV) imaging from Galaxy Evolution Explorer (GALEX), and high-yield UV spectroscopic confirmations from Hubble Space Telescope (HST). Here we markedly expand this approach by cross-correlating SDSS DR7 and GALEX GR4+5 to catalog 428 SDSS and 165 other quasars with z>2.78 having likely (~70%) GALEX detections, suggesting they are bright into the far-UV. Reconnaissance HST Cycle 16 Supplemental prism data for 29 of these new quasar-GALEX matches spectroscopically confirm 17 as indeed far-UV bright. At least 10 of these confirmations have clean sightlines all the way down to HeII Lyα, substantially expanding the number of known clean HeII quasars, and reaffirming the order of magnitude enhanced efficiency of our selection technique. Combined confirmations from this and our past programs yield more than 20 HeII quasars, quintupling the sample. These provide substantial progress toward a sample of HeII quasar sightlines large enough, and spanning a sufficient redshift range, to enable statistical IGM studies that may avoid individual object peculiarity and sightline variance. Our expanded catalog of hundreds of high-likelihood far-UV-bright QSOs additionally will be useful for understanding the extreme-UV properties of the quasars themselves. (2 data files).

HUBBLE'S 100,000TH EXPOSURE CAPTURES IMAGE OF DISTANT QUASAR

Science.gov (United States)

2002-01-01

The Hubble Space Telescope achieved its 100,000th exposure June 22 with a snapshot of a quasar that is about 9 billion light-years from Earth. The Wide Field and Planetary Camera 2 clicked this image of the quasar, the bright object in the center of the photo. The fainter object just above it is an elliptical galaxy. Although the two objects appear to be close to each other, they are actually separated by about 2 billion light-years. Located about 7 billion light-years away, the galaxy is almost directly in front of the quasar. Astronomer Charles Steidel of the California Institute of Technology in Pasadena, Calif., indirectly discovered the galaxy when he examined the quasar's light, which contained information about the galaxy's chemical composition. The reason, Steidel found, was that the galaxy was absorbing the light at certain frequencies. The astronomer is examining other background quasars to determine which kinds of galaxies absorb light at the same frequencies. Steidel also was somewhat surprised to discover that the galaxy is an elliptical, rather than a spiral. Elliptical galaxies are generally believed to contain very little gas. However, this elliptical has a gaseous 'halo' and contains no visible stars. Part of the halo is directly in front of the quasar. The bright object to the right of the quasar is a foreground star. The quasar and star are separated by billions of light-years. The quasar looks as bright as the star because it produces a tremendous amount of light from a compact source. The 'disturbed-looking' double spiral galaxy above the quasar also is in the foreground. Credit: Charles Steidel (California Institute of Technology, Pasadena, CA) and NASA. Image files in GIF and JPEG format and captions may be accessed on Internet via anonymous ftp from ftp.stsci.edu in /pubinfo.

The SDSS view of the Palomar-Green bright quasar survey

Energy Technology Data Exchange (ETDEWEB)

Jester, Sebastian; Schneider, Donald P.; Richards, Gordon T.; Green, Richard F.; Schmidt, Maarten; Hall, Patrick B.; Strauss, Michael A.; Vanden Berk, Daniel E.; Stoughton, Chris; Gunn, James E.; Brinkmann, Jon; Kent, Stephen M.; Smith, J.Allyn; Tucker, Douglas, L.; Yanny, Brian; /Fermilab /Penn State U., Astron. Astrophys. /Princeton U.

2005-02-01

The author investigates the extent to which the Palomar-Green (PG) Bright Quasar Survey (BQS) is complete and representative of the general quasar population by comparing with imaging and spectroscopy from the Sloan Digital Sky Survey. A comparison of SDSS and PG photometry of both stars and quasars reveals the need to apply a color and magnitude recalibration to the PG data. Using the SDSS photometric catalog, they define the PG's parent sample of objects that are not main-sequence stars and simulate the selection of objects from this parent sample using the PG photometric criteria and errors. This simulation shows that the effective U-B cut in the PG survey is U-B < -0.71, implying a color-related incompleteness. As the color distribution of bright quasars peaks near U-B = -0.7 and the 2-{sigma} error in U-B is comparable to the full width of the color distribution of quasars, the color incompleteness of the BQS is approximately 50% and essentially random with respect to U-B color for z < 0.5. There is however, a bias against bright quasars at 0.5 < z < 1, which is induced by the color-redshift relation of quasars (although quasars at z > 0.5 are inherently rare in bright surveys in any case). They find no evidence for any other systematic incompleteness when comparing the distributions in color, redshift, and FIRST radio properties of the BQS and a BQS-like subsample of the SDSS quasar sample. However, the application of a bright magnitude limit biases the BQS toward the inclusion of objects which are blue in g-i, in particular compared to the full range of g-i colors found among the i-band limited SDSS quasars, and even at i-band magnitudes comparable to those of the BQS objects.

Low resolution infrared spectra of quasars

International Nuclear Information System (INIS)

Soifer, B.T.; Neugebauer, G.; Oke, J.B.; Matthews, K.

1980-01-01

Low resolution spectra of a significant sample of quasars show that the Paschen α and Balmer line ratios do not agree with the radiative recombination case B result and vary widely within the quasars sampled. The range in Pα:Hβ ratios is a factor of approximately 6, while the range in Lyα:Hα ratios is a factor of approximately 5. For the Pα:Balmer series, the deviations from case B recombination are not consistent with reddening, but appear, within large dispersions, to be consistent with optical depth effects in the Balmer lines affecting the line ratios. The Lyα:Hα ratio is, however, correlated with the continuum spectral index, and can be explained as due to reddening affecting both the lines and continuum. Recent observational results based on a joint infrared/optical survey of the hydrogen line spectra of a significant number of the brightest low and high redshift quasars are summarised. This survey includes 12 quasars in the redshift range 0.07 1.5, where Hα and/or Hβ is redshifted into the 1.65μm or 2.2μm atmospheric windows. (Auth.)

MILLIMETER OBSERVATIONS OF A SAMPLE OF HIGH-REDSHIFT OBSCURED QUASARS

International Nuclear Information System (INIS)

Martinez-Sansigre, Alejo; Karim, Alexander; Schinnerer, Eva

2009-01-01

We present observations at 1.2 mm with Max-Planck Millimetre Bolometer Array (MAMBO-II) of a sample of z ∼> 2 radio-intermediate obscured quasars, as well as CO observations of two sources with the Plateau de Bure Interferometer. The typical rms noise achieved by the MAMBO observations is 0.55 mJy beam -1 and five out of 21 sources (24%) are detected at a significance of ≥3σ. Stacking all sources leads to a statistical detection of (S 1.2mm ) = 0.96 ± 0.11 mJy and stacking only the non-detections also yields a statistical detection, with (S 1.2mm ) = 0.51 ± 0.13 mJy. At the typical redshift of the sample, z = 2, 1 mJy corresponds to a far-infrared luminosity L FIR ∼4 x 10 12 L sun . If the far-infrared luminosity is powered entirely by star formation, and not by active galactic nucleus heated dust, then the characteristic inferred star formation rate is ∼700 M sun yr -1 . This far-infrared luminosity implies a dust mass of M d ∼3 x 10 8 M sun , which is expected to be distributed on ∼kpc scales. We estimate that such large dust masses on kpc scales can plausibly cause the obscuration of the quasars. Combining our observations at 1.2 mm with mid- and far-infrared data, and additional observations for two objects at 350 μm using SHARC-II, we present dust spectral energy distributions (SEDs) for our sample and derive a mean SED for our sample. This mean SED is not well fitted by clumpy torus models, unless additional extinction and far-infrared re-emission due to cool dust are included. This additional extinction can be consistently achieved by the mass of cool dust responsible for the far-infrared emission, provided the bulk of the dust is within a radius ∼2-3 kpc. Comparison of our sample to other samples of z ∼ 2 quasars suggests that obscured quasars have, on average, higher far-infrared luminosities than unobscured quasars. There is a hint that the host galaxies of obscured quasars must have higher cool-dust masses and are therefore often

A DISTANT QUASAR'S BRILLIANT LIGHT

Science.gov (United States)

2002-01-01

The arrow in this image, taken by a ground-based telescope, points to a distant quasar, the brilliant core of an active galaxy residing billions of light-years from Earth. As light from this faraway object travels across space, it picks up information on galaxies and the vast clouds of material between galaxies as it moves through them. The Space Telescope Imaging Spectrograph aboard NASA's Hubble Space Telescope decoded the quasar's light to find the spectral 'fingerprints' of highly ionized (energized) oxygen, which had mixed with invisible clouds of hydrogen in intergalactic space. The quasar's brilliant beam pierced at least four separate filaments of the invisible hydrogen laced with the telltale oxygen. The presence of oxygen between the galaxies implies there are huge quantities of hydrogen in the universe. Credits: WIYN Telescope at Kitt Peak National Observatory in Arizona. The telescope is owned and operated by the University of Wisconsin, Indiana University, Yale University, and the National Optical Astronomy Observatories.