WorldWideScience

Sample records for loam ssl teller

  1. The analysis on SSL protocal

    International Nuclear Information System (INIS)

    Wang Xuren; Xu Rongsheng; Bi Xueyao; Yu Tonghe

    2003-01-01

    We discuss analysis on SSL (Security Socket Layer) protocols in this paper. In order to improve capability of SSL Sniffer, we do some change to SSL Sniffer so that it can be used efficiently and easily in the 'sniffer' mode. Some tests have been done and the result is satisfactory. (authors)

  2. Indicators of Malicious SSL Connections

    NARCIS (Netherlands)

    Bortolameotti, Riccardo; Peter, Andreas; Everts, Maarten Hinderik; Bolzoni, D.

    2015-01-01

    Internet applications use SSL to provide data confidential- ity to communicating entities. The use of encryption in SSL makes it impossible to distinguish between benign and malicious connections as the content cannot be inspected. Therefore, we propose and evaluate a set of indicators for malicious

  3. Indicators of malicious SSL connections

    NARCIS (Netherlands)

    Bortolameotti, R.; Peter, A.; Everts, M.H.; Bolzoni, D.

    2015-01-01

    Internet applications use SSL to provide data confidentiality to communicating entities. The use of encryption in SSL makes it impossible to distinguish between benign and malicious connections as the content cannot be inspected. Therefore, we propose and evaluate a set of indicators for malicious

  4. PROTOCOLO DE SEGURIDAD SSL

    Directory of Open Access Journals (Sweden)

    Liusbetty Canino Gutiérrez

    2006-12-01

    Full Text Available

    El creciente uso de Internet, ha dirigido la atención hacia un problema crucial: la privacidad. Para que tenga lugar una negociación en Internet, se precisa, en la mayoría de los casos, que cada entidad participante pueda contar con una manera eficaz de verificar la identidad de las otras y establecer un nivel de confianza. Es necesario, por tanto, crear un entorno que garantice la autenticidad y seguridad de las transacciones que tienen lugar en este proceso. SSL (Secure Sockets Layer es el protocolo de seguridad más estandarizado que, haciendo uso de un conjunto de técnicas criptográficas, asegura confidencialidad e integridad de la información.

  5. SSL - THE SIMPLE SOCKETS LIBRARY

    Science.gov (United States)

    Campbell, C. E.

    1994-01-01

    The Simple Sockets Library (SSL) allows C programmers to develop systems of cooperating programs using Berkeley streaming Sockets running under the TCP/IP protocol over Ethernet. The SSL provides a simple way to move information between programs running on the same or different machines and does so with little overhead. The SSL can create three types of Sockets: namely a server, a client, and an accept Socket. The SSL's Sockets are designed to be used in a fashion reminiscent of the use of FILE pointers so that a C programmer who is familiar with reading and writing files will immediately feel comfortable with reading and writing with Sockets. The SSL consists of three parts: the library, PortMaster, and utilities. The user of the SSL accesses it by linking programs to the SSL library. The PortMaster initializes connections between clients and servers. The PortMaster also supports a "firewall" facility to keep out socket requests from unapproved machines. The "firewall" is a file which contains Internet addresses for all approved machines. There are three utilities provided with the SSL. SKTDBG can be used to debug programs that make use of the SSL. SPMTABLE lists the servers and port numbers on requested machine(s). SRMSRVR tells the PortMaster to forcibly remove a server name from its list. The package also includes two example programs: multiskt.c, which makes multiple accepts on one server, and sktpoll.c, which repeatedly attempts to connect a client to some server at one second intervals. SSL is a machine independent library written in the C-language for computers connected via Ethernet using the TCP/IP protocol. It has been successfully compiled and implemented on a variety of platforms, including Sun series computers running SunOS, DEC VAX series computers running VMS, SGI computers running IRIX, DECstations running ULTRIX, DEC alpha AXPs running OSF/1, IBM RS/6000 computers running AIX, IBM PC and compatibles running BSD/386 UNIX and HP Apollo 3000

  6. Effect of Simulated Weathering and Aging of TNT in Amended Sandy Loam Soil on Toxicity to the Enchytraeid Worm, Enchytreaeus Crypticus

    Science.gov (United States)

    2006-05-01

    high bioavailability of organic compounds. However, amended SSL soil was analyzed for presence of metabolic transformation products from nitroaromatic...Phillips, C.; Checkai, R. 1999. Comparison of malathion toxicity using enchytraeid reproduction test and earthworm toxicity test in different soil ...OF TNT IN AMENDED SANDY LOAM SOIL ON TOXICITY TO THE ENCHYTRAEID WORM, ENCHYTRAEUS CRYPTICUS Roman G. Kuperman Ronald T. Checkai Michael Simini

  7. Edward Teller Biographical Memoir

    Energy Technology Data Exchange (ETDEWEB)

    Libby, S B; Sessler, A M

    2009-07-27

    Edward Teller died on September 9, 2003 in Stanford, California at the age of 95. He was both one of the great theoretical physicists of the twentieth century and a leading figure in the development of nuclear weapons and broader defense advocacy. Teller's work in physics, spanning many decades of the twentieth century, includes some of the most fundamental insights in the quantum behaviors of molecules and their spectra, nuclei, surfaces, solid state and spin systems, and plasmas. In the defense arena, Teller is best known for his key insight that made thermonuclear weapons possible. Teller was both a great scientific collaborator and physics teacher at all levels, known for his openness, generosity, personal warmth, and powerful physical intuition. Many of his graduate students went on to illustrious careers.

  8. SSL and TLS Theory and Practice

    CERN Document Server

    Oppliger, Rolf

    2009-01-01

    SSL (secure socket layer) and TLS (Transport Layer Security) are widely deployed security protocols that are used in all kinds of web-based e-commerce and e-business applications and are part of most contemporary security systems available today. This practical book provides a comprehensive introduction to these protocols, offering you a solid understanding of their design. You find discussions on the advantages and disadvantages of using SSL/TLS protocols compared to other Internet security protocols. This authoritative resource shows how to properly employ SSL and TLS and configure security

  9. SSL Freeform Generator v1.00

    Science.gov (United States)

    Kuchnik, Michael

    2014-01-01

    The Orion spacecraft utilizes a system of Compact Unique Identifiers (CUIs) to identify telemetry measurements in the process of communicating with the ground. While avionic systems are still in development, simulation of telemetric data must be used for the development of dependent systems. The SuperScript Language (SSL) developed by Honeywell Aerospace provides users a programming language for simulation of this data. The use of tools that provide SSL generation capabilities at a higher level allows for faster and more efficient generation of simulation waveforms. Previous SSL Generator implementations such as Orion Scripted Interface Generator (OrionSIG) relied on software supported routines to generate simulation points for the SSL scripts. This provided relevant simulation capabilities, but was reduced in flexibility by the available software routines available. For this approach, software supported routines have been entirely dropped. Rather, the user is required to enter their own simulation waveform input. This allows arbitrarily complex functions to be utilized simulated with maximum degree of freedom for the user.: The idea for this version of the SSL Generator was a mapping of arbitrary waveforms to Orion CUI telemetry data. The SSL Generator implemented offers a higher degree of freedom to the user than previous versions while attempting to maintain abstraction from the underlying SSL script and the Orion CUI data types. As such, many mappings of waveforms to CUIs will simply not work. Certain implementation decisions were made to minimize the damage caused by these unintended side-effects, such as saturation of values exceeding the maximum or minimum bounds of the data type. Other details, such as signed values being represented in unsigned data types, present problems which cant be fixed to an acceptable degree of intended behavior without user input. Awareness of the limitations of all layers of the software stack will increase the productivity of

  10. Multiple-Channel Security Architecture and its Implementation over SSL

    Directory of Open Access Journals (Sweden)

    Song Yong

    2006-01-01

    Full Text Available This paper presents multiple-channel SSL (MC-SSL, an architecture and protocol for protecting client-server communications. In contrast to SSL, which provides a single end-to-end secure channel, MC-SSL enables applications to employ multiple channels, each with its own cipher suite and data-flow direction. Our approach also allows for several partially trusted application proxies. The main advantages of MC-SSL over SSL are (a support for end-to-end security in the presence of partially trusted proxies, and (b selective data protection for achieving computational efficiency important to resource-constrained clients and heavily loaded servers.

  11. Man in the middle attacks on SSL/TLS

    OpenAIRE

    Caro Alonso-Rodríguez, Antonio Jesús

    2013-01-01

    El proyecto estudia un tipo concreto de ataque sobre el protocolo SSL/TLS llamado "Man in the middle". El projecte estudia un tipus concret d'atac sobre el protocol SSL/TLS anomenat "Man in the middle".

  12. PERBANDINGAN KINERJA IP SEC DAN SSL

    Directory of Open Access Journals (Sweden)

    Dessyanto Boedi P

    2015-04-01

    Full Text Available Ipsec (IP Security and SSL (Secure Socket Layer is the most widely used techniques to secure data communications over the Internet. Both of these techniques has advantages and disadvantages of each. The purpose of this study is to present an analysis of the two techniques above in terms of security and performance.

  13. Dicty_cDB: SSL592 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSL592 (Link to dictyBase) - - - Contig-U14332-1 SSL592E (Link... to Original site) - - - - - - SSL592E 244 Show SSL592 Library SS (Link to library) Clone ID SSL592 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14332-1 Original site URL http://dict...ence niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k Translated Amino Acid...kqncitl*ikkinllkk Frame C: niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k

  14. Insights into accelerated aging of SSL luminaires

    Science.gov (United States)

    Davis, J. Lynn; Lamvik, Michael; Bittle, James; Shepherd, Sarah; Yaga, Robert; Baldasaro, Nick; Solano, Eric; Bobashev, Georgiy

    2013-09-01

    Although solid-state lighting (SSL) products are often intended to have product lifetimes of 15 years or more, the rapid change in technology has created a need for accelerated life tests (ALTs) that can be performed in the span of several months. A critical element of interpreting results from any systems-level ALT is understanding of the impact of the test environment on each component. Because of its ubiquity in electronics, the use of temperature-humidity environments as potential ALTs for SSL luminaires was investigated. Results from testing of populations of three commercial 6" downlights in environments of 85°C and 85% relative humidity (RH) and 75°C and 75% RH are reported. These test environments were found to accelerate lumen depreciation of the entire luminaire optical system, including LEDs, lenses, and reflectors. The effects of aging were found to depend strongly on both the optical materials that were used and the design of the luminaire; this shows that the lumen maintenance behavior of SSL luminaires must be addressed at the optical systems level. Temperature-Humidity ALTs can be a useful test in understand lumainaire depreciation provided that proper consideration is given to the different aging rates of various materials. Since the impact of the temperature-humidity environment varies among components of the optical system, uniform aging of all system components in a single test is difficult to achieve.

  15. Authentication Binding between SSL/TLS and HTTP

    Science.gov (United States)

    Saito, Takamichi; Sekiguchi, Kiyomi; Hatsugai, Ryosuke

    While the Secure Socket Layer or Transport Layer Security (SSL/TLS) is assumed to provide secure communications over the Internet, many web applications utilize basic or digest authentication of Hyper Text Transport Protocol (HTTP) over SSL/TLS. Namely, in the scheme, there are two different authentication schemes in a session. Since they are separated by a layer, these are not convenient for a web application. Moreover, the scheme may also cause problems in establishing secure communication. Then we provide a scheme of authentication binding between SSL/TLS and HTTP without modifying SSL/TLS protocols and its implementation, and we show the effectiveness of our proposed scheme.

  16. On the security of SSL/TLS-enabled applications

    Directory of Open Access Journals (Sweden)

    Manik Lal Das

    2014-01-01

    Full Text Available SSL/TLS (Secure Socket Layer/Transport Layer Security-enabled web applications aim to provide public key certificate based authentication, secure session key establishment, and symmetric key based traffic confidentiality. A large number of electronic commerce applications, such as stock trading, banking, shopping, and gaming rely on the security strength of the SSL/TLS protocol. In recent times, a potential threat, known as main-in-the-middle (MITM attack, has been exploited by attackers of SSL/TLS-enabled web applications, particularly when naive users want to connect to an SSL/TLS-enabled web server. In this paper, we discuss about the MITM threat to SSL/TLS-enabled web applications. We review the existing space of solutions to counter the MITM attack on SSL/TLS-enabled applications, and then, we provide an effective solution which can resist the MITM attack on SSL/TLS-enabled applications. The proposed solution uses a soft-token based approach for user authentication on top of the SSL/TLS’s security features. We show that the proposed solution is secure, efficient and user friendly in comparison to other similar approaches.

  17. Dicty_cDB: SSL472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSL472 (Link to dictyBase) - - - Contig-U14592-1 SSL472F (Link... to Original site) SSL472F 185 - - - - - - Show SSL472 Library SS (Link to library) Clone ID SSL472 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14592-1 Original site URL http://dict...group) genomic DNA, chromosome 6, PAC clone:P0036F10, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.59 1 AC114263 |AC114263.2 Dict...library Plasmodium falciparum 3D7 cDNA 5' similar to TR:O96129 O96129 PREDICTED MEMBRANE ASSOCIATED PROTEIN.

  18. Finding error handling bugs in OpenSSL using Coccinelle

    DEFF Research Database (Denmark)

    Lawall, Julia; Laurie, Ben; Hansen, René Rydhof

    2010-01-01

    OpenSSL is a library providing various functionalities relating to secure network communication.  Detecting and fixing bugs in OpenSSL code is thus essential, particularly when such bugs can lead to malicious attacks.  In previous work, we have proposed a methodology for finding API usage protocols...... in Linux kernel code using the program matching and transformation engine Coccinelle.  In this work, we report on our experience in applying this methodology to OpenSSL, focusing on API usage protocols related to error handling.  We have detected over 30 bugs in a recent OpenSSL snapshot, and in many cases...... it was possible to correct the bugs automatically.  Our patches correcting these bugs have been accepted by the OpenSSL developers.  This work furthermore confirms the applicability of our methodology to user-level code....

  19. Trilateral interlaboratory with SSL (WLEDi) luminaire

    Science.gov (United States)

    Burini Junior, E. C.; Santos, E. R.; Assaf, L. O.

    2018-03-01

    The IEE/USP laboratory and two others, all belonging to RBLE (Brazilian Network of Test Laboratories) participated in a trilateral comparison performed from measurement independently of participants interaction. The results from electric and photometric measurements carried out on samples of Solid State Lighting - SSL, Inorganic White Light Emitting Diode (WLEDi) luminaires by three accredited laboratories were considered in order to point out mutual deviations and to verify the confidence in a bilateral comparison. The first analysis revealed a maximum deviation of 4.2 % between the luminous intensity attributed by one laboratory and the arithmetic mean value from three laboratories. The largest standard uncertainty value of 1.9 % was estimated for Total Harmonic Distortion of electric current THDi and the lowest value, 0.4 %, to the luminous flux. The extreme deviation for one parameter results was 7.2 % at maximum luminous intensity and the lowest was 1.7 % for luminous flux.

  20. Using Frankencerts for Automated Adversarial Testing of Certificate Validation in SSL/TLS Implementations

    OpenAIRE

    Brubaker, Chad; Jana, Suman; Ray, Baishakhi; Khurshid, Sarfraz; Shmatikov, Vitaly

    2014-01-01

    Modern network security rests on the Secure Sockets Layer (SSL) and Transport Layer Security (TLS) protocols. Distributed systems, mobile and desktop applications, embedded devices, and all of secure Web rely on SSL/TLS for protection against network attacks. This protection critically depends on whether SSL/TLS clients correctly validate X.509 certificates presented by servers during the SSL/TLS handshake protocol.

  1. On the security of SSL/TLS-enabled applications

    OpenAIRE

    Das, Manik Lal; Samdaria, Navkar

    2014-01-01

    SSL/TLS (Secure Socket Layer/Transport Layer Security)-enabled web applications aim to provide public key certificate based authentication, secure session key establishment, and symmetric key based traffic confidentiality. A large number of electronic commerce applications, such as stock trading, banking, shopping, and gaming rely on the security strength of the SSL/TLS protocol. In recent times, a potential threat, known as main-in-the-middle (MITM) attack, has been exploited by attackers of...

  2. SSL/TLS Vulnerability Detection Using Black Box Approach

    Science.gov (United States)

    Gunawan, D.; Sitorus, E. H.; Rahmat, R. F.; Hizriadi, A.

    2018-03-01

    Socket Secure Layer (SSL) and Transport Layer Security (TLS) are cryptographic protocols that provide data encryption to secure the communication over a network. However, in some cases, there are vulnerability found in the implementation of SSL/TLS because of weak cipher key, certificate validation error or session handling error. One of the most vulnerable SSL/TLS bugs is heartbleed. As the security is essential in data communication, this research aims to build a scanner that detect the SSL/TLS vulnerability by using black box approach. This research will focus on heartbleed case. In addition, this research also gathers information about existing SSL in the server. The black box approach is used to test the output of a system without knowing the process inside the system itself. For testing purpose, this research scanned websites and found that some of the websites still have SSL/TLS vulnerability. Thus, the black box approach can be used to detect the vulnerability without considering the source code and the process inside the application.

  3. Network security with openSSL cryptography for secure communications

    CERN Document Server

    Viega, John; Chandra, Pravir

    2002-01-01

    Most applications these days are at least somewhat network aware, but how do you protect those applications against common network security threats? Many developers are turning to OpenSSL, an open source version of SSL/TLS, which is the most widely used protocol for secure network communications.The OpenSSL library is seeing widespread adoption for web sites that require cryptographic functions to protect a broad range of sensitive information, such as credit card numbers and other financial transactions. The library is the only free, full-featured SSL implementation for C and C++, and it can be used programmatically or from the command line to secure most TCP-based network protocols.Network Security with OpenSSL enables developers to use this protocol much more effectively. Traditionally, getting something simple done in OpenSSL could easily take weeks. This concise book gives you the guidance you need to avoid pitfalls, while allowing you to take advantage of the library?s advanced features. And, inst...

  4. Linear Shrinkage Behaviour of Compacted Loam Masonry Blocks

    Directory of Open Access Journals (Sweden)

    NAWAB ALI LAKHO

    2017-04-01

    Full Text Available Walls of wet loam, used in earthen houses, generally experience more shrinkage which results in cracks and less compressive strength. This paper presents a technique of producing loam masonry blocks that are compacted in drained state during casting process in order to minimize shrinkage. For this purpose, loam masonry blocks were cast and compacted at a pressure of 6 MPa and then dried in shade by covering them in plastic sheet. The results show that linear shrinkage of 2% occurred which is smaller when compared to un-compacted wet loam walls. This implies that the loam masonry blocks compacted in drained state is expected to perform better than un-compacted wet loam walls.

  5. Interaction of radionuclides with diluvium loams

    International Nuclear Information System (INIS)

    Martyanov, V.V.; Guskov, A.V.; Tkachenko, A.V.; Prozorov, L.B.; Karlina, O.K.

    2005-01-01

    Full text of publication follows: Primary goal of this research was to study the interaction of radioactive liquid waste with diluvium loams. A geology-hydro-geological characterisation of the RADON-site facility, located in the Southern Region of Russia, is given. According to the results of laboratory and field studies, the hydro-geological parameters of diluvium loams were designed, and their mineral and grain structures were investigated. It was established, that loams have low filtration properties. Definition of filtration coefficients (Kf) under laboratory conditions has shown low values (hydraulic gradient J=10, Kf = 8.10 -4 m/day). But the field experiment has shown, that Kf values vary from 0.1 up to 0.04 m/day with a gradient of J=1! (It is important to point at the selection of the initial data for modelling migration). Mineral structure: quartz - 43 %, montmorillonite - 28 %, hydro-micas - 17 %, iron hydroxides - 5 %, feldspar - 3,7 %, kaolinite - 2 %, carbonates - 1 %, organics - 0,3 %. The content of minerals known as good sorbents, makes up to 52 %. Laboratory experiments dedicated to the determination of sorption isotherms for various radionuclides were carried out. As a result, distribution coefficients (Kd) for 90 Sr, 137 Cs, 60 Co, 238 Pu were determined. Geology-hydro-geological and radiochemical data were used for the schematization of the system. Then, the mathematical modelling and forecasting of radionuclide migration was carried out. Two conservative scenarios were considered - full destruction of the waste matrices + water flow (lateral and vertical direction). As migrating components 90 Sr, 137 Cs, 60 Co, 238 Pu were considered. 90 Sr, 137 Cs, 60 Co, 238 Pu have different mobility due to their Kd ranging from tens and hundreds up to thousand ml/g depending on the properties of the diluvium loams. Initial radionuclide concentrations were as follow: 137 Cs -1.32.10 8 Bq/l, 60 Co - 2.52.10 7 Bq/l, 90 Sr - 1.81.10 7 Bq/l, 238 Pu - 7.78.10 6

  6. Existující útoky na SSL/TLS

    OpenAIRE

    Lysoněk, Milan

    2017-01-01

    SSL/TLS je moderní kryptografický protokol, který zabezpečuje komunikaci mezi klientem a serverem. Avšak na tento protokol existují útoky, které mohou ohrozit komunikaci buď odposloucháváním nebo jejím narušením. Obrana proti těmto útokům a testování zranitelností protokolů je ale značně náročný proces. Tato práce popisuje zranitelnosti SSL/TLS protokolu a implementuje vybrané útoky v tlsfuzzeru --- nástroj pro testování SSL/TLS implementací. Výsledná implementace útoků je demonstrována na tř...

  7. Implementing SSL/TLS using cryptography and PKI

    CERN Document Server

    Davies, Joshua

    2011-01-01

    Hands-on, practical guide to implementing SSL and TLS protocols for Internet security If you are a network professional who knows C programming, this practical book is for you.  Focused on how to implement Secure Socket Layer (SSL) and Transport Layer Security (TLS), this book guides you through all necessary steps, whether or not you have a working knowledge of cryptography. The book covers SSLv2, TLS 1.0, and TLS 1.2, including implementations of the relevant cryptographic protocols, secure hashing, certificate parsing, certificate generation, and more.  Coverage includes: Underst

  8. Multi-Year SSL Market Development Support Plan

    Energy Technology Data Exchange (ETDEWEB)

    Ledbetter, Marc R.

    2012-05-01

    This plan sets out a strategic, five year framework for guiding DOE's market development support activities for high-performance solid-state lighting (SSL) products for the U.S. general illumination market. The market development support activities described in this plan, which span federal fiscal years 2012 to 2016, are intended to affect the types of SSL general illumination products adopted by the market, to accelerate commercial adoption of those products, and to support appropriate application of those products to maximize energy savings. DOE has established aggressive FY16 goals for these activities, including goals for the types of products brought to market, the market adoption of those products, and the energy savings achieved through use of SSL products. These goals are for the combined effect of DOE's SSL market development support and R and D investment, as well as the leveraged activities of its partners. Goals include: (1) inducing the market introduction of SSL products achieving 140 lumens per Watt (lm/W) for warm white products, and 155 lm/W for cool white products, and (2) inducing sales of high-performance SSL products that achieve annual site electricity savings of 21 terawatt hours (0.25 quadrillion Btus primary energy) by FY16. To overcome identified market barriers and to achieve the above five year goals, DOE proposes to carry out the following strategy. DOE will implement a multi-year program to accelerate adoption of good quality, high performance SSL products that achieve significant energy savings and maintain or improve lighting quality. Relying on lessons learned from past emerging technology introductions, such as compact fluorescent lamps, and using newly developed market research, DOE will design its efforts to minimize the likelihood that the SSL market will repeat mistakes that greatly delayed market adoption of earlier emerging technology market introductions. To achieve the maximum effect per dollar invested, DOE will

  9. Interfacial behaviour of sodium stearoyllactylate (SSL) as an oil-in-water pickering emulsion stabiliser.

    Science.gov (United States)

    Kurukji, D; Pichot, R; Spyropoulos, F; Norton, I T

    2013-11-01

    The ability of a food ingredient, sodium stearoyllactylate (SSL), to stabilise oil-in-water (O/W) emulsions against coalescence was investigated, and closely linked to its capacity to act as a Pickering stabiliser. Results showed that emulsion stability could be achieved with a relatively low SSL concentration (≥0.1 wt%), and cryogenic-scanning electron microscopy (cryo-SEM) visualisation of emulsion structure revealed the presence of colloidal SSL aggregates adsorbed at the oil-water interface. Surface properties of SSL could be modified by altering the size of these aggregates in water; a faster decrease in surface tension was observed when SSL dispersions were subjected to high pressure homogenisation (HPH). The rate of SSL adsorption at the sunflower oil-water interface also increased after HPH, and a higher interfacial tension (IFT) was observed with increasing SSL concentration. Differential scanning calorimetry (DSC) enabled a comparison of the thermal behaviour of SSL in aqueous dispersions with SSL-stabilised O/W emulsions. SSL melting enthalpy depended on emulsion interfacial area and the corresponding DSC data was used to determine the amount of SSL adsorbed at the oil-water interface. An idealised theoretical interfacial coverage calculation based on Pickering emulsion theory was in general agreement with the mass of SSL adsorbed as predicted by DSC. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

  10. A one-year oral toxicity study of sodium stearoyl lactylate (SSL) in rats

    NARCIS (Netherlands)

    Lamb, J.; Hentz, K.; Schmitt, D.; Tran, N.; Jonker, D.; Junker, K.

    2010-01-01

    The toxicity of sodium stearoyl lactylate (SSL) was examined in Wistar rats fed diets containing 0, 1.25, 2.5, and 5% SSL for one year, equivalent to mean daily intakes of 558, 1115, and 2214. mg/kg/day in males and 670, 1339, and 2641. mg/kg/day in females, respectively. SSL was well tolerated at

  11. Design methodologies for reliability of SSL LED boards

    NARCIS (Netherlands)

    Jakovenko, J.; Formánek, J.; Perpiñà, X.; Jorda, X.; Vellvehi, M.; Werkhoven, R.J.; Husák, M.; Kunen, J.M.G.; Bancken, P.; Bolt, P.J.; Gasse, A.

    2013-01-01

    This work presents a comparison of various LED board technologies from thermal, mechanical and reliability point of view provided by an accurate 3-D modelling. LED boards are proposed as a possible technology replacement of FR4 LED boards used in 400 lumen retrofit SSL lamps. Presented design

  12. SSL Adoption by Museums: Survey Results, Analysis, and Recommendations

    Energy Technology Data Exchange (ETDEWEB)

    Perrin, T. E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Druzik, J. R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Miller, N. J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2014-11-01

    DOE Solid-State Lighting GATEWAY report that summarizes the results of a survey of the museum community regarding conversions to SSL in museums. Responses provided real-world insight into how LEDs are being incorporated into museums, and what successes and hurdles have been encountered in the process.

  13. 12 CFR 205.16 - Disclosures at automated teller machines.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Disclosures at automated teller machines. 205... SYSTEM ELECTRONIC FUND TRANSFERS (REGULATION E) § 205.16 Disclosures at automated teller machines. (a) Definition. Automated teller machine operator means any person that operates an automated teller machine at...

  14. Verification of OpenSSL version via hardware performance counters

    Science.gov (United States)

    Bruska, James; Blasingame, Zander; Liu, Chen

    2017-05-01

    Many forms of malware and security breaches exist today. One type of breach downgrades a cryptographic program by employing a man-in-the-middle attack. In this work, we explore the utilization of hardware events in conjunction with machine learning algorithms to detect which version of OpenSSL is being run during the encryption process. This allows for the immediate detection of any unknown downgrade attacks in real time. Our experimental results indicated this detection method is both feasible and practical. When trained with normal TLS and SSL data, our classifier was able to detect which protocol was being used with 99.995% accuracy. After the scope of the hardware event recording was enlarged, the accuracy diminished greatly, but to 53.244%. Upon removal of TLS 1.1 from the data set, the accuracy returned to 99.905%.

  15. Using Frankencerts for Automated Adversarial Testing of Certificate Validation in SSL/TLS Implementations.

    Science.gov (United States)

    Brubaker, Chad; Jana, Suman; Ray, Baishakhi; Khurshid, Sarfraz; Shmatikov, Vitaly

    2014-01-01

    Modern network security rests on the Secure Sockets Layer (SSL) and Transport Layer Security (TLS) protocols. Distributed systems, mobile and desktop applications, embedded devices, and all of secure Web rely on SSL/TLS for protection against network attacks. This protection critically depends on whether SSL/TLS clients correctly validate X.509 certificates presented by servers during the SSL/TLS handshake protocol. We design, implement, and apply the first methodology for large-scale testing of certificate validation logic in SSL/TLS implementations. Our first ingredient is "frankencerts," synthetic certificates that are randomly mutated from parts of real certificates and thus include unusual combinations of extensions and constraints. Our second ingredient is differential testing: if one SSL/TLS implementation accepts a certificate while another rejects the same certificate, we use the discrepancy as an oracle for finding flaws in individual implementations. Differential testing with frankencerts uncovered 208 discrepancies between popular SSL/TLS implementations such as OpenSSL, NSS, CyaSSL, GnuTLS, PolarSSL, MatrixSSL, etc. Many of them are caused by serious security vulnerabilities. For example, any server with a valid X.509 version 1 certificate can act as a rogue certificate authority and issue fake certificates for any domain, enabling man-in-the-middle attacks against MatrixSSL and GnuTLS. Several implementations also accept certificate authorities created by unauthorized issuers, as well as certificates not intended for server authentication. We also found serious vulnerabilities in how users are warned about certificate validation errors. When presented with an expired, self-signed certificate, NSS, Safari, and Chrome (on Linux) report that the certificate has expired-a low-risk, often ignored error-but not that the connection is insecure against a man-in-the-middle attack. These results demonstrate that automated adversarial testing with frankencerts

  16. Důvěryhodná proxy v SSL/TLS spojení

    OpenAIRE

    Smolík, Jiří

    2017-01-01

    The problem of SSL/TLS interception ("trusted proxy in SSL/TLS connection") has been known for years and many implementations exist. However, all of them share a single technical solution which is based solely on the PKI authentication mechanism and suffers from multiple serious disadvantages. Most importantly, it is not compatible with several aspects or future trends of SSL/TLS and PKI, there's almost no space for improvement and its real use may spawn legal issues. After we analyze technic...

  17. Jahn-Teller effect: its history and applicability

    International Nuclear Information System (INIS)

    Teller, E.

    1981-01-01

    The interactions between Teller, Renner, Jahn and Landau which led to the formulation of the Jahn-Teller effect are discussed. The applicability of Jahn-Teller type of theory to superconductivity and the explanation proposed by the use of Goldstone particles are assessed

  18. 78 FR 18221 - Disclosures at Automated Teller Machines (Regulation E)

    Science.gov (United States)

    2013-03-26

    ... Disclosures at Automated Teller Machines (Regulation E) AGENCY: Bureau of Consumer Financial Protection... the EFTA to eliminate a requirement that a fee notice be posted on or at automated teller machines... legislation, though the Electronic Fund Transfer Act and Regulation E use the term ``automated teller machine...

  19. Timing Analysis of SSL/TLS Man in the Middle Attacks

    OpenAIRE

    Benton, Kevin; Bross, Ty

    2013-01-01

    Man in the middle attacks are a significant threat to modern e-commerce and online communications, even when such transactions are protected by TLS. We intend to show that it is possible to detect man-in-the-middle attacks on SSL and TLS by detecting timing differences between a standard SSL session and an attack we created.

  20. MITHYS: Mind The Hand You Shake - Protecting Mobile Devices from SSL Usage Vulnerabilities

    DEFF Research Database (Denmark)

    Conti, M.; Dragoni, Nicola; Gottardo, S.

    2013-01-01

    Recent studies have shown that a significant number of mobile applications, often handling sensitive data such as bank accounts and login credentials, suffers from SSL vulnerabilities. Most of the time, these vulnerabilities are due to improper use of the SSL protocol (in particular, in its...

  1. effect of tractor forward speed on sandy loam soil physical ...

    African Journals Online (AJOL)

    Dr Obe

    Ilorin on a sandy loam soil to evaluate the effect of the imposition of different .... of the blade is 10.5cm. ... arranged in an inverted cone shape with ... replicates were taken for each speed run. The ..... Thakur, T. C; A. Yadav; B. P. Varshney and.

  2. Analysis of free SSL/TLS Certificates and their implementation as Security Mechanism in Application Servers.

    Directory of Open Access Journals (Sweden)

    Mario E. Cueva Hurtado

    2017-02-01

    Full Text Available Security in the application layer (SSL, provides the confidentiality, integrity, and authenticity of the data, between two applications that communicate with each other. This article is the result of having implemented Free SSL / TLS Certificates in application servers, determining the relevant characteristics that must have a SSL/TLS certificate, the Certifying Authority generate it. A vulnerability analysis is developed in application servers and encrypted communications channel is established to protect against attacks such as man in the middle, phishing and maintaining the integrity of information that is transmitted between the client and server.

  3. Benchmarks for Developing Ecological Soil Screening Levels (ECO-SSL): Effects of Selenium on Soil Invertebrates

    National Research Council Canada - National Science Library

    Checkai, Ronald T; Simini, Michael; Kuperman, Roman; Phillips, Carlton T; Johnson, Dennis W; Higashi, Richard M; Fan, Teresa W-M; Sappington, Keith

    2004-01-01

    ...) for ecological receptors. Unfortunately data in the published literature were insufficient in quantity and quality to establish an Eco-SSL for selenium, critical in various DoD advanced technologies, and frequently...

  4. Relativistic Jahn-Teller effect in tetrahedral systems

    International Nuclear Information System (INIS)

    Opalka, Daniel; Domcke, Wolfgang; Segado, Mireia; Poluyanov, Leonid V.

    2010-01-01

    It is shown that orbitally degenerate states in highly symmetric systems are split by Jahn-Teller forces which are of relativistic origin (that is, they arise from the spin-orbit coupling operator). For the example of tetrahedral systems, the relativistic Jahn-Teller Hamiltonians of orbitally degenerate electronic states with spin 1/2 are derived. While both electrostatic and relativistic forces contribute to the Jahn-Teller activity of vibrational modes of E and T 2 symmetry in 2 T 2 states of tetrahedral systems, the electrostatic and relativistic Jahn-Teller couplings are complementary for 2 E states: The E mode is Jahn-Teller active through electrostatic forces, while the T 2 mode is Jahn-Teller active through the relativistic forces. The relativistic Jahn-Teller parameters have been computed with ab initio relativistic electronic-structure methods. It is shown for the example of the tetrahedral cluster cations of the group V elements that the relativistic Jahn-Teller couplings can be of the same order of magnitude as the familiar electrostatic Jahn-Teller couplings for the heavier elements.

  5. New understandings of failure modes in SSL luminaires

    Science.gov (United States)

    Shepherd, Sarah D.; Mills, Karmann C.; Yaga, Robert; Johnson, Cortina; Davis, J. Lynn

    2014-09-01

    As SSL products are being rapidly introduced into the market, there is a need to develop standard screening and testing protocols that can be performed quickly and provide data surrounding product lifetime and performance. These protocols, derived from standard industry tests, are known as ALTs (accelerated life tests) and can be performed in a timeframe of weeks to months instead of years. Accelerated testing utilizes a combination of elevated temperature and humidity conditions as well as electrical power cycling to control aging of the luminaires. In this study, we report on the findings of failure modes for two different luminaire products exposed to temperature-humidity ALTs. LEDs are typically considered the determining component for the rate of lumen depreciation. However, this study has shown that each luminaire component can independently or jointly influence system performance and reliability. Material choices, luminaire designs, and driver designs all have significant impacts on the system reliability of a product. From recent data, it is evident that the most common failure modes are not within the LED, but instead occur within resistors, capacitors, and other electrical components of the driver. Insights into failure modes and rates as a result of ALTs are reported with emphasis on component influence on overall system reliability.

  6. Gamow-Teller Strength Distributions for Some Magic Nuclei

    Directory of Open Access Journals (Sweden)

    Necla ÇAKMAK

    2014-12-01

    Full Text Available The total Gamow-Teller strengths and their energy distributions for 96Zr, 96Sr, 54Ca, 28O, 24C and 14C have been obtained within the framework of Random Phase Approximation (RPA. The effective interaction potential has been described by considering the commutativity of the Gamow-Teller operator with the central part of the nuclear Hamiltonian.

  7. 1995 Edward teller lecture. Patience and optimism

    International Nuclear Information System (INIS)

    Miley, G.H.

    1996-01-01

    Remarks made in the author close-quote s acceptance lecture for the 1995 Edward Teller Medal are presented and expanded. Topics covered include research on nuclear-pumped lasers, the first direct e-beam-pumped laser, direct energy conversion and advanced fuel fusion, plus recent work on inertial electrostatic confinement. open-quote open-quote Patience close-quote close-quote and open-quote open-quote optimism close-quote close-quote are viewed as essential elements needed by scientists following the open-quote open-quote zig-zag close-quote close-quote path to fusion energy production. copyright 1996 American Institute of Physics

  8. Gamow-teller transitions: progress and problems

    International Nuclear Information System (INIS)

    Walter, G.

    1994-01-01

    The determination of the Gamow-Teller (GT) matrix elements from beta-decay and charge exchange reactions has led to a series of discoveries concerning the structure of the nucleus and the properties of spin-isospin transitions in nuclei. The study of GT distribution and strength, either by charge exchange or weak decay, provides excellent tests for nuclear models as these parameters are extremely sensitive to the details of nuclear structure. Recent improvements of these models have reduced, for the most part, differences between experiment and theory, allowing in turn a more reliable estimate of weak decay rates in stellar matter. A better understanding of the 'missing strength' and of the failure of many experiments to detect the strength that is present have also been obtained. Recently, it appears also that weak decay studies in selected region (proton or neutron rich) of the N-Z plane give access to the GT giant resonance. (J.S.). 65 refs., 10 figs

  9. Modeling the impact of thermal effects on luminous flux maintenance for SSL luminaires

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Lynn [RTI International, Research Triangle Park, NC (United States); Mills, Karmann [RTI International, Research Triangle Park, NC (United States); Lamvik, Michael [RTI International, Research Triangle Park, NC (United States); Solano, Eric [RTI International, Research Triangle Park, NC (United States); Bobashev, Georgiy [RTI International, Research Triangle Park, NC (United States); Perkins, Curtis [RTI International, Research Triangle Park, NC (United States)

    2017-05-30

    Meeting the longevity requirements of solid-state lighting (SSL) devices places extreme demands on the materials and designs that are used in SSL luminaires. Therefore, understanding the aging characteristics of lens, reflectors, and other materials is essential to projecting the long-term performance of LED-based lighting systems. Overlooking these factors at either the design or product specification stage can result in premature failure of the device due to poor luminous flux maintenance and/or excessive chromaticity shifts. This paper describes a methodology for performing accelerated stress testing (AST) on materials intended for use in SSL luminaires. This test methodology, which consists of elevated temperature and humidity conditions, produces accelerated aging data that can be correlated to expected performance under normal luminaire operating conditions. The correlations can then be leveraged to produce models of the changes in the optical properties of key materials including transmittance versus wavelength of lenses and reflectance versus wavelength for housings and other reflectors. This information has been collected into a lumen maintenance decision support tool (LM-DST) and together with user supplied inputs (e.g., expected operation conditions) can provide guidance on lifetime expectations of SSL luminaires. This approach has been applied to a variety of materials commonly found in SSL luminaires including acrylics, polycarbonates, and silicones used for lenses and paints, coatings, films, and composites used for reflectors.

  10. Andrew Liehr and the structure of Jahn-Teller surfaces

    International Nuclear Information System (INIS)

    Chibotaru, Liviu F.; Iwahara, Naoya

    2017-01-01

    The present article is an attempt to draw attention to a seminal work by Andrew Liehr “Topological aspects of conformational stability problem” [1, 2] issued more than half century ago. The importance of this work stems from two aspects of static Jahn-Teller and pseudo-Jahn-Teller problems fully developed by the author. First, the work of Liehr offers an almost complete overview of adiabatic potential energy surfaces for most known Jahn-Teller problems including linear, quadratic and higher-order vibronic couplings. Second, and most importantly, it identifies the factors defining the structure of Jahn-Teller surfaces. Among them, one should specially mention the minimax principle stating that the distorted Jahn-Teller systems tend to preserve the highest symmetry consistent with the loss of their orbital degeneracy. We believe that the present short reminiscence not only will introduce a key Jahn-Teller scientist to the young members of the community but also will serve as a vivid example of how a complete understanding of a complex problem, which the Jahn-Teller effect certainly was in the beginning of 1960s, can be achieved. (paper)

  11. Impact of tillage intensity on clay loam soil structure

    DEFF Research Database (Denmark)

    Daraghmeh, Omar; Petersen, Carsten; Munkholm, Lars Juhl

    Soil structure and structural stability are key parameters in sustainable soil management and optimum cropping practices. Locally and temporally adapted precision tillage may improve crop performance while at the same time reduce environmental impacts. The main objective of this study...... was to improve the knowledge of precision tillage practices through characterizing the effect of varied tillage intensities on structural properties of a clay loam soil. A field experiment was conducted using a randomized complete block design with two main factors, i.e. operational speed (OS, 2 levels......) and rotovating speed (RS, 3 levels). The tillage was conducted using a PTO-driven rotovator equipped to measure angular velocity. The effect of traffic compaction, made directly after tillage, was measured on soil taken from wheel track (WT) compared with soil outside wheel track (NWT). Soil samples from 0-3 cm...

  12. Processing Uranium-Bearing Materials Containing Coal and Loam

    Energy Technology Data Exchange (ETDEWEB)

    Civin, V; Prochazka, J [Research and Development Laboratory No. 3 of the Uranium Industry, Prague, Czechoslovakia (Czech Republic)

    1967-06-15

    Among the ores which are classified as low-grade in the CSSR are mixtures of coal and bentonitic loam of tertiary origin, containing approximately 0.1% U and with a moisture content at times well above 20-30%. The uranium is held mainly by the carbonaceous component. Conventional processing of these materials presents various difficulties which are not easily overcome. During leaching the pulp thickens and frequently becomes pasty, due to the presence of montmorillonites. Further complications arise from the high sorption capacity of the materials (again primarily due to montmorillonites) and poor sedimentation of the viscous pulps. In addition, the materials are highly refractory to the leaching agents. The paper presents experience gained in solving the problems of processing these ores. The following basic routes were explored: (1) separation of the carbonaceous and loamy components: The organic component appears to be the main activity carrier. Processing the concentrated material upon separation of the inactive or less active loam may not only remove the thixotropic behaviour but also substantially reduce the cost of the ore treatment; (2) 'liquifying' the pulps or preventing the thickening of the pulp by addition of suitable agents; (3) joint acid or carbonate processing of the materials in question with current ore types; (4) removal or suppression of thixotropic behaviour by thermal pretreatment of the material; and (5) application of the 'acid cure' method. The first method appears to be the most effective, but it presents considerable difficulties due to the extreme dispersion of the carbonaceous phase and further research is being carried out. Methods 2 and 3 proved to be unacceptable. Method 4, which includes roasting at 300-400{sup o}C, is now being operated on an industrial scale. The final method has also shown definite advantages for particular deposits of high montmorillonite content material. (author)

  13. Quantum structural approach to high-Tc superconductivity theory: Herzberg-Teller, Renner-Teller, Jahn-Teller effects and intervalent geminal charge transfer

    International Nuclear Information System (INIS)

    Chiu, Y.

    1997-01-01

    We use quantum molecular structure and spectroscopic thoughts of various possible vibronic interactions for the position space of two-electron geminal orbitals with Bloch sums. Our geminals have different degeneracy from one-electron molecular orbitals and are different from the momentum space of BCS free electrons. Based on Herzberg-Teller expansions, our consideration of the aspect of the Renner-Teller effect for cyclic boundary crystals (instead of the usual linear molecules) involves first-order vibronic interaction with isotope effects different from the second-order electron-phonon energy of BCS theory, bipolaron theory, etc. Our consideration of the Jahn-Teller effect with equal-minimum double-well potential leads to the intervalent charge transfer between two degenerate vibrationally affected electronic structures. Our considerations of different style vibrations other than the antisymmetric vibration for the nearest neighbor (e.g., displaced oscillator, etc.) may possibly be related to the case of special chemical structures with special doping and special coherence length. Our simple structural illustrations of such different vibronic Renner-Teller, Jahn-Teller effects and intervalent charge transfer (of La 2-x Sr x CuO 4 and YBa 2 Cu 3 O 7-x ) may promote some possible thoughts of quantum chemical structures compared and mixed with the physical treatments of special high-T c superconductors. copyright 1997 The American Physical Society

  14. Final Report: System Reliability Model for Solid-State Lighting (SSL) Luminaires

    Energy Technology Data Exchange (ETDEWEB)

    Davis, J. Lynn [RTI International, Research Triangle Park, NC (United States)

    2017-05-31

    The primary objectives of this project was to develop and validate reliability models and accelerated stress testing (AST) methodologies for predicting the lifetime of integrated SSL luminaires. This study examined the likely failure modes for SSL luminaires including abrupt failure, excessive lumen depreciation, unacceptable color shifts, and increased power consumption. Data on the relative distribution of these failure modes were acquired through extensive accelerated stress tests and combined with industry data and other source of information on LED lighting. This data was compiled and utilized to build models of the aging behavior of key luminaire optical and electrical components.

  15. customer-teller scheduling system for optimizing banks service

    African Journals Online (AJOL)

    els Bank Teller scheduling system for optimizing a Banks customer service. The model takes into account real time .... tinuous observation by management personnel and thus results in .... relationships in a mathematical model. A mathematical ...

  16. After the Prestige: A Postmodern Analysis of Penn and Teller

    Directory of Open Access Journals (Sweden)

    Miller, Liz

    2015-12-01

    Full Text Available By mocking the magic community and revealing the secret behind some of their tricks, Penn and Teller perform a kind of parodic and post-modern “anti-magic.” Penn and Teller display an artful use of rhetoric; in exposing the secrets and shortcomings of conjuring, they are revolutionizing the way people think about both the art of magic and the magic community. Individuals such as Penn and Teller may use parody to subvert the hegemonic interpretations. However, we also know that it is difficult to bring down a system while operating within that system. Thus, this article explores the way Penn and Teller are challenging the metanarrative of the magic community, using several of the duo’s more popular illusions as examples for analysis. Ultimately, this paper should help us gain a better understanding of the way parody can be used to challenge hegemonic conceptions, and the limitations of this type of rhetorical approach.

  17. 96 THE EFFECT OF AUTOMATED TELLER MACHINES ON BANKS ...

    African Journals Online (AJOL)

    reduces the number of human deployment by banks thereby reducing cost of operations. ... United States (PLUS and CIRRUS) drooped their long standing opposition to allowing ..... Automated teller machine network pricing – A review of the.

  18. New Framework of Sustainable Indicators for Outdoor LED (Light Emitting Diodes Lighting and SSL (Solid State Lighting

    Directory of Open Access Journals (Sweden)

    Annika K. Jägerbrand

    2015-01-01

    Full Text Available Light emitting diodes (LEDs and SSL (solid state lighting are relatively new light sources, but are already widely applied for outdoor lighting. Despite this, there is little available information allowing planners and designers to evaluate and weigh different sustainability aspects of LED/SSL lighting when making decisions. Based on a literature review, this paper proposes a framework of sustainability indicators and/or measures that can be used for a general evaluation or to highlight certain objectives or aspects of special interest when choosing LED/SSL lighting. LED/SSL lighting is reviewed from a conventional sustainable development perspective, i.e., covering the three dimensions, including ecological, economic and social sustainability. The new framework of sustainable indicators allow prioritization when choosing LED/SSL products and can thereby help ensure that short-term decisions on LED/SSL lighting systems are in line with long-term sustainability goals established in society. The new framework can also be a beneficial tool for planners, decision-makers, developers and lighting designers, or for consumers wishing to use LED/SSL lighting in a sustainable manner. Moreover, since some aspects of LED/SSL lighting have not yet been thoroughly studied or developed, some possible future indicators are suggested.

  19. PERANCANGAN REPLIKASI BASIS DATA MYSQL DENGAN MEKANISME PENGAMANAN MENGGUNAKAN SSL ENCRYPTION

    Directory of Open Access Journals (Sweden)

    Herman Yuliansyah

    2014-01-01

    Full Text Available Karena faktor pentingnya data dan informasi pada organisasi small medium business (SMB, maka diperlukan suatu replikasi basis data sehingga jika terjadi suatu keadaan force majure, organisasi tersebut tidak akan mengalami kehilangan data. Replikasi basis data ini melibatkan paling sedikit 2 sistem basis data yang terhubung dalam suatu jaringan komputer. Konsep CIA Triad yaitu Confidentiality, Integrity dan Availability, merupakan dasar keamanan untuk mengelola data dan informasi. Keterkaitan antara faktor replikasi data dan keamanan informasi sangat perlu diperhatikan untuk diteliti lebih lanjut sehingga diharapkan dapat meningkatkan faktor keamanan data dalam jaringan komputer.Metodologi yang digunakan dalam penelitian ini yaitu dengan melakukan pengumpulan data terkait topik penelitian melalui studi pustaka, observasi, dan membuat pengujian di laboratorium dengan membuat simulasi replikasi basis data tanpa mekasnisme pengamanan dan melakukan pengujian keamanan komunikasinya kemudian membandingkannya dengan replikasi data dengan mekanisme pengamanan dengan SSL serta melakukan pengujian keamanan komunikasinya melalui proses penyadapan paket data yang dikirimkan dari server master dan server slave.Hasil dari penelitian ini dapat disimpulkan yaitu replikasi basis data MySQL dengan tanpa mekanisme pengamanan SSL memunculkan celah kemanan karena pesan yang dikirimkan dalam bentuk pesan plain tidak tersantikan. Sedangkan melalui penambahan dukungan SSL telah memberikan manfaat keamanan terhadap replikasi basis data MySQL, hal ini dibuktikan bahwa hasil proses penyadapan pesan terlihat paket data yang dikomunikasikan dari server master ke server slave sudah dalam keadaan terenkripsi.Kata Kunci : Replikasi basis data, MySQL, SSL Encryption.

  20. Polymer-based 2D/3D wafer level heterogeneous integration for SSL module

    NARCIS (Netherlands)

    Yuan, C.; Wei, J.; Ye, H.; Koh, S.; Harianto, S.; Nieuwenhof, M.A. van den; Zhang, G.Q.

    2012-01-01

    This paper demonstrates a heterogeneous integration of solid state lighting (SSL) module, including light source (LED) and driver/control components. Such integration has been realized by the polymer-based reconfigured wafer level package technologies and such structure has been prototyped and

  1. Numerical study of the spin-1 Ashkin-Teller model

    International Nuclear Information System (INIS)

    Bekhechi, S.; Badehdah, M.; Benyoussef, A.; Ettaki, B.

    1998-07-01

    Two non perturbative methods by means of the Transfer-Matrix Finite-Size-Scaling (TMFSS) and Monte Carlo (MC) simulations are used to investigate the spin-1 Ashkin-Teller model (A.T.M.). We have obtained rich phase diagrams with first and second order phase transitions with several multicritical points of higher order. Also this model exhibits a new partially ordered phase PO2 which does not exist in the spin-1/2 Ashkin-Teller model (A.T.M.). Finally, the critical behaviour of this model is discussed. (author)

  2. Gamow-Teller beta decay of proton-rich nuclei

    International Nuclear Information System (INIS)

    Klepper, O.; Rykaczewski, K.

    1990-11-01

    The beta decays of 48 Mn and of even-even nuclei near the double shell-closures at 100 Sn and 146 Gd are currently investigated at the GSI on-line mass separator. Their Gamow-Teller strength are surveyed in their present experimental status, together with related results from the ISOLDE (CERN) and ISOCELE (Orsay) separators, and are compared with predictions from different nuclear models. The strength of the 0 + → 1 + Gamow-Teller transitions is compiled in tables and graphs. (orig.)

  3. A SURVEY OF AUTOMATED TELLER MACHINE USAGE IN NORTH INDIA

    OpenAIRE

    Shweta Sankhwar*1 & Dhirendra Pandey2

    2017-01-01

    A machine that hand out cash or executes several banking services at a swipe of Automated Teller Machine (ATM) card in it. An ATM is a machine is use to withdraw cash using a debit card issued by a bank to the consumer(s). An ATM card is issued by a financial organization that permits user to access an Automated Teller Machine (ATM) such as to deposit amount, cash withdrawals, to check account information, etc. It is now preferred to cash by a large majority of the urban population in many ci...

  4. Transport of atrazine and dicamba through silt and loam soils

    Science.gov (United States)

    Tindall, James A.; Friedel, Michael J.

    2016-01-01

    The objectives of this research were to determine the role of preferential flow paths in the transport of atrazine (2-chloro-4-(ethylamino)-6-(isopropylamino)-s-triazine) and dicamba (3-6-dichloro-2-methoxybenzoic acid) through silt and loam soils overlying the High Plains aquifer in Nebraska. In a previous study, 3 of 6 study areas demonstrated high percentages of macropores; those three areas were used in this study for analysis of chemical transport. As a subsequent part of the study, 12 intact soil cores (30-cm diameter by 40-cm height), were excavated sequentially, two from each of the following depths: 0-40cm and 40-80cm. These cores were used to study preferential flow characteristics using dye staining and to determine hydraulic properties. Two undisturbed experimental field plots, each with a 3-m2 surface area, were installed in three study areas in Nebraska. Each was instrumented with suction lysimeters and tensiometers at depths of 10cm to 80cm in 10-cm increments. Additionally, each plot was planted with corn (Zea mays). A neutron probe access tube was installed in each plot to determine soil w ater content at 15-cm intervals. All plots were enclosed w ith a raised frame (of 8-cm height) to prevent surface runoff. All suction lysimeters were purged monthly for three months and were sampled immediately prior to pre-plant herbicide application to obtain background chemical concentrations. Atrazine and dicamba moved rapidly through the soil, but only after a heavy rainfall event, probably owing to the presence of preferential flow paths and lack of microbial degradation in these soil areas. Staining of laboratory cores showed a positive correlation between the percent area stained by depth and the subsequent breakthrough of Br- in the laboratory and leaching of field-applied herbicides owing to large rainfall events. Suction lysimeter samples in the field showed increases in concentrations of herbicides at depths where laboratory data indicated greater

  5. A Cyber Security Risk Assessment of Hospital Infrastructure including TLS/SSL and other Threats

    OpenAIRE

    Millar, Stuart

    2016-01-01

    Cyber threats traditionally target governments, financial institutions and businesses. However, of growing concern is the threat to healthcare organizations. This study conducts a cyber security risk assessment of a theoretical hospital environment, to include TLS/SSL, which is an encryption protocol for network communications, plus other physical, logical and human threats. Despite significant budgets in the UK for the NHS, the spend on cyber security appears worryingly low and many hospital...

  6. Enhancing the Current Automated Teller Machine (ATM) in Nigerian ...

    African Journals Online (AJOL)

    This is going to be achieved by creating another input device that collects the money into the ATM system, reads its denomination and either saves it or transfers it the required customer ... Keywords: Automated Teller Machine (ATM), Interswitch, Local Area Network (LAN), Wide Area Network (WAN), Telecommunication.

  7. Semi-classical behavior of Poschl-Teller coherent states

    Czech Academy of Sciences Publication Activity Database

    Bergeron, H.; Gazeau, J.P.; Siegl, Petr; Youssef, A.

    2010-01-01

    Roč. 92, č. 6 (2010), s. 60003 ISSN 0295-5075 R&D Projects: GA MŠk LC06002 Institutional research plan: CEZ:AV0Z10480505 Institutional support: RVO:61389005 Keywords : coherent states * Pöschl-Teller potential * quantization Subject RIV: BE - Theoretical Physics Impact factor: 2.753, year: 2010

  8. Classical motion and coherent states for Poeschl-Teller potentials

    International Nuclear Information System (INIS)

    Cruz y Cruz, S.; Kuru, S.; Negro, J.

    2008-01-01

    The trigonometric and hyperbolic Poeschl-Teller potentials are dealt with from the point of view of classical and quantum mechanics. We show that there is a natural correspondence between the algebraic structure of these two approaches for both kind of potentials. Then, the coherent states are constructed and the appropriate classical variables are compared with the expected values of their corresponding quantum operators

  9. One of My Favorite Assignments: Automated Teller Machine Simulation.

    Science.gov (United States)

    Oberman, Paul S.

    2001-01-01

    Describes an assignment for an introductory computer science class that requires the student to write a software program that simulates an automated teller machine. Highlights include an algorithm for the assignment; sample file contents; language features used; assignment variations; and discussion points. (LRW)

  10. Optimal capacity of Ashkin-Teller neural networks

    International Nuclear Information System (INIS)

    Kozleowski, P.; Bolle, D.

    2001-01-01

    The maximal capacity per number of couplings is calculated for Ashkin-Teller type neural networks using a replica-symmetric Gardner approach. The results are compared with numerical simulations. The best value obtained at κ=0 is α c =2.26±0.01

  11. Gamow teller strength from n-nucleus scattering

    International Nuclear Information System (INIS)

    Haeusser, O.

    1989-08-01

    Detailed studies of the spin-isospin structure of nuclear excitations are possible at TRIUMF's medium resolution spectrometer using the (n,p), ( p → , p →/ and (p,n) reactions. We discuss here results on isospin symmetry of inelastic nucleon scattering reactions populating isospin triads in A=6 and A=12 nuclei. The empirical ratio of L=0 isovector spin flip cross sections at 200-450 MeV and B(GT) for strong Gamow-Teller transitions in p-shell nuclei is found to be larger than calculated in the DWIA using a free NN t-matrix. Based on empirical values of σ/B(GT) the β + Gamow Teller strength function from (n,p) reactions on (sd) and (fp) shell targets is substantially quenched compared to current nuclear structure models using the free-nucleon axial-vector coupling constant. (Author) 33 refs., 6 figs

  12. Chiral filter, axial charges and Gamow-Teller strengths

    International Nuclear Information System (INIS)

    Rho, M.

    1983-09-01

    The different ways that nuclear matter responds to the weak axial-vector current are interpreted in terms of modification of the ''vacuum'' in baryon-rich environments. The notion of ''chiral filter'' is introduced. Use of a ward identity is suggested. The Gamow-Teller quenching and the enhanced axial charge in O + O - transitions follow from this. I also discuss briefly possible relevance of the nucleon as a topological soliton configuration to the global property of nuclear axial response functions

  13. A monitoring/auditing mechanism for SSL/TLS secured service sessions in Health Care Applications.

    Science.gov (United States)

    Kavadias, C D; Koutsopoulos, K A; Vlachos, M P; Bourka, A; Kollias, V; Stassinopoulos, G

    2003-01-01

    This paper analyzes the SSL/TLS procedures and defines the functionality of a monitoring/auditing entity running in parallel with the protocol, which is decoding, checking the certificate and permitting session establishment based on the decoded certificate information, the network addresses of the endpoints and a predefined access list. Finally, this paper discusses how such a facility can be used for detection impersonation attempts in Health Care applications and provides case studies to show the effectiveness and applicability of the proposed method.

  14. RANCANG BANGUN FILE TRANSFER PROTOCOL (FTP DENGAN PENGAMANAN OPEN SSL PADA JARINGAN VPN MIKROTIK DI SMK DWIWARNA

    Directory of Open Access Journals (Sweden)

    Devi Ruwaida

    2018-01-01

    Full Text Available File Transfer Protocol (FTP server merupakan jenis sistem yang menghubungkan hak pengakses (client dan penyedia (server dalam melakukan pertukaran data yang melewati port 21, yang semula ftp server berjalan pada protocol yang tidak terlindungi di dalam port 21, kemudian dengan OpenSSL ini di amankan agar data dapat sampai ke tujuan. Pada penelitian ini akan dibangun Rancang Bangun File Transfer Protocol (Ftp Dengan Pengamanan Open Ssl Pada Jaringan Vpn Mikrotik Di Smk Dwiwarna  yang akan di konfigurasi pada debian 9.1 dengan  di tambahnya pengaman sertifikat ssl , dengan harapan  melindungi proses dalam pengiriman data dapat dengan aman dan ditambahkannya sistem VPN PPTP pada mikrotik akan lebih memberikan keamanan yang lebih baik lagi, dimana pemanfaatan Point-to-Point Tunneling Protocol (PPTP suatu protokol jaringan yang bisa memungkinkan client dalam pengiriman data secara aman melalui remote client kepada server sekolah dibangunnya suatu virtual private network (VPN.

  15. influence of tillage practices on physical properties of a sandy loam

    African Journals Online (AJOL)

    DR. AMINU

    many regions of the world if the mechanics of tillage effects on soil physical properties is to be well understood. Thus, the ... tillage systems on water storage of a sandy loam soil after 22 years of ..... Soil infiltration ... and processes. Academy ...

  16. EFFECTS OF ALKALINE SANDY LOAM ON SULFURIC SOIL ACIDITY AND SULFIDIC SOIL OXIDATION

    Directory of Open Access Journals (Sweden)

    Patrick S. Michael

    2015-08-01

    Full Text Available  In poor soils, addition of alkaline sandy loam containing an adequate proportion of sand, silt and clay would add value by improving the texture, structure and organic matter (OM for general use of the soils. In acid sulfate soils (ASS, addition of alkaline sandy would improve the texture and leach out salts as well as add a sufficient proportion of OM for vegetation establishment. In this study, addition of alkaline sandy loam into sulfuric soil effectively increased the pH, lowered the redox and reduced the sulfate content, the magnitude of the effects dependent on moisture content. Addition of alkaline sandy loam in combination with OM was highly effective than the effects of the lone alkaline sandy loam. When alkaline sandy was added alone or in combination with OM into sulfidic soil, the effects on pH and the redox were similar as in the sulfuric soil but the effect on sulfate content was variable. The effects under aerobic conditions were higher than under anaerobic conditions. The findings of this study have important implications for the general management of ASS where lime availability is a concern and its application is limited.International Journal of Environment Volume-4, Issue-3, June-August 2015Page: 42-54

  17. Assessment of structural stability of a degraded sandy clay loam soil ...

    African Journals Online (AJOL)

    The effects of bare, two legumes and four grasses cover treatments on the structural stability of a sandy clay loam Ultisol were studied within a two year period. The experiment was of a randomised complete block design with seven treatments. The legume treatments were Centrosema pubescens (Ce) and Pueraria ...

  18. Pore structure characteristics after two years biochar application to a sandy loam field

    DEFF Research Database (Denmark)

    Sun, Zhencai; Arthur, Emmanuel; de Jonge, Lis Wollesen

    2015-01-01

    the effects of birch wood biochar (20, 40, and 100 Mg ha−1) applied to a sandy loam on soil total porosity and pore structure indices. Bulk and intact soil samples were collected for physicochemical analyses and water retention and gas diffusivity measurements between pF 1.0 and pF 3.0. Biochar application...

  19. Automatizace MitM útoku pro dešifrování SSL/TLS

    OpenAIRE

    Marušic, Marek

    2016-01-01

    Protokoly SSL/TLS sú používané pre šifráciu sieťovéhej prevádzky. Poskytujú bezpečnú komunikáciu medzi klientmi a servermi. Komunikácia môže byť odpočúvaná pomocou MitM útoku. Táto práca je zameraná na atuomatizovanie MitM útoku a demonštráciu jej výsledkov. Automatizáciou sa zjednoduší spustenie útoku bez nutnosti študovania rôznych manuálových stránok a aby sa používatelia vyhli pracnej konfigurácii MitM zariadenia a mohli jednoducho zachytiť a analyzovať SSL/TLS komunikáciu. Automatizácia ...

  20. Thermal Characterization and Lifetime Prediction of LED Boards for SSL Lamp

    Directory of Open Access Journals (Sweden)

    J. Formanek

    2013-04-01

    Full Text Available This work presents a detailed 3-D thermo-mechanical modelling of two LED board technologies to compare their performance. LED board are considered to be used in high power 800 lumen retrofit SSL (Solid State Lighting lamp. Thermal, mechanical and life time properties are evaluated by numerical modelling. Experimental results measured on fabricated LED board samples are compared to calculated data. Main role of LED board in SSL lamp is to transport heat from LED die to a heat sink and keep the thermal stresses in all layers as low as possible. The work focuses on improving of new LED board thermal management. Moreover, reliability and lifetime of LED board has been inspected by numerical calculation and validated by experiment. Thermally induced stress has been studied for wide temperature range that can affect the LED boards (-40 to +125°C. Numerical modelling of thermal performance, thermal stress distribution and lifetime has been carried out with ANSYS structural analysis where temperature dependent stress-strain material properties have been taken into account. The objective of this study is to improve not only the thermal performance of new LED board, but also identification of potential problems from mechanical fatigue point of view. Accelerated lifetime testing (e.g., mechanical is carried out in order to study the failure behaviour of current and newly developed LED board.

  1. Characterization of the alkaline laccase Ssl1 from Streptomyces sviceus with unusual properties discovered by genome mining.

    Directory of Open Access Journals (Sweden)

    Matthias Gunne

    Full Text Available Fungal laccases are well investigated enzymes with high potential in diverse applications like bleaching of waste waters and textiles, cellulose delignification, and organic synthesis. However, they are limited to acidic reaction conditions and require eukaryotic expression systems. This raises a demand for novel laccases without these constraints. We have taken advantage of the laccase engineering database LccED derived from genome mining to identify and clone the laccase Ssl1 from Streptomyces sviceus which can circumvent the limitations of fungal laccases. Ssl1 belongs to the family of small laccases that contains only few characterized enzymes. After removal of the twin-arginine signal peptide Ssl1 was readily expressed in E. coli. Ssl1 is a small laccase with 32.5 kDa, consists of only two cupredoxin-like domains, and forms trimers in solution. Ssl1 oxidizes 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid (ABTS and phenolic substrates like 2,6-dimethoxy phenol, guaiacol, and syringaldazine. The k(cat value for ABTS oxidation was at least 20 times higher than for other substrates. The optimal pH for oxidation reactions is substrate dependent: for phenolic substrates the highest activities were detected at alkaline conditions (pH 9.0 for 2,6-dimethoxy phenol and guaiacol and pH 8.0 for syringaldazine, while the highest reaction rates with ABTS were observed at pH 4.0. Though originating from a mesophilic organism, Ssl demonstrates remarkable stability at elevated temperatures (T(1/2,60°C = 88 min and in a wide pH range (pH 5.0 to 11.0. Notably, the enzyme retained 80% residual activity after 5 days of incubation at pH 11. Detergents and organic co-solvents do not affect Ssl1 stability. The described robustness makes Ssl1 a potential candidate for industrial applications, preferably in processes that require alkaline reaction conditions.

  2. Gamow Teller strength from charge exchange reactions at intermediate energies

    International Nuclear Information System (INIS)

    Haeusser, O.

    1989-07-01

    Detailed studies of the spin-isospin structure of nuclear excitations are possible at TRIUMF's medium resolution spectrometer using the (n,p), ( p → , p →/ ) and (p,n) reactions. We discuss here results on isospin symmetry of inelastic nucleon scattering reactions populating isospin triads in A=6 and A=12 nuclei. The β + Gamow Teller strength function from (n,p) reactions on (sd) and (fp) shell targets is found to be substantially quenched compared to current nuclear structure models using the free-nucleon axial-vector coupling constant. (Author) 22 refs., 3 figs

  3. Origin of Small Barriers in Jahn–Teller Systems

    DEFF Research Database (Denmark)

    Barriuso, M. T.; Ortiz-Sevilla, B.; Aramburu, J. A.

    2013-01-01

    . It is quantitatively proven that the elongated geometry observed for NaCl:Ni+ is due to the 3d–4s vibronic admixture, which is slightly larger than the anharmonicity in the eg JT mode that favors a compressed geometry. The existence of these two competing mechanisms explains the low value of B for the model system......Despite its relevance, the microscopic origin of the energy barrier, B, between the compressed and elongated geometries of Jahn–Teller (JT) systems is not well understood yet because of a lack of quantitative data about its various contributions. Seeking to clear up this matter, we have carried out...

  4. Four-dimensional Ashkin-Teller gauge theory

    International Nuclear Information System (INIS)

    Alcaraz, F.C.; Jacobs, L.

    1983-01-01

    The authors construct and analyze a lattice field theory of two Z 2 gauge fields which interact in a minimal gauge-invariant fashion. Although the theory presented here, a generalization of the two-dimensional Ashkin-Teller spin system, has no formal continuum limit, it is found that it has an electrodynamicslike phase similar to that observed in general Z/sub N/ theories for N> or =4. This model is probably the simplest generalization of the conventional Z 2 pure gauge theory which has a massless phase separated from the strong- and weak-coupling regions by lines of second-order phase transitions

  5. The spin symmetry for deformed generalized Poeschl-Teller potential

    International Nuclear Information System (INIS)

    Wei Gaofeng; Dong Shihai

    2009-01-01

    In the case of spin symmetry we solve the Dirac equation with scalar and vector deformed generalized Poeschl-Teller (DGPT) potential and obtain exact energy equation and spinor wave functions for s-wave bound states. We find that there are only positive energy states for bound states in the case of spin symmetry based on the strong regularity restriction condition λ<-η for the wave functions. The energy eigenvalue approaches a constant when the potential parameter α goes to zero. Two special cases such as generalized PT potential and standard PT potential are also briefly discussed.

  6. Formal verification of automated teller machine systems using SPIN

    Science.gov (United States)

    Iqbal, Ikhwan Mohammad; Adzkiya, Dieky; Mukhlash, Imam

    2017-08-01

    Formal verification is a technique for ensuring the correctness of systems. This work focuses on verifying a model of the Automated Teller Machine (ATM) system against some specifications. We construct the model as a state transition diagram that is suitable for verification. The specifications are expressed as Linear Temporal Logic (LTL) formulas. We use Simple Promela Interpreter (SPIN) model checker to check whether the model satisfies the formula. This model checker accepts models written in Process Meta Language (PROMELA), and its specifications are specified in LTL formulas.

  7. APPLICATION OF QUEUING THEORY TO AUTOMATED TELLER MACHINE (ATM) FACILITIES USING MONTE CARLO SIMULATION

    OpenAIRE

    UDOANYA RAYMOND MANUEL; ANIEKAN OFFIONG

    2014-01-01

    This paper presents the importance of applying queuing theory to the Automated Teller Machine (ATM) using Monte Carlo Simulation in order to determine, control and manage the level of queuing congestion found within the Automated Teller Machine (ATM) centre in Nigeria and also it contains the empirical data analysis of the queuing systems obtained at the Automated Teller Machine (ATM) located within the Bank premises for a period of three (3) months. Monte Carlo Simulation is applied to th...

  8. Benchmarking nuclear models for Gamow–Teller response

    International Nuclear Information System (INIS)

    Litvinova, E.; Brown, B.A.; Fang, D.-L.; Marketin, T.; Zegers, R.G.T.

    2014-01-01

    A comparative study of the nuclear Gamow–Teller response (GTR) within conceptually different state-of-the-art approaches is presented. Three nuclear microscopic models are considered: (i) the recently developed charge-exchange relativistic time blocking approximation (RTBA) based on the covariant density functional theory, (ii) the shell model (SM) with an extended “jj77” model space and (iii) the non-relativistic quasiparticle random-phase approximation (QRPA) with a Brueckner G-matrix effective interaction. We study the physics cases where two or all three of these models can be applied. The Gamow–Teller response functions are calculated for 208 Pb, 132 Sn and 78 Ni within both RTBA and QRPA. The strengths obtained for 208 Pb are compared to data that enable a firm model benchmarking. For the nucleus 132 Sn, also SM calculations are performed within the model space truncated at the level of a particle–hole (ph) coupled to vibration configurations. This allows a consistent comparison to the RTBA where ph⊗phonon coupling is responsible for the spreading width and considerable quenching of the GTR. Differences between the models and perspectives of their future developments are discussed.

  9. Benchmarking nuclear models for Gamow–Teller response

    Energy Technology Data Exchange (ETDEWEB)

    Litvinova, E., E-mail: elena.litvinova@wmich.edu [Department of Physics, Western Michigan University, Kalamazoo, MI 49008-5252 (United States); National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824-1321 (United States); Brown, B.A. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824-1321 (United States); National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824-1321 (United States); Fang, D.-L. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824-1321 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824-1321 (United States); Marketin, T. [Physics Department, Faculty of Science, University of Zagreb (Croatia); Zegers, R.G.T. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824-1321 (United States); National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824-1321 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824-1321 (United States)

    2014-03-07

    A comparative study of the nuclear Gamow–Teller response (GTR) within conceptually different state-of-the-art approaches is presented. Three nuclear microscopic models are considered: (i) the recently developed charge-exchange relativistic time blocking approximation (RTBA) based on the covariant density functional theory, (ii) the shell model (SM) with an extended “jj77” model space and (iii) the non-relativistic quasiparticle random-phase approximation (QRPA) with a Brueckner G-matrix effective interaction. We study the physics cases where two or all three of these models can be applied. The Gamow–Teller response functions are calculated for {sup 208}Pb, {sup 132}Sn and {sup 78}Ni within both RTBA and QRPA. The strengths obtained for {sup 208}Pb are compared to data that enable a firm model benchmarking. For the nucleus {sup 132}Sn, also SM calculations are performed within the model space truncated at the level of a particle–hole (ph) coupled to vibration configurations. This allows a consistent comparison to the RTBA where ph⊗phonon coupling is responsible for the spreading width and considerable quenching of the GTR. Differences between the models and perspectives of their future developments are discussed.

  10. Simulation and qualification of a system-in-package (SiP) based solid state lighting (SSL) module

    NARCIS (Netherlands)

    Farley, D.M.; Boschman, F.; Bullema, J.E.; Gielen, A.W.J.; Hesen, P.; Krugers, J.P.H.M.; Swartjes, F.; Zeijl, H. van; Zhang, G.Q.

    2012-01-01

    The reliability assessment aspect of the LED field is not fully developed. The lack of complete understanding is due, in part, to the newness of the field. SSL has not existed long enough to directly gauge the accuracy of the Lifetime Assessments being made. The approach of using simulation in

  11. Long-Term Evaluation of SSL Field Performance in Select Interior Projects

    Energy Technology Data Exchange (ETDEWEB)

    Perrin, Tess E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Davis, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wilkerson, Andrea M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-02-28

    This GATEWAY project evaluated four field installations to better understand the long-term performance of a number of LED products, which can hopefully stimulate improvements in designing, manufacturing, specifying, procuring, and installing LED products. Field studies provide the opportunity to discover and investigate issues that cannot be simulated or uncovered in a laboratory, but the installed performance over time of commercially available LED products has not been well documented. Improving long-term performance can provide both direct energy savings by reducing the need to over-light to account for light loss and indirect energy savings through better market penetration due to SSL’s competitive advantages over less-efficient light source technologies. The projects evaluated for this report illustrate that SSL use is often motivated by advantages other than energy savings, including maintenance savings, easier integration with control systems, and improved lighting quality.

  12. Advanced optical design and control of multi-colored SSL system for stage lighting application

    DEFF Research Database (Denmark)

    Chakrabarti, Maumita

    , the light output from the light engine is energy and optically efficient as well as environmentally friendly. The light output stability during the operational time is investigated by using the Monte Carlo simulation and a color sensor is implemented along with the pre‐calibrated lookup table to a feedback...... system in order to provide controlled color and intensity variations within certain limits. By implementing the control mechanism, system‐to‐system calibration is possible. The control mechanism can be generalized to be used in any other SSL system. Instead of using a color sensor, the variation......The thesis deals with a novel LED color mixing light engine which is designed, developed, and subsequently demonstrated by making a prototype of the same, which is experimentally investigated. Further, the design optimization solves the problems of achieving collimated high luminous flux in a color...

  13. Report on Computing and Networking in the Space Science Laboratory by the SSL Computer Committee

    Science.gov (United States)

    Gallagher, D. L. (Editor)

    1993-01-01

    The Space Science Laboratory (SSL) at Marshall Space Flight Center is a multiprogram facility. Scientific research is conducted in four discipline areas: earth science and applications, solar-terrestrial physics, astrophysics, and microgravity science and applications. Representatives from each of these discipline areas participate in a Laboratory computer requirements committee, which developed this document. The purpose is to establish and discuss Laboratory objectives for computing and networking in support of science. The purpose is also to lay the foundation for a collective, multiprogram approach to providing these services. Special recognition is given to the importance of the national and international efforts of our research communities toward the development of interoperable, network-based computer applications.

  14. Prognostics of damage accural in SSL luminaires and drivers subjected to HTSL accelerated aging

    Energy Technology Data Exchange (ETDEWEB)

    Lall, Pradeep [Auburn Univ., AL (United States); Sakalaukus, Peter [Auburn Univ., AL (United States); Davis, Lynn [RTI International, Research Triangle Park, NC (United States)

    2013-07-16

    This paper will show an investigation of off-the-shelf luminaires with the focus on the LED electronic drivers, specifically the aluminum electrolytic capacitors (AECs), that have been aged using high temperature shelf life (HTSL) testing of 135°C in order to prognosticate the remaining useful life of the luminaires. Luminaires have the potential of seeing excessive temperatures when being transported across country or being stored in non-climate controlled warehouses. They are also being used in outdoor applications in desert environments that see little or no humidity but will experience extremely high temperatures during the day. This makes it important to increase our understanding of what effects being stored at high temperatures for a prolonged period of time will have on the usability and survivability of these devices. The U.S. Department of Energy has made a long term commitment to advance the efficiency, understanding and development of solid-state lighting (SSL) and is making a strong push for the acceptance and use of SSL products. In this work, the four AECs of three different types inside each LED electronic driver were studied. The change in capacitance and the change in equivalent series resistance (ESR) of the AECs were measured and considered to be a leading indication of failure of the LED system. These indicators were used to make remaining useful life predictions to develop an algorithm to predict the end of life of the AECs. The luminous flux of a pristine downlight module was also monitored using each LED electronic driver that was subjected to HTSL through the progression of the testing to determine a correlation between the light output of the lamp and the failing components of the LED electronic driver. Prognostic and Health Management (PHM) is a useful tool for assessment of the remaining life of electrical components and is demonstrated for AECs in this work.

  15. Determination of Selenium Toxicity for Survival and Reproduction of Enchytraeid Worms in a Sandy Loam Soil

    Science.gov (United States)

    2016-07-01

    LOAM SOIL ECBC-TR-1388 Roman G. Kuperman Ronald T. Checkai Michael Simini Carlton T. Phillips RESEARCH AND TECHNOLOGY DIRECTORATE Richard M...plastic wrap was stretched over the top of each container and secured with a rubber band. Three pinholes were made in the plastic wrap to 6...172–178. Glover, J.; Levander, O.; Parizek, J.; Vouk, V. Selenium. In Handbook on the Toxicology of Metals; Friberg, L., Norberg, G.F., Vouk, V.B

  16. Gamow-Teller matrix elements from 00 ( p,n) cross section

    International Nuclear Information System (INIS)

    Goodman, C.D.; Goulding, C.A.; Greenfield, M.B.; Rapaport, J.; Bainum, D.E.; Foster, C.C.; Love, W.G.; Petrovich, F.

    1980-01-01

    After simple corrections for distortion effects, 120-MeV, 0 0 (p,n) cross sections are found to be proportional to the squares of the corresponding Fermi and Gamow-Teller matrix elements extracted from β-decay measurements. It is suggested that this proportionality can be used to extract Gamow-Teller matrix elements for transitions inaccessible to β decay

  17. Jahn-teller domains and magnetic domains in Mn2FeO4

    NARCIS (Netherlands)

    Kub, J.; Brabers, V.A.M.; Novák, P.; Gemperle, R.; Simsova, J.

    2000-01-01

    Elastic (Jahn–Teller) domains and magnetic domains in the tetragonal spinel Mn2FeO4 were studied using X-ray double-crystal topography, X-ray diffractometry and the colloid-SEM method. The Jahn–Teller domains of the measured samples are tetragonal with the [0 0 1] c-axis alternating perpendicularly

  18. Jahn Teller effect of cations in water: The cupric ion in water

    Energy Technology Data Exchange (ETDEWEB)

    Halley, J.W. [Minnesota Univ., Minneapolis, MN (United States). School of Physics and Astronomy; Wang, X.R. [Hong Kong Univ. of Science and Technology, Kowlon (Hong Kong). Dept. of Physics; Curtiss, L.A. [Argonne National Lab., IL (United States)

    1993-02-01

    We report a molecular dynamics model for the Jahn Teller effect in the solvation shell of a cation in solution in an aqueous liquid. We apply the model to the cupric ion and compare results with results of neutron scattering experiments on copper chlorate solutions. We conclude that the original interpretation of the experiments in terms of a Jan Teller effect may require modification.

  19. What makes an automated teller machine usable by blind users?

    Science.gov (United States)

    Manzke, J M; Egan, D H; Felix, D; Krueger, H

    1998-07-01

    Fifteen blind and sighted subjects, who featured as a control group for acceptance, were asked for their requirements for automated teller machines (ATMs). Both groups also tested the usability of a partially operational ATM mock-up. This machine was based on an existing cash dispenser, providing natural speech output, different function menus and different key arrangements. Performance and subjective evaluation data of blind and sighted subjects were collected. All blind subjects were able to operate the ATM successfully. The implemented speech output was the main usability factor for them. The different interface designs did not significantly affect performance and subjective evaluation. Nevertheless, design recommendations can be derived from the requirement assessment. The sighted subjects were rather open for design modifications, especially the implementation of speech output. However, there was also a mismatch of the requirements of the two subject groups, mainly concerning the key arrangement.

  20. Jahn-Teller effect in molecular electronics: quantum cellular automata

    Science.gov (United States)

    Tsukerblat, B.; Palii, A.; Clemente-Juan, J. M.; Coronado, E.

    2017-05-01

    The article summarizes the main results of application of the theory of the Jahn-Teller (JT) and pseudo JT effects to the description of molecular quantum dot cellular automata (QCA), a new paradigm of quantum computing. The following issues are discussed: 1) QCA as a new paradigm of quantum computing, principles and advantages; 2) molecular implementation of QCA; 3) role of the JT effect in charge trapping, encoding of binary information in the quantum cell and non-linear cell-cell response; 4) spin-switching in molecular QCA based on mixed-valence cell; 5) intervalence optical absorption in tetrameric molecular mixed-valence cell through the symmetry assisted approach to the multimode/multilevel JT and pseudo JT problems.

  1. Off-center Jahn-Teller ion: coupled polar and tetragonal deformations

    International Nuclear Information System (INIS)

    Vikhnin, V.S.; Sochava, L.S.

    1979-01-01

    Models of the off-center Jahn-Teller ions are considered, i.e. Ni + in SrO and Cu 27 in SrO studied earlier. Models of the off-center Jahn-Teller ion are proposed, in which mutual effect of dipole-active deformations conditioning off-centering and the Jahn-Teller tetragonal deformations takes place. Manifestations of a new type of multipit potential XY 24 of an off-center ion are considered. The Jahn-Teller effect (JTE) is studied for a duplicate in cubic environment, unharmonism of the fourth order being taken into account. In such a model of Exe of JTE, the position and quantity of minima of adiabatic potential are changed as compared with Exe of JTE taking account of unharmonism of the third order or the square Jahn-Teller interaction. While using models of the off-center Jahn-Teller ion which take account of the effect of two tetragonal Jahn-Teller deformations occurring in the Exe problem considering unharmonism of the fourth order produced on dipole-active deformations, it becomes possible to explain the experiment for SrO:Ni +

  2. Model-Based Design of Brushless DC Motor Control and Motion Control Modelling for RoboCup SSL Robots

    OpenAIRE

    Li, Xiaotian

    2015-01-01

    Over the recent years, the RoboCup competition has grown popular and attracted more and more domestic and international universities, and the levels of the teams increase every year. In Small Size League (SSL) competition, besides a good strategy system, the precision of the robots’ actions is also of vital importance in order to achieve high performance. Thus, a highly accurate and stable motion control system is needed to drive the robots to move in accordance with the planned trajectory. C...

  3. Measurement of angular differential cross sections at the SSL Atomic Scattering Facility

    International Nuclear Information System (INIS)

    Kvale, T.J.

    1988-01-01

    The design of the SSL Atomic Scattering Facility (ASF) located at the NASA/Marshall Space Flight Center as well as some of the initial experiments to be performed with it, are covered. The goal is to develop an apparatus capable of measuring angular differential cross sections (ADCS) for the scattering of 2 to 14 eV atomic oxygen from various gaseous targets. At present little is known about atomic oxygen scattering with kinetic energies of a few eV. This apparatus is designed to increase the understanding of collisions in this energy region. Atomic oxygen scattering processes are of vital interest to NASA because the space shuttle as well as other low earth orbit satellites will be subjected to a flux of 5 eV atomic oxygen on the ram surfaces while in orbit. The primary experiments will involve the measurements of ADCS for atomic oxygen scattering from gaseous targets (in particular, molecular nitrogen). These, as well as the related initial experiments involving thermal He scattering from N2 and O2 targets will be described

  4. The Hintermann-Merlini-Baxter-Wu and the infinite-coupling-limit Ashkin-Teller models

    Energy Technology Data Exchange (ETDEWEB)

    Huang Yuan, E-mail: huangy22@mail.ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Deng Youjin, E-mail: yjdeng@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Jacobsen, Jesper Lykke, E-mail: jacobsen@lpt.ens.fr [Laboratoire de Physique Theorique, Ecole Normale Superieure, 24 rue Lhomond, 75231 Paris (France); Universite Pierre et Marie Curie, 4 place Jussieu, 75252 Paris (France); Salas, Jesus, E-mail: jsalas@math.uc3m.es [Grupo de Modelizacion, Simulacion Numerica y Matematica Industrial, Universidad Carlos III de Madrid, Avda. de la Universidad 30, 28911 Leganes (Spain); Grupo de Teorias de Campos y Fisica Estadistica, Instituto Gregorio Millan, Universidad Carlos III de Madrid, Unidad asociada al IEM-CSIC, Madrid (Spain)

    2013-03-11

    We show how the Hintermann-Merlini-Baxter-Wu model (which is a generalization of the well-known Baxter-Wu model to a general Eulerian triangulation) can be mapped onto a particular infinite-coupling-limit of the Ashkin-Teller model. We work out some mappings among these models, also including the standard and mixed Ashkin-Teller models. Finally, we compute the phase diagram of the infinite-coupling-limit Ashkin-Teller model on the square, triangular, hexagonal, and kagome lattices.

  5. The Phenalenyl Free Radical - a Jahn-Teller D3H PAH

    Science.gov (United States)

    O'Connor, G. D.; Troy, T. P.; Roberts, D. A.; Chalyavi, N.; Fückel, B.; Crossley, M. J.; Nauta, K.; Schmidt, T. W.; Stanton, J. F.

    2012-06-01

    After benzene and naphthalene, the smallest polycyclic aromatic hydrocarbon bearing six-membered rings is the threefold-symmetric phenalenyl radical. Despite the fact that it is so fundamental, its electronic spectroscopy has not been rigorously scrutinized, in spite of growing interest in graphene fragments for molecular electronic applications. Here we used complementary laser spectroscopic techniques to probe the jet-cooled phenalenyl radical in vacuo. Its spectrum reveals the interplay between four electronic states that exhibit Jahn-Teller and pseudo-Jahn-Teller (Herzberg-Teller) vibronic coupling. The coupling mechanism has been elucidated by the application of various ab initio quantum-chemical techniques.

  6. Interaction of the Bored Sand and Gravel Drain Pile with the Surrounding Compacted Loam Soil and Foundation Raft Taking into Account Rheological Properties of the Loam Soil and Non-Linear Properties of the Drain Pile

    Science.gov (United States)

    Ter-Martirosyan, Z. G.; Ter-Martirosyan, A. Z.; Anzhelo, G. O.; Buslov, A. S.

    2018-01-01

    The task of the interaction of the sand and gravel drain pile with the surrounding loam soil after its preliminary deep compaction and formation of the composite ground cylinder from the drain pile and surrounding compacted loam soil (cells) is considered in the article. It is seen that the subsidence and carrying capacity of such cell considerably depends on physical and mechanical properties of the compacted drain piles and surrounding loam soil as well as their diameter and intercellular distance. The strain-stress state of the cell is considered not taking into account its component elements, but taking into account linear and elastic-plastic properties of the drain pile and creep flow of the surrounding loam soil. It is stated that depending on these properties the distribution and redistribution of the load on a cell takes place from the foundation raft between the drain pile and surrounding soil. Based on the results of task solving the formulas and charts are given demonstrating the ratio of the load between the drain pile and surrounding loam soil in time.

  7. Bethe, Oppenheimer, Teller and the Fermi Award: Norris Bradbury Speaks

    Energy Technology Data Exchange (ETDEWEB)

    Meade, Roger Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-04-28

    In 1956 the Enrico Fermi Presidential Award was established to recognize scientists, engineers, and science policymakers who gave unstintingly over their careers to advance energy science and technology. The first recipient was John von Neumann. .1 Among those scientists who were thought eligible for the award were Hans Bethe, J. Robert Oppenheimer, and Edward Teller. In 1959 Norris Bradbury was asked to comment on the relative merits of each these three men, whom he knew well from their affiliation with Los Alamos. Below is a reproduction of the letter Bradbury sent to Dr. Warren C. Johnson of the AEC’s General Advisory Committee(GAC) containing his evaluation of each man. The letter might surprise those not accustomed to Bradbury’s modus operandi of providing very detailed and forthright answers to the AEC. The letter, itself, was found in cache of old microfilm. Whether because of the age of the microfilm or the quality of the filming process, portions of the letter are not legible. Where empty brackets appear, the word or words could not be read or deduced. Words appearing in brackets are guesses that appear, from the image, to be what was written. These guesses, of course, are just that – guesses.

  8. Is talking to an automated teller machine natural and fun?

    Science.gov (United States)

    Chan, F Y; Khalid, H M

    Usability and affective issues of using automatic speech recognition technology to interact with an automated teller machine (ATM) are investigated in two experiments. The first uncovered dialogue patterns of ATM users for the purpose of designing the user interface for a simulated speech ATM system. Applying the Wizard-of-Oz methodology, multiple mapping and word spotting techniques, the speech driven ATM accommodates bilingual users of Bahasa Melayu and English. The second experiment evaluates the usability of a hybrid speech ATM, comparing it with a simulated manual ATM. The aim is to investigate how natural and fun can talking to a speech ATM be for these first-time users. Subjects performed the withdrawal and balance enquiry tasks. The ANOVA was performed on the usability and affective data. The results showed significant differences between systems in the ability to complete the tasks as well as in transaction errors. Performance was measured on the time taken by subjects to complete the task and the number of speech recognition errors that occurred. On the basis of user emotions, it can be said that the hybrid speech system enabled pleasurable interaction. Despite the limitations of speech recognition technology, users are set to talk to the ATM when it becomes available for public use.

  9. Testing the Quick Seismic Event Locator and Magnitude Calculator (SSL_Calc) by Marsite Project Data Base

    Science.gov (United States)

    Tunc, Suleyman; Tunc, Berna; Caka, Deniz; Baris, Serif

    2016-04-01

    Locating and calculating size of the seismic events is quickly one of the most important and challenging issue in especially real time seismology. In this study, we developed a Matlab application to locate seismic events and calculate their magnitudes (Local Magnitude and empirical Moment Magnitude) using single station called SSL_Calc. This newly developed sSoftware has been tested on the all stations of the Marsite project "New Directions in Seismic Hazard Assessment through Focused Earth Observation in the Marmara Supersite-MARsite". SSL_Calc algorithm is suitable both for velocity and acceleration sensors. Data has to be in GCF (Güralp Compressed Format). Online or offline data can be selected in SCREAM software (belongs to Guralp Systems Limited) and transferred to SSL_Calc. To locate event P and S wave picks have to be marked by using SSL_Calc window manually. During magnitude calculation, instrument correction has been removed and converted to real displacement in millimeter. Then the displacement data is converted to Wood Anderson Seismometer output by using; Z=[0;0]; P=[-6.28+4.71j; -6.28-4.71j]; A0=[2080] parameters. For Local Magnitude calculation,; maximum displacement amplitude (A) and distance (dist) are used in formula (1) for distances up to 200km and formula (2) for more than 200km. ML=log10(A)-(-1.118-0.0647*dist+0.00071*dist2-3.39E-6*dist3+5.71e-9*dist4) (1) ML=log10(A)+(2.1173+0.0082*dist-0.0000059628*dist2) (2) Following Local Magnitude calculation, the programcode calculates two empiric Moment Magnitudes using formulas (3) Akkar et al. (2010) and (4) Ulusay et al. (2004). Mw=0.953* ML+0.422 (3) Mw=0.7768* ML+1.5921 (4) SSL_Calc is a software that is easy to implement and user friendly and offers practical solution to individual users to location of event and ML, Mw calculation.

  10. Cadmium phytoextraction from loam soil in tropical southern China by Sorghum bicolor.

    Science.gov (United States)

    Wang, Xu; Chen, Can; Wang, Jianlong

    2017-06-03

    The cadmium (Cd) uptake characteristics by Sorghum bicolor cv. Nengsi 2# and Cowley from the acidic sandy loam soil (pH = 6.1) during the entire growth period (100 days) were investigated in pot outdoors in a tropical district of southern China, Hainan Island. The Cd-spiked levels in soil were set as 3 and 15 mg/kg. Correspondingly, the available Cd levels in soil extracted by Mehlich III solution were 2.71 and 9.41 mg/kg, respectively. Basically, two varieties in a full growth period (100 days) did not show a significant difference in their growth and Cd uptake. Under high Cd stress, the plant growth was inhibited and its biomass weight and height decreased by 38.7-51.5% and 27.6-28.5%, respectively. However, S. bicolor showed higher bioaccumulation capability of Cd from soil to plant [bioconcentration factor (BCF)>4], and higher transfer capability of Cd from roots to shoots [translocation factor (TF)>1] under high Cd stress; Cd contents in the roots, stems, and leaves of S. bicolor reached 43.79-46.07, 63.28-70.60, and 63.10-66.06 mg/kg, respectively. S. bicolor exhibited the potential phytoextraction capability for low or moderate Cd-contamination in acidic sandy loam soil.

  11. Comment on "Histories and Horoscopes: The Ethnographer as Fortune-Teller."

    Science.gov (United States)

    Luttrell, Wendy

    1998-01-01

    Explores the analogy of the researcher as fortune teller and the parallels between research histories and horoscopes and discusses the tension between what the subject is and what he or she is imagined to be by others. (SLD)

  12. The effect of automated teller machines on banks' services in Nigeria

    African Journals Online (AJOL)

    AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search ... work is to find out the effects of Automated Teller Machines (ATM) on Bank's services. ... used by successful organizations for gaining competitive advantage over others.

  13. Lorentz-Lorenz quenching for the Gamow-Teller sum rule

    International Nuclear Information System (INIS)

    Delorme, J.; Ericson, M.; Figureau, A.

    1984-03-01

    We investigate the modification of the Gamow-Teller sum rule brought in by nucleonic excitations. The general trend of the data is well reproduced. The value of the force which mixes nucleonic and nuclear excitations is discussed

  14. Occupational Noise Exposure among Toll Tellers at Toll Plaza in Malaysia

    Science.gov (United States)

    Azmi, Sharifah Nadya Syed; Dawal, Siti Zawiah Md; Ya, Tuan Mohammad Yusoff Shah Tuan; Saidin, Hamidi

    2010-10-01

    Toll tellers working at toll plaza have potential of exposure to high noise from the vehicles especially for the peak level of sound emitted by the heavy vehicles. However, occupational exposures in this workplace have not been adequately characterized and identified. Occupational noise exposure among toll tellers at toll plaza was assessed using Sound Level Meter, Noise Dosimeter and through questionnaire survey. These data were combined to estimate the work shift exposure level and health impacts to the toll tellers by using statistical analysis. Noise Dosimeter microphone was located at the hearing zone of the toll teller which working inside the toll booth and full-period measurements were collected for each work shift. The measurements were taken at 20 toll booths from 6.00 am to 2.00 pm for 5 days. 71 respondents participated in the survey to identify the symptoms of noise induced hearing loss and other health related problems among toll tellers. Results of this study indicated that occupational noise exposure among toll tellers for Mean Continuous Equivalent Level, Leq was 79.2±1.4 dB(A), Mean Maximum Level, Lmax was 107.8±3.6 dB(A) and Mean Peak Level, Lpeak was 136.6±9.9 dB. The Peak Level reported statistically significantly at 140 dB, the level of TLV recommended by ACGIH. The research findings indicated that the primary risk exposure to toll tellers comes from noise that emitted from heavy vehicles. Most of the toll tellers show symptoms of noise induced hearing loss and annoyed by the sources of noise at the toll plaza.

  15. Effect of Simulated Weathering and Aging of TNT in Amended Sandy Loam Soil on Toxicity to the Enchytraeid Worm, Enchytreaeus Crypticus

    National Research Council Canada - National Science Library

    Kuperman, Roman G; Checkai, Ronald T; Simini, Michael; Phillips, Carlton T; Kolakowski, Jan E; Kurnas, Carl W

    2006-01-01

    ...) for the ecological risk assessment of contaminants at Superfund sites. Insufficient information for TNT to generate Eco-SSL for soil invertebrates has necessitated standardized toxicity testing to fill the data gap...

  16. Effect of biochar on aerobic processes, enzyme activity, and crop yields in two sandy loam soils

    DEFF Research Database (Denmark)

    Sun, Zhencai; Bruun, Esben; Arthur, Emmanuel

    2014-01-01

    Biochar added to agricultural soils may sequester carbon and improve physico-chemical conditions for crop growth, due to effects such as increased water and nutrient retention in the root zone. The effects of biochar on soil microbiological properties are less certain. We addressed the effects...... of wood-based biochar on soil respiration, water contents, potential ammonia oxidation (PAO), arylsulfatase activity (ASA), and crop yields at two temperate sandy loam soils under realistic field conditions. In situ soil respiration, PAO, and ASA were not significantly different in quadruplicate field...... plots with or without biochar (20 Mg ha−1); however, in the same plots, volumetric water contents increased by 7.5 % due to biochar (P = 0.007). Crop yields (oat) were not significantly different in the first year after biochar application, but in the second year, total yields of spring barley increased...

  17. Migration of Co and Cs radionuclides through a loam soil column

    International Nuclear Information System (INIS)

    Syed Hakimi Sakuma bin Syed Ahmad; Shimooka, K.

    1990-01-01

    A soil column experiment was conducted to determine the migration of Co and Cs radionuclides through a loam soil. The different migration rates of the radionuclides at low and high concentrations were determined at pH 7. Retardation factor (Rf) both the radionuclides at low and high concentrations were determined by fitting adsorbed concentration distribution equations to observed values. The calculation shows that the Rf1=500 and Rf2=3 for Co at high and low concentrations, respectively. For Cs, the Rf1=600 and Rf2=5 at high and low concentrations, respectively. The results shows that major portions of both the radionuclides were adsorbed onto the soil layer at the top by ion exchange mechanism which resulted in the high retardation factor values. Minor portions had migrated downwards as insoluble cations, pseudocolloids and very fine silt particles resulting in the low retardation factor

  18. Degradation of roxarsone in a silt loam soil and its toxicity assessment.

    Science.gov (United States)

    Liang, Tengfang; Ke, Zhengchen; Chen, Qing; Liu, Li; Chen, Guowei

    2014-10-01

    The land application of poultry or swine litter, containing large amounts of roxarsone, causes serious arsenic pollution in soil. Understanding biotransformation process of roxarsone and its potential risks favors proper disposal of roxarsone-contaminated animal litter, yet remains not achieved. We report an experimental study of biotransformation process of roxarsone in a silt loam soil under various soil moisture and temperature conditions, and the toxicity of roxarsone and its products from degradation. Results showed that soil moisture and higher temperature promoted roxarsone degradation, associating with emergent pentavalent arsenic. Analysis of fluorescein diacetate (FDA) hydrolysis activity revealed that roxarsone does not exert acute toxic on soil microbes. With the release of inorganic arsenic, FDA hydrolysis activity was inhibited gradually, as evidenced by ecotoxicological assessment using Photobacterium leiognathi. The results shade new lights on the dynamic roxarsone biotransformation processes in soil, which is important for guiding appropriate disposal of poultry or swine litter in the environment. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Neutron Gauge Calibration Curve as Affected by Chloride Concentration and Bulk Density of Loam Soil

    International Nuclear Information System (INIS)

    AL-Hasani, A.A.; Fahad, A.A.; Shihab, R.M.

    2010-01-01

    chloride concentration and bulk density are considered among important factors affecting calibration curve of neutron gauge in the soil.The aim of this study was to investigate the effect of chloride concentration and bulk density of a loam soil on neutron gauge calibration curve.Sufficient amount of loam soil was air dried screened through a 2 mm sieve,and divided into three equal portions.Sodium chloride of 2.5 and 6.6g kg'-1 soil was added to the first and second portions,respectively.The third portion was left as a control.The soil then moistened and mixed well to make volumetric water content within the range of 0.01 to 0.24 cm 3 cm - 3. The moist soil was packed into an iron drum 0.80 m diameter and 1.00 m height to obtain bulk densities of 1.10 and 1.30 to 1.60 Mg m - 3 for uncompacted soil,respectively.Access tube 0.05 m inner diameter was installed in the center of the drum.Three readings from CPN 503 neutron gauge were taken at each 0.15,0.30, 0.45,and 0.75 m depth.Results indicated that the count (counts/standard count) for an aqueous solution decreased with the increase in chloride concentration.Similarly, the slope of the linear calibration curves of the investigated soil decreased with the increase in chloride concentration.Shifting of the curves was 9 to 10%for the uncompacted soil, whereas it was 12 to 14 % for the compacted of low and high concentration of chloride, respectively . Results of changing bulk density always reduced the slope value as compared with the uncorrected count ratio.

  20. The vibrational Jahn–Teller effect in E⊗e systems

    Energy Technology Data Exchange (ETDEWEB)

    Thapaliya, Bishnu P.; Dawadi, Mahesh B.; Ziegler, Christopher; Perry, David S., E-mail: dperry@uakron.edu

    2015-10-16

    Highlights: • The vibrational Jahn–Teller effect is documented for three E⊗e molecular systems. • The spontaneous vibrational Jahn–Teller distortion is very small. • Vibrational Jahn–Teller splittings are substantial (1–60 cm{sup −1}). • Vibrational conical intersections in CH{sub 3}OH are accessible at low energies. - Abstract: The Jahn–Teller theorem is applied in the vibrational context where degenerate high-frequency vibrational states (E) are considered as adiabatic functions of low-frequency vibrational coordinates (e). For CH{sub 3}CN and Cr(C{sub 6}H{sub 6})(CO){sub 3}, the global minimum of the non-degenerate electronic potential energy surface occurs at the C{sub 3v} geometry, but in CH{sub 3}OH, the equilibrium geometry is far from the C{sub 3v} reference geometry. In the former cases, the computed spontaneous Jahn–Teller distortion is exceptionally small. In methanol, the vibrational Jahn–Teller interaction results in the splitting of the degenerate E-type CH stretch into what have been traditionally assigned as the distinct ν{sub 2} and ν{sub 9} vibrational bands. The ab initio vibrational frequencies are fit precisely by a two-state high-order Jahn–Teller Hamiltonian (Viel and Eisfeld, 2004). The presence of vibrational conical intersections, including 7 for CH{sub 3}OH, has implications for spectroscopy, for geometric phase, and for ultrafast localized non-adiabatic energy transfer.

  1. Penentuan Jumlah Teller Optimum Dengan Menggunakan Teknik Simulasi ProModel di PT Bank Sumut Cabang Utama Medan

    OpenAIRE

    Handoko, Rio

    2012-01-01

    Sistem antrian yang diterapkan pada PT. Bank Sumut Cabang Utama Medan menerapkan sistem antrian FIFO / FCFS (First Come First Serve. Pada PT. Bank Sumut Cabang Utama Medan terdapat sepuluh teller atau server yang bertugas melayani pelanggan. Setiap pelanggan yang datang wajib mengambil nomor antrian kemudian menunggu untuk dipanggil oleh teller yang kosong dan kemudian melakukan transaksi. Teller yang telah selesai melayani satu pelanggan kemudian menekan tombol agar antrian berikutnya dapat ...

  2. Task clarification, performance feedback, and social praise: Procedures for improving the customer service of bank tellers.

    Science.gov (United States)

    Crowell, C R; Anderson, D C; Abel, D M; Sergio, J P

    1988-01-01

    Customer service for bank tellers was defined in terms of 11 verbal behavior categories. An audio-recording system was used to track the occurrence of behaviors in these categories for six retail banking tellers. Three behavior management interventions (task clarification, performance feedback, and social praise), applied in sequence, were designed to improve overall teller performance with regard to the behavioral categories targeted. Clarification was accomplished by providing clear delineation of the various target categories, with specific examples of the behaviors in each. Feedback entailed presentation of ongoing verbal and visual information regarding teller performance. Praise consisted of verbal recognition of teller performance by branch managers. Results showed that clarification effects emerged quickly, producing an overall increase in desired behaviors of 12% over baseline. Feedback and praise effects occurred more gradually, resulting in overall increases of 6% and 7%, respectively. A suspension of all procedures led to a decline in overall performance, whereas reinstatement of feedback and praise was again accompanied by performance improvement. These findings extend the generality of behavior management applications and help to distinguish between possible antecedent and consequent effects of performance feedback.

  3. Průběžné testování interoperability knihoven TLS/SSL

    OpenAIRE

    Šumšal, František

    2017-01-01

    Cílem této práce je implementace systému pro testování Secure Socket Layer (SSL) / Transport Layer Security (TLS) knihoven na podporovaných systémech a jeho využití na rozšířené sadě testů pro verifikaci jejich interoperability. Tento systém umožňuje jak průběžné testování, tak testování na vyžádání pro specifickou verzi knihovny. Hlavním přínosem této práce je zajištění inteoperability nejznámějších SSL/TLS knihoven již ve fázi vývoje a detekce chyb v co nejkratším čase. Výsledky této práce ...

  4. Jahn-Teller effect fundamentals and implications for physics and chemistry

    CERN Document Server

    Koppel, Horst; Barentzen, Heinz

    2009-01-01

    The Jahn-Teller effect continues to be a paradigm for structural instabilities and dynamical processes in molecules and in the condensed phase. While the basic theorem, first published in 1937, had to await experimental verification for 15 years, the intervening years have seen rapid development, initially in the theoretical arena, followed increasingly by experimental work on molecules and crystals. Among the many important developments in the field we mention cooperative phenomena in crystals, the general importance of pseudo-Jahn-Teller couplings for symmetry-lowering phenomena in molecular systems, nonadiabatic processes at conical intersections of potential energy surfaces and extensions of the basic theory in relation to the discovery of fullerenes and other icosahedral systems. The aim of the present volume is to provide a survey of the state-of-the art in Jahn-Teller interactions at the interface of quantum chemistry and condensed matter physics.

  5. Degradation and persistence of cotton pesticides in sandy loam soils from Punjab, Pakistan.

    Science.gov (United States)

    Tariq, Muhammad Ilyas; Afzal, Shahzad; Hussain, Ishtiaq

    2006-02-01

    The present study evaluated the influence of temperature, moisture, and microbial activity on the degradation and persistence of commonly used cotton pesticides, i.e., carbosulfan, carbofuran, lambda-cyhalothrin, endosulfan, and monocrotophos, with the help of laboratory incubation and lysimeter studies on sandy loam soil (Typic Ustocurepts) in Pakistan. Drainage from the lysimeters was sampled on days 49, 52, 59, 73, 100, 113, and 119 against the pesticide application on days 37, 63, 82, 108, and 137 after the sowing of cotton. Carbofuran, monocrotophos, and nitrate were detected in the drainage samples, with an average value, respectively, of 2.34, 2.6 microg/L, and 15.6 mg/L for no-tillage and 2.16, 2.3 microg/L, and 13.4 mg/L for tillage. In the laboratory, pesticide disappearance kinetics were measured with sterile and nonsterile soils from 0 to 10 cm in depth at 15, 25, and 35 degrees C and 50% and 90% field water capacities. Monocrotophos and carbosulfan dissipation followed first-order kinetics while others followed second-order kinetics. The results of incubation studies showed that temperature and moisture contents significantly reduced the t(1/2) (half-life) values of pesticides in sterile and nonsterile soil, but the effect of microbial activity was nearly significant that might be due to less organic carbon (0.3%). The presence of carbofuran and monocrotophos in the soil profile (0-10, 10-30, 30-60, 60-90, 90-150 cm) and the higher concentrations of endosulfan and lambda-cyhalothrin in the top layer (0-10 cm) showed the persistence of the pesticides. The detection of endosulfan and lambda-cyhalothrin in the 10-30 cm soil layer might be due to preferential flow. The data generated from this study could be helpful for risk assessment studies of pesticides and for validating pesticide transport models for sandy loam soils in cotton-growing areas of Pakistan.

  6. Soil nitrogen dynamics and Capsicum Annuum sp. plant response to biochar amendment in silt loam soil

    Science.gov (United States)

    Horel, Agota; Gelybo, Gyorgyi; Dencso, Marton; Toth, Eszter; Farkas, Csilla; Kasa, Ilona; Pokovai, Klara

    2017-04-01

    The present study investigated the growth of Capsicum Annuum sp. (pepper) in small-scale experiment to observe changes in plant growth and health as reflected by leaf area, plant height, yield, root density, and nitrogen usage. Based on field conditions, part of the study aimed to examine the photosynthetic and photochemical responses of plants to treatments resulting from different plant growth rates. During the 12.5 week long study, four treatments were investigated with biochar amount of 0, 0.5%, 2.5%, and 5.0% (by weight) added to silt loam soil. The plants were placed under natural environmental conditions, such that photosynthetic activities from photosynthetically active radiation (PAR) and the plants photochemical reflectance index (PRI) could be continuously measured after exposure to sunlight. In this study we found that benefits from biochar addition to silt loam soil most distinguishable occurred in the BC2.5 treatments, where the highest plant yield, highest root density, and highest leaf areas were observed compared to other treatments. Furthermore, data showed that too low (0.5%) or too high (5.0%) biochar addition to the soil had diminishing effects on Capsicum Annuum sp. growth and yield over time. At the end of the 12th week, BC2.5 had 22.2%, while BC0.5 and BC5.0 showed 17.4% and 15.7% increase in yield dry weight respectively compared to controls. The collected data also showed that the PRI values of plants growing on biochar treated soils were generally lower compared to control treatments, which could relate to leaf nitrogen levels. Total nitrogen amount showed marginal changes over time in all treatments. The total nitrogen concentration showed 28.6% and 17.7% increase after the 6th week of the experiment for BC2.5 and BC5.0, respectively, while inorganic nutrients of NO3-N and NH4+-N showed a continuous decrease during the course of the study, with a substantial drop during the first few weeks. The present study provides evidence for impact

  7. Poschl-Teller potentials based solution to Hilbert's tenth problem Pöschl-Teller potentials based solution to Hilbert's tenth problem

    Directory of Open Access Journals (Sweden)

    Juan Ospina

    2006-12-01

    Full Text Available Hypercomputers compute functions or numbers, or more generally solve problems or carry out tasks, that cannot be computed or solved by a Turing machine. An adaptation of Tien D. Kieu¿s quantum hypercomputational algorithm is carried out for the dynamical algebra su(1, 1 of the Poschl-Teller potentials. The classically incomputable problem that is resolved with this hypercomputational algorithm is Hilbert¿s tenth problem. We indicated that an essential mathematical condition of these algorithms is the existence of infinitedimensional unitary irreducible representations of low dimensional dynamical algebras that allow the construction of coherent states of the Barut-Girardello type. In addition, we presented as a particular case of our hypercomputational algorithm on Poschl-Teller potentials, the hypercomputational algorithm on an infinite square well presented previously by the authors.Los hipercomputadores computan funciones o números, o en general solucionan problemas que no pueden ser computados o solucionados por una máquina de Turing. Se presenta una adaptación del algoritmo cuántico hipercomputacional propuesto por Tien D. Kieu, al álgebra dinámica su(1, 1 realizada en los potenciales Pöschl-Teller. El problema clásicamente incomputable que se resuelve con este algoritmo hipercomputacional es el d´ecimo problema de Hilbert. Se señala que una condición matemática fundamental para estos algoritmos es la existencia de una representación unitaria infinito dimensional irreducible de álgebras de baja dimensión que admitan la construcción de estados coherentes del tipo Barut-Girardello. Adicionalmente se presenta como caso límite del algoritmo propuesto sobre los potenciales Pöschl-Teller, el algoritmo hipercomputacional sobre la caja de potencial infinita construido previamente por los autores.

  8. Science and Technology Review, July-August 1998: Celebrating Edward Teller at 90

    Science.gov (United States)

    Smart, J.

    1998-07-01

    On the occasion of Edward Teller's 90th birthday, Science and Technology Review (S&TR) has the pleasure of honoring Lawrence Livermore's co-founder and most influential scientist. Teller is known for his inventive work in physics, his concepts leading to thermonuclear explosions, and his strong stands on such issues as science education, the nation's strategic defense, the needs for science in the future, and sharing scientific information. The articles in this issue also show him, as always, tirelessly moving forward with his new and changing interests.

  9. Assessment of welfare and egg production of laying hens moravia ssl in small-scale breeding

    Directory of Open Access Journals (Sweden)

    Mária Angelovičová

    2015-10-01

    Full Text Available The purpose of this study was to investigate the welfare of laying hens Moravia SSL housed in small-scale hen house with free range, behavior, egg production and selected physical indicators of eggs and chemical indicators of egg mass. The laying hens were kept in a hen house on deep litter. Breeding facility of hen house was within the meaning of recommendation for applying the principles of welfare, i.e. the space and breeding facility within the meaning of enriched breeding environment. Stocking density of the laying hens corresponded with recommendations for unrestricted movement and implementing natural activities. The hen house was equipped with the perch, nest, feeder and drinker. The commercial feed mixture was used for feeding, which is intended for laying hens. The kitchen remains were added to feed mixture, as are wet bread, the non-edible remains of foodstuffs. A feed mixture was served to laying hens 825 g per day. The laying hens had free access to drinking water, grazing, ground pecking, ground scratching and dust-bathing and in the free range. We focused investigation of on the egg laying intensity, selected parameters of physical egg quality and chemical egg contents. Time to relax of laying hens was adjusted according to the summer and winter breeding seasons. The main activities of free-range hens are grazing, ground pecking, ground scratching and dust-bathing. The main activities of free-range hens are grazing, ground pecking, ground scratching and dust-bathing. These activities were investigated in laying hens too in dependent of year period, more in the summer. Housing of the hens was equipped with the perch. The laying hens regularly used a perch. A beginning of occupation the perch was at the time of time growing dark, at the end of the light day. A nesting material was selected regular, monthly exchange. It was meadow hay of excellent quality for the collection of high quality and safe eggs from nests in the hen house

  10. ELASTOPLASTICIDAD DE UN SUELO FRANCO ARENOSO DE SABANA I SANDY LOAM SAVANNA SOIL ELASTOPLASTICITY

    Directory of Open Access Journals (Sweden)

    Américo Hossne García

    2018-04-01

    Full Text Available The knowledge of elastoplastic properties is important for calculating soil elastic and plastic deformations experienced by static or dynamic loads generated, for example, by farm implements and root growth. The objective of this study was to determine the soil elastoplastic parameters: Young’s modulus (E, the shear modulus (G, bulk modulus (K and Poisson’s ratio (υ of a sandy-loam soil from a savanna in Monagas State, Venezuela. Triaxial tests and regression analyses were used to interpret the variance between them. The results show that E varied from 4693.39 to 36669.35 kPa; G from 700 to 5000 kPa; K from 500 to 2000 kPa and υ had a value of 0.50. It is concluded that these soils are incompressible under plastic conditions, i.e. easily deformable. The Poisson’s ratio varied significantly with soil water content. The Young modulus, bulk modulus and the shear modulus showed high variation with respect to water content. Both the Young’s modulus and Poisson’s ratio increased, at low soil water content, with the rise in chamber pressure .

  11. The Influence Of Loam Type And Cement Content On The Compressive Strength Of Rammed Earth

    Directory of Open Access Journals (Sweden)

    Narloch P. L.

    2015-03-01

    Full Text Available Currently, a worldwide dynamic rise of interest in using soil as a construction material can be observed. This trend is evident in the rapid rise of the amount of standards that deal with soil techniques. In 2012 the number of standards was larger by one third than five years prior. To create a full standardization of the rammed earth technique it is necessary to take into account the diversity of used soil and stabilizing additives. The proportion of the components, the process of element production and the research methods must also be made uniform. The article describes the results of research on the compressive strength of rammed earth samples that differed from each other with regards to the type of loam used for the mixture and the amount of the stabilizer. The stabilizer used was Portland cement CEM I 42.5R. The research and the analysis of the results were based on foreign publications, the New Zealand standard NZS 4298:1998, the American Standard NMAC14.7.4 and archival Polish Standards from the 1960’s that dealt with earth material.

  12. Effect of biochar amendment on nitrate retention in a silty clay loam soil

    Directory of Open Access Journals (Sweden)

    Angela Libutti

    2016-08-01

    Full Text Available Biochar incorporation into agricultural soils has been proposed as a strategy to decrease nutrient leaching. The present study was designed to assess the effect of biochar on nitrate retention in a silty clay loam soil. Biochar obtained from the pyrogasification of fir wood chips was applied to soil and tested in a range of laboratory sorption experiments. Four soil treatments were considered: soil only (control, soil with 2, 4 and 8% of biochar by mass. The Freundlich sorption isotherm model was used to fit the adsorbed amount of nitrate in the soil-biochar mixtures. The model performed very well in interpreting the experimental data according to a general linear regression (analysis of co-variance statistical approach. Nitrate retention in the soilbiochar mixtures was always higher than control, regardless the NO3 – concentration in the range of 0-400 mg L–1. Different sorption capacities and intensities were detected depending on the biochar application rate. The highest adsorption capacity was observed in the soils added with 2 and 4% of biochar, respectively. From the results obtained is possible to infer that nitrate retention is higher at lower biochar addition rate to soil (2 and 4% and at lower nitrate concentration in the soil water solution. These preliminary laboratory results suggest that biochar addition to a typical Mediterranean agricultural soil could be an effective management option to mitigate nitrate leaching.

  13. Depth distribution of preferential flow patterns in a sandy loam soil as affected by tillage

    Directory of Open Access Journals (Sweden)

    C. T. Petersen

    1997-01-01

    Full Text Available Dye-tracer studies using the anionic dye Brilliant Blue FCF were conducted on a structured sandy loam soil (Typic Agrudalf. 25 mm of dye solution was applied to the surface of 11 1.6 x 1.6 m field plots, some of which had been subjected to conventional seed bed preparation (harrowing while others had been rotovated to either 5 or 15 cm depth before sowing. The soil was excavated to about 160 cm depth one or two days after dye application. Flow patterns and structural features appearing on vertical or horizontal cross sections were examined and photographed. The flow patterns were digitized, and depth functions for the number of activated flow pathways and the degree of dye coverage were calculated. Dye was found below 100 cm depth on 26 out of 33 vertical cross sections made in conventionally tilled plots showing that preferential flow was a prevailing phenomenon. The depth-averaged number of stained flow pathways in the 25-100 cm layer was significantly smaller in a plot rotovated to 5 cm depth than in a conventionally tilled plot, both under relatively dry initial soil conditions and when the entire soil profiles were initially at field capacity. There were no examples of dye penetration below 25 cm depth one month after deep rotovation. Distinct horizontal structures in flow patterns appearing at 20-40 cm depth coupled with changes in flow domains indicated soil layering with abrupt changes in soil structure and hydraulic properties.

  14. Inhibition effect of zinc in wastewater on the N2O emission from coastal loam soils.

    Science.gov (United States)

    Huang, Yan; Ou, Danyun; Chen, Shunyang; Chen, Bin; Liu, Wenhua; Bai, Renao; Chen, Guangcheng

    2017-03-15

    The effects of zinc (Zn) on nitrous oxide (N 2 O) fluxes from coastal loam soil and the abundances of soil nitrifier and denitrifier were studied in a tidal microcosm receiving livestock wastewater with different Zn levels. Soil N 2 O emission significantly increased due to discharge of wastewater rich in ammonia (NH 4 + -N) while the continuous measurements of gas flux showed a durative reduction in N 2 O flux by high Zn input (40mgL -1 ) during the low tide period. Soil inorganic nitrogen concentrations increased at the end of the experiment and even more soil NH 4 + -N was measured in the high-Zn-level treatment, indicating an inhibition of ammonia oxidation by Zn input. Quantitative PCR of soil amoA, narG and nirK genes encoding ammonia monooxygenase, nitrate reductase and nitrite reductase, respectively, showed that the microbial abundances involved in these metabolisms were neither affected by wastewater discharge nor Zn contamination. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Eleven years' effect of conservation practices for temperate sandy loams: II. Soil pore characteristics

    DEFF Research Database (Denmark)

    Abdollahi, Lotfallah; Munkholm, Lars Juhl

    2017-01-01

    Conservation agriculture (CA) is regarded by many as a sustainable intensification strategy. Minimal soil disturbance in combination with residue retention are important CA components. This study examined the long-term effects of crop rotation, residue retention, and tillage on soil pore characte......Conservation agriculture (CA) is regarded by many as a sustainable intensification strategy. Minimal soil disturbance in combination with residue retention are important CA components. This study examined the long-term effects of crop rotation, residue retention, and tillage on soil pore...... characteristics of two Danish sandy loams. Rotation R2 is a rotation of winter crops (mainly cereals) with residues retained, rotation R3 a mix of winter and spring crops (mainly cereals) with residues removed, and rotation R4 the same mix of winter and spring crops, but with residues retained. Each rotation...... included the tillage treatments: moldboard plowing to 20-cm depth (MP), harrowing to 8- to 10-cm depth (H) and direct drilling (D). Soil cores were taken from the topsoil (4–8, 12–16, 18–27 cm) in mid-autumn 2013 and early spring 2014. Water retention, air permeability, and gas diffusivity was determined...

  16. Production of Barbari Bread (Traditional Iranian Bread) Using Different Levels of Distillers Dried Grains with Solubles (DDGS) and Sodium Stearoyl Lactate (SSL)

    Science.gov (United States)

    Pourafshar, Shirin; Krishnan, Padmanaban G.

    2018-01-01

    Bread is one of the oldest foods known throughout history and even though it is one of the principal types of staple around the world, it usually lacks enough nutrients, including protein and fiber. As such, fortification is one of the best solutions to overcome this problem. Thus, the objective this study was to examine the effect of three levels of distillers dried grains with solubles (DDGS) (0%, 10% and 20%) in conjunction with three levels of SSL (sodium stearoyl lactate) (0%, 2% and 5%) on physical and chemical properties of Barbari bread (traditional Iranian bread). To the best of our knowledge, this is the first study to evaluate DDGS and Sodium Stearoyl-2-Lactilate (SSL), as sources of fortification in Barbari bread. The results showed that incorporation of 20% of DDGS and 0% SSL caused a significant increase in the amount of fiber and protein. As for the physical attributes, using higher amount of DDGS caused a darker color, and as for the texture parameters, the highest firmness was measured when 10% DDGS and 5% of SSL were used. Different Mixolab and Rapid Visco Analyzer (RVA) parameters also were measured with varying results. The findings of this study show that DDGS can be a valuable source of fiber and protein, which can be used as a cost effective source to fortify cereal-based products. PMID:29494562

  17. Production of Barbari Bread (Traditional Iranian Bread Using Different Levels of Distillers Dried Grains with Solubles (DDGS and Sodium Stearoyl Lactate (SSL

    Directory of Open Access Journals (Sweden)

    Shirin Pourafshar

    2018-03-01

    Full Text Available Bread is one of the oldest foods known throughout history and even though it is one of the principal types of staple around the world, it usually lacks enough nutrients, including protein and fiber. As such, fortification is one of the best solutions to overcome this problem. Thus, the objective this study was to examine the effect of three levels of distillers dried grains with solubles (DDGS (0%, 10% and 20% in conjunction with three levels of SSL (sodium stearoyl lactate (0%, 2% and 5% on physical and chemical properties of Barbari bread (traditional Iranian bread. To the best of our knowledge, this is the first study to evaluate DDGS and Sodium Stearoyl-2-Lactilate (SSL, as sources of fortification in Barbari bread. The results showed that incorporation of 20% of DDGS and 0% SSL caused a significant increase in the amount of fiber and protein. As for the physical attributes, using higher amount of DDGS caused a darker color, and as for the texture parameters, the highest firmness was measured when 10% DDGS and 5% of SSL were used. Different Mixolab and Rapid Visco Analyzer (RVA parameters also were measured with varying results. The findings of this study show that DDGS can be a valuable source of fiber and protein, which can be used as a cost effective source to fortify cereal-based products.

  18. Production of Barbari Bread (Traditional Iranian Bread) Using Different Levels of Distillers Dried Grains with Solubles (DDGS) and Sodium Stearoyl Lactate (SSL).

    Science.gov (United States)

    Pourafshar, Shirin; Rosentrater, Kurt A; Krishnan, Padmanaban G

    2018-03-01

    Bread is one of the oldest foods known throughout history and even though it is one of the principal types of staple around the world, it usually lacks enough nutrients, including protein and fiber. As such, fortification is one of the best solutions to overcome this problem. Thus, the objective this study was to examine the effect of three levels of distillers dried grains with solubles (DDGS) (0%, 10% and 20%) in conjunction with three levels of SSL (sodium stearoyl lactate) (0%, 2% and 5%) on physical and chemical properties of Barbari bread (traditional Iranian bread). To the best of our knowledge, this is the first study to evaluate DDGS and Sodium Stearoyl-2-Lactilate (SSL), as sources of fortification in Barbari bread. The results showed that incorporation of 20% of DDGS and 0% SSL caused a significant increase in the amount of fiber and protein. As for the physical attributes, using higher amount of DDGS caused a darker color, and as for the texture parameters, the highest firmness was measured when 10% DDGS and 5% of SSL were used. Different Mixolab and Rapid Visco Analyzer (RVA) parameters also were measured with varying results. The findings of this study show that DDGS can be a valuable source of fiber and protein, which can be used as a cost effective source to fortify cereal-based products.

  19. Analogy Between Particle in a Box and Jahn–Teller Effect

    Indian Academy of Sciences (India)

    IAS Admin

    Solving the SchrÄodinger equation, the allowed energy levels of the particle are given .... to slight distortion of the cube. Using (3), the new energy of ... ARTICLE. The Jahn–Teller theorem states that in a nonlinear molecule, if degenerate orbitals are asymmetrically occupied a distortion will occur to remove the degeneracy.

  20. Algebraic treatment of second Poeschl-Teller, Morse-Rosen and Eckart equations

    International Nuclear Information System (INIS)

    Barut, A.O.; Inomata, A.; Wilson, R.

    1987-01-01

    The method of algebraic treatment is applied to the non-compact case to solve a family of second Poeschl-Teller, Morse-Rosen and Eckart equations with quantized coupling constants. Both discrete and continuous spectra, bound state and scattering wave functions (transmission coefficients) are found from the matrix elements of group representations. (author). 24 refs, 1 tab

  1. Jahn-Teller coupling at ND1 and GR1 centres in diamond

    International Nuclear Information System (INIS)

    Lowther, J.E.

    1978-01-01

    Stress parameters associated with the splitting of the GR1 and ND1 lines are examined in the light of the recent suggestion that ND1 arises from the negatively charged vacancy. The stress parameters are totally consistent with this interpretation; Jahn-Teller coupling in the excited states being similar for both centres. (author)

  2. Isospectral Trigonometric Pöschl-Teller Potentials with Position Dependent Mass Generated by Supersymmetry

    International Nuclear Information System (INIS)

    Santiago-Cruz, C

    2016-01-01

    In this work a position dependent mass Hamiltonian with the same spectrum of the trigonometric Pöschl-Teller one was constructed by means of the underlying potential algebra. The corresponding wave functions are determined by using the factorization method. A new family of isospectral potentials are constructed by applying a Darboux transformation. An example is presented in order to illustrate the formalism. (paper)

  3. New SUSYQM coherent states for Poschl-Teller potentials: a detailed mathematical analysis

    Czech Academy of Sciences Publication Activity Database

    Bergeron, H.; Siegl, Petr; Youssef, A.

    2012-01-01

    Roč. 45, č. 24 (2012), 244028/1-244028/14 ISSN 1751-8113 R&D Projects: GA MŠk LC06002; GA ČR GAP203/11/0701 Institutional support: RVO:61389005 Keywords : supersymmetry * Poschi-Teller potential Subject RIV: BE - Theoretical Physics Impact factor: 1.766, year: 2012

  4. Dirac equation with spin symmetry for the modified Pöschl–Teller ...

    Indian Academy of Sciences (India)

    effective nuclear shell-model scheme [7–9]. Also, various potentials such as the Morse potential [10–12], Wood–Saxon potential [13], Coulomb and Hartmann potentials [14],. Eckart potential [15,16], Pöschl–Teller potential [17,18] and the harmonic potential [19,20] have been studied within the framework of the spin and ...

  5. Wave-Vector Dependence of the Jahn-Teller Interactions in TmVO4

    DEFF Research Database (Denmark)

    Kjems, Jørgen; Hayes, W.; Smith, S. H.

    1975-01-01

    The resonant Jahn-Teller coupling of the B2g acoustic phonon and the Zeeman-split ground doublet in TmVO4 has been studied by inelastic neutron scattering. Tuning of the magnetic field provides a means for investigating the wave-vector dependence of the interactions. We find that the coupling...

  6. Gamow-Teller decay of T = 1 nuclei to odd-odd N = Z nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Lisetskiy, A F [National Superconducting Cyclotron Laboratory, MSU, East Lansing, MI 48824 (United States); Gelberg, A [Institute for Nuclear Physics, University of Cologne, 50937 Cologne (Germany); Institute of Physical and Chemical Reasearch (RIKEN), Wako, 351-0198 (Japan); Brentano, P von [Institute for Nuclear Physics, University of Cologne, 50937 Cologne (Germany)

    2005-01-01

    Transition strengths of Gamow-Teller decay of T{sub z} = {+-}1 nuclei to N = Z odd-odd nuclei have been calculated in a two-nucleon approximation for spherical and deformed nuclei. The results obtained for the latter are quite close to the values obtained by full-space shell-model calculations and to the experiment.

  7. Investigating the Human Computer Interaction Problems with Automated Teller Machine Navigation Menus

    Science.gov (United States)

    Curran, Kevin; King, David

    2008-01-01

    Purpose: The automated teller machine (ATM) has become an integral part of our society. However, using the ATM can often be a frustrating experience as people frequently reinsert cards to conduct multiple transactions. This has led to the research question of whether ATM menus are designed in an optimal manner. This paper aims to address the…

  8. The Jahn-Teller effect and its observation in titanium alum

    International Nuclear Information System (INIS)

    Tregenna Piggott, P.

    1996-01-01

    Full text: A fundamental assumption, often employed to problems in solid state physics, is that a system may be well described within the confines of the Born-Oppenheimer approximation. As a consequence of the substantial difference of masses, the electrons are assumed to follow the motion of the nuclei adiabatically; hence, the motion of the electrons and nuclei are solved separately. As Jahn and Teller showed in 1936, any non-linear molecule having orbital degeneracy will be unstable to at least one asymmetric displacement which lifts the degeneracy. The wave equation must then be solved taking into account coupling between the electronic and nuclear motion. The E x β system, an electronic doublet coupled to a single mode of vibration, is introduced as an elementary example and is used to illustrate features characteristic of Jahn-Teller systems. The E x ε system is discussed in conjunction with work currently being undertaken on CsTi(SO 4 ) 2 .12H 2 O. In this alum, the [Ti(OH 2 ) 6 ] 3 + cation (3d 1 ) is subject to an axial field which acts to leave a doubly degenerate electronic ground term. Spectroscopic and crystallographic data show the salt to undergo a phase transition at 12 K which we associate with a Co-operative Jahn-Teller Effect manifested by the interaction of the Jahn-Teller electrons with the crystal lattice. Also presented are EPR and SQUID data which illustrate how the Jahn-Teller effect leads to quenching of orbital angular momentum and spin-orbit coupling

  9. Phosphorus application to cotton enhances growth, yield, and quality characteristics on a sandy loam soil

    International Nuclear Information System (INIS)

    Ahmad, M.; Ranjha, A.M.

    2009-01-01

    Phosphorus (P) is the second most limiting nutrient in cotton (Gossypium hirsutum L.) production after nitrogen. Under wheat-cotton cropping system of Pakistan most of the farmers apply P fertilizer only to wheat crop. A field experiment was conducted to evaluate the effect of fertilizer P on the growth, yield and fibre quality of cotton on a sandy loam calcareous soil at farmer's field in cotton growing area of district Khanewal, Punjab. Five levels of P (0, 17, 26, 34 and 43 kg P ha /sup -1/) along with 120 kg N and 53 kg K ha/sup -1/ were applied. The response of cotton growth parameters was greater than quality components to P addition in calcareous soil. There was significant increase in the growth and yield parameters with each additional rate of P. The response of number of bolls per plant, boll weight and seed cotton yield was to the tune of 88.23, 16.82 and 42%, respectively at P application rate of 34 kg ha/sup -1/. Cotton quality components (lint %age, fiber length and fiber strength) improved from 2 to 5% where 43 kg P ha/sup -1/ was added. The lint and seed P concentration was little affected by P application as compared to stem and leaves showing its essentiality for cell division and development of meristematic tissue. Phosphorus use, thus not only valuable for wheat crop but also its application to cotton crop is of vital importance in improving both lint yield and quality. (author)

  10. Surface Runoff of Pesticides from a Clay Loam Field in Sweden.

    Science.gov (United States)

    Larsbo, Mats; Sandin, Maria; Jarvis, Nick; Etana, Ararso; Kreuger, Jenny

    2016-07-01

    Pesticides stored at or close to the soil surface after field application can be mobilized and transported off the field when surface runoff occurs. The objective of our study was to quantify the potential pesticide losses in surface runoff from a conventionally managed agricultural field in a Swedish climate. This was achieved by measuring surface runoff volumes and concentrations in runoff of six spring-applied pesticides and autumn-applied glyphosate and its metabolite aminomethylphosphonic acid (AMPA). Measurements were performed for 3 yr both during the growing seasons and during intervening winter snowmelt periods on a clay loam field close to Uppsala. During growing seasons, surface runoff was generated on only five occasions during one 25-d period in 2012 when the infiltration capacity of the soil may have been reduced by structural degradation due to large cumulative rainfall amounts after harrowing. Concentrations in surface runoff exceeded Swedish water quality standards in all samples during this growing season for diflufenican and pirimicarb. Surface runoff was generated during three snowmelt periods during the winter of 2012-2013. All of the applied pesticides were found in snowmelt samples despite incorporation of residues by autumn plowing, degradation, and leaching into the soil profile during the period between spraying and sampling. Concentrations of glyphosate ranged from 0.12 to 7.4 μg L, and concentrations of AMPA ranged from 0 to 2.7 μg L. Our results indicate that temporal changes in hydraulic properties during the growing season and when the soil freezes during winter affect pesticide losses through surface runoff. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  11. Plant uptake and soil retention of phthalic acid applied to Norfolk sandy loam

    International Nuclear Information System (INIS)

    Dorney, J.R.; Weber, J.B.; Overcash, M.R.; Strek, H.J.

    1985-01-01

    Plant uptake and soil retention of 14 C carboxyl-labeled phthalic acid were studied at application rates of 0.6, 6.0, 60.0, and 600.0 ppm (soil dry weight) to Norfolk sandy loam (Typic Paleudult, fine loamy, kaolinitic, thermic). Height and dry weight of corn (Zea mays L. Pioneer 3368A) (21 day), tall fescue (Festuca arundinacea Schreb. Kentucky 31) (45 day) immature soybean (Glycine max (L.) Merr. Altoona) (21 day) plant, mature soybean plant, and mature wheat (Triticum aestivum L. Butte) straw were not affected by phthalic acid applied to soil. In addition, soybean seed and wheat seed dry weight were unaffected. Immature wheat (40 day) height decreased at the 600 ppm rate. Plant uptake of phthalic acid ranged from 0 to 23 ppm and was significantly above background for all plants and plant materials except soybean pods. Fescue and immature plants exhibited the highest concentration of phthalic acid while mature wheat plants and wheat seeds exhibited the least. Most of the phthalic acid volatilized or was decomposed from the soil by the end of the study; an average of only 5.7% of the originally applied chemical was recovered in both soil or plants. An average of 0.02% of the originally applied phthalic acid leached out of the treated zone. Considering the low toxicity of phthalic acid and its relatively rapid disappearance from soil, it is unlikely to become a health hazard from contaminated plants. However, plant uptake of other toxic organics could potentially become a hazard on soils treated with sludge containing significant quantities of these substances

  12. Aggregate-associated carbon and nitrogen in reclaimed sandy loam soils

    Energy Technology Data Exchange (ETDEWEB)

    Wick, A.F.; Stahl, P.D.; Ingram, L.J. [Virginia Polytechnic Institute & State University, Blacksburg, VA (United States)

    2009-11-15

    Minimal research has been conducted on aggregate, C, and N in coarse-textured soils used to reclaim surface coal mine lands. Furthermore, little is known about the contribution different plant communities make to the recovery of aggregation in these soils. Two chronosequences of semiarid reclaimed sites with sandy loam soils were sampled under shrub- and grass-dominated communities. Aggregation, aggregate fractions, and associated C and N were measured. No definitive trends of increasing macroaggregates between sites were observed undershrubs; however, macro- and microaggregation was greater in the 16-yr-old (0.20 and 0.23 kg aggregate kg{sup -1} soil, respectively) than in the 5-yr-old soils (0.02 and 0.08 kg aggregate kg{sup -1} soil, respectively) under grasses. Although C and N concentrations were drastically reduced (50-75%) with mining activity between the <1-yr-old and native soils, aggregate C and N concentrations tinder shrubs and grasses were similar to each other and to the native soils in the 5-yr-old site. Sods under grass in the 16-yr-old site had lower available and aggregate-occluded C and N concentrations than the 5-yr-old site, while C and N concentrations did not change between 5- and 16-yr-old soils under shrubs. Conversely, aggregate C and N pool sizes under shrubs and grasses both increased with site age to conditions similar to those observed in the native soil. Reclaimed shrub site soils had consistently higher C concentrations in the older reclaimed sites (10 and 16 yr old) than the soils under grasses, indicating greater accumulation and retention of C and N in organic material under shrub than grass communities in semiarid reclaimed sites.

  13. IMPACT OF THE REPEATED TRACTOR PASSES ON SOME PHYSICAL PROPERTIES OF SILTY LOAM SOIL

    Directory of Open Access Journals (Sweden)

    Dubravko Filipović

    2011-12-01

    Full Text Available The aim of this paper was to quantify soil compaction induced by tractor traffic on untilled wet silty loam soil (Mollic Fluvisol. Changes in penetration resistance, bulk density and total porosity were measured for detecting the soil compaction. Treatments include ten passes of a four-wheel drive tractor with the engine power of 54.0 kW and weight of 3560 kg (1580 kg on the front axle and 1980 kg on the rear axle, 2.41 m distance between axles. The tyres on the tractor were cross-ply, front 11.2-24 and rear 16.9-30, with the inflation pressure of 160 kPa and 100 kPa, respectively. The speed of tractor during passes over experimental plots was 5.0 km h-1. In comparison to control, each tractor pass induced an increase in soil penetration resistance at all depths, and the average increment ratios, determined as the average of all layers, were 9.8, 18.5 and 26.1% after one, five and ten passes, respectively. The bulk density also increased with number of tractor passes, but with less percentage increasing. The increment ratios comparison to the control were 3.6, 9.5 and 12.9% after one, five and ten passes, respectively. The total porosity decreased with the number of passes, and the decrement ratios were 4.5, 16.5 and 20.8% after one, five and ten passes, respectively.

  14. Respirable dust and quartz exposure from three South African farms with sandy, sandy loam, and clay soils.

    Science.gov (United States)

    Swanepoel, Andrew J; Kromhout, Hans; Jinnah, Zubair A; Portengen, Lützen; Renton, Kevin; Gardiner, Kerry; Rees, David

    2011-07-01

    To quantify personal time-weighted average respirable dust and quartz exposure on a sandy, a sandy loam, and a clay soil farm in the Free State and North West provinces of South Africa and to ascertain whether soil type is a determinant of exposure to respirable quartz. Three farms, located in the Free State and North West provinces of South Africa, had their soil type confirmed as sandy, sandy loam, and clay; and, from these, a total of 298 respirable dust and respirable quartz measurements were collected between July 2006-November 2009 during periods of major farming operations. Values below the limit of detection (LOD) (22 μg · m(-3)) were estimated using multiple 'imputation'. Non-parametric tests were used to compare quartz exposure from the three different soil types. Exposure to respirable quartz occurred on all three farms with the highest individual concentration measured on the sandy soil farm (626 μg · m(-3)). Fifty-seven, 59, and 81% of the measurements on the sandy soil, sandy loam soil, and clay soil farm, respectively, exceeded the American Conference of Governmental Industrial Hygienists (ACGIH) threshold limit value (TLV) of 25 μg · m(-3). Twelve and 13% of respirable quartz concentrations exceeded 100 μg · m(-3) on the sandy soil and sandy loam soil farms, respectively, but none exceeded this level on the clay soil farm. The proportions of measurements >100 μg · m(-3) were not significantly different between the sandy and sandy loam soil farms ('prop.test'; P = 0.65), but both were significantly larger than for the clay soil farm ('prop.test'; P = 0.0001). The percentage of quartz in respirable dust was determined for all three farms using measurements > the limit of detection. Percentages ranged from 0.5 to 94.4% with no significant difference in the median quartz percentages across the three farms (Kruskal-Wallis test; P = 0.91). This study demonstrates that there is significant potential for over-exposure to respirable quartz in

  15. The T1u x 8 hg Jahn-Teller system - an improved model for the C60-molecule

    International Nuclear Information System (INIS)

    Rough, S.M.; Dunn, J.L.; Bates, C.A.

    1997-01-01

    The ground state of C 60 - gives rise to a T 1u x 8 h g Jahn-Teller (JT) system. A proof is presented showing that the presence of eight active h g modes rather than one makes little difference to the mathematical complexity of this problem compared to the simpler single-mode variant. After showing that the T 1u x 8 h g Jahn-Teller system has the same electronic eigenstates as the T 1u x h g Jahn-Teller system, the inversion splitting and first-order reduction factors are derived. (orig.)

  16. New SUSYQM coherent states for Pöschl-Teller potentials: a detailed mathematical analysis

    Science.gov (United States)

    Bergeron, H.; Siegl, P.; Youssef, A.

    2012-06-01

    In a recent short note (Bergeron et al 2010 Europhys. Lett. 92 60003), we have presented the good properties of a new family of semi-classical states for Pöschl-Teller potentials. These states are built from a supersymmetric quantum mechanics (SUSYQM) approach and the parameters of these ‘coherent’ states are points in the classical phase space. In this paper, we develop all the mathematical aspects that have been left out of the previous paper (proof of the resolution of unity, detailed calculations of the quantized version of classical observables and mathematical study of the resulting operators: problems of domains, self-adjointness or self-adjoint extensions). Some additional questions such as asymptotic behavior are also studied. Moreover, the framework is extended to a larger class of Pöschl-Teller potentials. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical devoted to ‘Coherent states: mathematical and physical aspects’.

  17. Renner-Teller effects in the photoelectron spectra of CNC, CCN, and HCCN.

    Science.gov (United States)

    Coudert, Laurent H; Gans, Bérenger; Garcia, Gustavo A; Loison, Jean-Christophe

    2018-02-07

    The line intensity of photoelectron spectra when either the neutral or cationic species display a Renner-Teller coupling is derived and applied to the modeling of the photoelectron spectra of CNC, CCN, and HCCN. The rovibronic energy levels of these three radicals and of their cations are investigated starting from ab initio results. A model treating simultaneously the bending mode and the overall rotation is developed to deal with the quasilinearity problem in CNC + , CCN + , and HCCN and accounts for the large amplitude nature of their bending mode. This model is extended to treat the Renner-Teller coupling in CNC, CCN, and HCCN + . Based on the derived photoelectron line intensity, the photoelectron spectra of all three molecules are calculated and compared to the experimental ones.

  18. Solution of Dirac equation for modified Poschl Teller plus trigonometric Scarf potential using Romanovsky polynomials method

    International Nuclear Information System (INIS)

    Prastyaningrum, I.; Cari, C.; Suparmi, A.

    2016-01-01

    The approximation analytical solution of Dirac equation for Modified Poschl Teller plus Trigonometric Scarf Potential are investigated numerically in terms of finite Romanovsky Polynomial. The combination of two potentials are substituted into Dirac Equation then the variables are separated into radial and angular parts. The Dirac equation is solved by using Romanovsky Polynomial Method. The equation that can reduce from the second order of differential equation into the differential equation of hypergeometry type by substituted variable method. The energy spectrum is numerically solved using Matlab 2011. Where the increase in the radial quantum number nr and variable of modified Poschl Teller Potential causes the energy to decrease. The radial and the angular part of the wave function also visualized with Matlab 2011. The results show, by the disturbance of a combination between this potential can change the wave function of the radial and angular part. (paper)

  19. On the interplay of Jahn-Teller physics and Mott physics in cuprates

    International Nuclear Information System (INIS)

    Kamimura, H; Ushio, H

    2008-01-01

    The extended two-story house model which is now called the Kamimura-Suwa (K-S) model has clarified how the interplay of Mott physics and Jahn-Teller physics plays an important role in determining the superconducting as well as metallic state of underdoped cuprates. In this paper it is first pointed out for underdoped cuprates that Mott physics leads to the existence of local antiferromagnetic order constructed from the localized spins while that the anti-Jahn-Teller effect as a central issue of Jahn-Teller physics leads to the existence of two kinds of orbitals parallel and perpendicular to a CuO 2 plane whose states have nearly the same energy. As a result of the interplay of both physics the K-S model has shown that the exchange interactions between the spins of a localized hole and of a carrier hole play an important role in producing the coexistence of superconductivity and antiferromagnetism in underdoped cuprates. The appearance of d-wave superconductivity even in the phonon-involved mechanism is also shown to be due to the interplay of Jahn-Teller physics and Mott Physics. Brief review of these facts as well as the K-S model is given in this paper. More outstanding result in this paper is that the origin of pseudogap in the deeply underdoped regime has been clarified. In this paper it is shown theoretically for the first time that the so-called T* pseudogap observed in ARPES, STM and tunneling experiments below T c in underdoped cuprates corresponds to the real transition of photo-excited electrons from the occupied states in the originally conduction band below the superconducting gap to a free-electron state above the vacuum level. Thus we conclude that the T* pseudogap in the underdoped cuprates which increases with decreasing the hole concentration is not 'pseudo', but a real gap which exists even below T c

  20. Matrix elements of u and p for the modified Poeschl-Teller potential

    International Nuclear Information System (INIS)

    Gomez-Camacho, J; Lemus, R; Arias, J M

    2004-01-01

    Closed analytical expressions in terms of a single sum are obtained for the matrix elements of the momentum and the natural variable u tanh(αx) in the basis of the modified Poeschl-Teller (MPT) bound eigenstates. These matrix elements are first expressed in terms of Franck-Condon factors, which thereafter are substituted for analytic expressions. Expansions of the variables p and u in terms of creation and annihilation operators associated with the MPT bound eigenfunctions are also presented

  1. Quenching of the Gamow-Teller matrix element in closed LS-shell-plus-one nuclei

    International Nuclear Information System (INIS)

    Towner, I.S.

    1989-06-01

    It is evident that nuclear Gamow-Teller matrix elements determined from β-decay and charge-exchange reactions are significantly quenched compared to simple shell-model estimates based on one-body operators and free-nucleon coupling constants. Here we discuss the theoretical origins of this quenching giving examples from light nuclei near LS-closed shells, such as 16 0 and 40 Ca. (Author) 12 refs., 2 tabs

  2. Conformal scalar field on the hyperelliptic curve and critical Ashkin-Teller multipoint correlation functions

    International Nuclear Information System (INIS)

    Zamolodchikov, A.B.

    1987-01-01

    A multipoint conformal block of Ramond states of the two-dimensional free scalar field is calculated. This function is related to the free energy of the scalar field on the hyperelliptic Riemann surface under a particular choice of boundary conditions. Being compactified on the circle this field leads to the crossing symmetric correlation functions with a discrete spectrum of scale dimensions. These functions are supposed to describe multipoint spin correlations of the critical Ashkin-Teller model. (orig.)

  3. QRPA estimate for the Δ(1232) cotribution to the Gamow-Teller decay of heavy nuclei

    International Nuclear Information System (INIS)

    Suhonen, J.

    1991-01-01

    The contribution of the Δ(1232) isobars to the nuclear beta decay strength function is estimated in the framework of the charge-changing form of the QRPA. This procedure is applied to neutron-deficient tin isotopes. The results imply that the quenching of the low-energy Gamow-Teller decay strength cannot attributed to the presence of delta admixtures in the nuclear wave function. (orig.)

  4. Gamow-Teller strength in the β-decay of 36Ca

    International Nuclear Information System (INIS)

    Trinder, W.; Adelberger, E.G.; Janas, Z.; Keller, H.; Krumbholz, K.; Pfuetzner, M.; Rykaczewski, K.

    1994-11-01

    The β-decay of 36 Ca has been studied at the projectile fragment separator at GSI Darmstadt. The Gamow-Teller strength function B(GT), deduced from the observed β-delayed proton- and γ-emission and from the measured half-life of 102(2) ms, is compared to results obtained from large-scale sd-shell model calculations. (orig.)

  5. Automated Biometric Voice-Based Access Control in Automatic Teller Machine (ATM)

    OpenAIRE

    Yekini N.A.; Itegboje A.O.; Oyeyinka I.K.; Akinwole A.K.

    2012-01-01

    An automatic teller machine requires a user to pass an identity test before any transaction can be granted. The current method available for access control in ATM is based on smartcard. Efforts were made to conduct an interview with structured questions among the ATM users and the result proofed that a lot of problems was associated with ATM smartcard for access control. Among the problems are; it is very difficult to prevent another person from attaining and using a legitimate persons card, ...

  6. Role of the momentum transfer in the quenching of the Gamow-Teller strength

    Energy Technology Data Exchange (ETDEWEB)

    Marketin, Tomislav [Institut fuer Kernphysik, Technische Universitaet Darmstadt (Germany); Physics Department, Faculty of Science, University of Zagreb (Croatia); Martinez-Pinedo, Gabriel [Institut fuer Kernphysik, Technische Universitaet Darmstadt (Germany); Paar, Nils; Vretenar, Dario [Physics Department, Faculty of Science, University of Zagreb (Croatia)

    2012-07-01

    A fully consistent calculation of the Gamow-Teller strength is presented, based on a microscopic theoretical framework. Nuclear ground state is determined using the relativistic Hartree-Bogolyubov (RHB) model with density dependent meson-nucleon coupling constants, and transition rates are calculated via proton-neutron relativistic quasiparticle RPA using the same interaction as in the RHB equations. The (p,n) probe has a similar spin-isospin operator structure to the Gamow-Teller (GT) operator. However, they become comparable only if the GT cross section is measured at a very small momentum transfer q. At higher momentum transfer the isovector spin monopole (IVSM) mode occurs, with the r{sup 2}{sigma}{tau} transition operator. Unlike the Gamow-Teller operator which excites only the 0{Dirac_h}{omega} transitions, the isovector spin monopole operator can also excite 2{Dirac_h}{omega} transitions and can change the strength distribution at high excitation energies. We explore the strength beyond the resonance, examine the effect of momentum transfer on the total strength and compare the results with recent measurements.

  7. Judging Edward Teller: A Closer Look at One of the Most Influential Scientists of the Twentieth Century

    Energy Technology Data Exchange (ETDEWEB)

    Libby, S B

    2010-12-29

    Much has been written about Edward TEller, but little of it is objective. Given, on the one hand, his position as one of the most inventive theoretical physicists of the 20th century, and on the other, his central role in the development and advocacy of thermonuclear weapons, one might imagine it impossible at this point in history to write a scholarly, impartial account of Teller's life and his impact. Now, however, Istvan Hargittai, a prominent Hungarian physical chemist and historian of science, has written a balanced, thoughtful, and beautifully research biography that comes closest. Hargittai is uniquely qualified for this difficult task. Coming a generation and a half later from a similar Hungarian-Jewish background, Hargittai understands well the influences and terrible events that shaped Teller. The advent of virulent, political anti-Semitism, first in Hungary and then in Germany, made Teller twice a refugee. Both Teller and Hargittai lost close family in the Holocaust; Hargittai was himself liberated from a Nazi concentration camp as a child. While Teller was in the US by then, his and Hargittai's surviving family members in Hungary suffered mistreatment at the hands of the postwar Hungarian Communist dictatorship. Hargittai's informed Eastern European perspective also provides a fresh viewpoint to the cold war context of the second half of Teller's career. Furthermore, Hargittai's own scientific work in molecular structure clearly makes him appreciate of Teller's breakthroughs in that field in the 1930s.

  8. PREFACE: XXIst International Symposium on the Jahn-Teller Effect 2012

    Science.gov (United States)

    Koizumi, Hiroyasu

    2013-04-01

    (The PDF contains the full conference program, the list of sponsors and the conference poster.) The 21st International Symposium on the Jahn-Teller effect was held at the University of Tsukuba, Japan, from 26-31 August 2012. People from 23 different countries participated and the number of registered participants was 118. In this symposium, the phrase 'Jahn-Teller effect' was taken to have a rather broad meaning. We discussed the Jahn-Teller and pseudo Jahn-Teller distortions. We also discussed general vibronic problems, and the problems associated with the conical intersections of the potential energy surfaces. As is indicated in the subtitle of the present symposium, 'Physics and Chemistry of Symmetry Breaking', a number of different topics concerning symmetry breaking were also extensively discussed. In particular, we had many discussions on magnetism, ferroelectricity, and superconductivity. A subtle but important problem that was dealt with was the appearance of multi-valuedness in the use of multi-component wave functions. In the Jahn-Teller problems, we almost always use the multi-component wave functions, thus, the knowledge of the proper handling of multi-valuedness is very important. Digital computers are not good at dealing with multi-valuedness, but we need to somehow handle it in our calculations. A very well known example of successful handling is found in the problem of the molecular system with the conical intersection: we cannot obtain the solution that satisfies the single-valuedness of wave functions (SVWF) just using the potential energy surface generated by a package program, and solving the Schrödinger equation with the quantum Hamiltonian constructed from the classical counterpart by replacing the classical variables with the corresponding operators; however, if a gauge potential is included and the double-valuedness of the electronic wave functions around the conical intersections is taken into account, the solution that satisfies the SVWF

  9. THE EFFECT OF SALINITY-SODICITY AND GLYPHOSATE FORMULATIONS – AVANS PREMIUM 360 SL ON PHOSPHOMONOESTERASE ACTIVITIES IN SANDY LOAM

    Directory of Open Access Journals (Sweden)

    Maciej Płatkowski

    2016-01-01

    Full Text Available The aim of study was to determine the influence of NaCl and glyphosate-based herbicide Avans Premium 360 SL on acid and alkaline phosphomonoesterase activities in sandy loam. The experiment was carried out in laboratory conditions on sandy loam with Corg content 10.90 g/kg. Soil was divided into half kilogram samples and adjusted to 60% of maximum water holding capacity. In the experiment dependent variables were: I – dosages of Avans Premium 360 SL (0, a recommended field dosage – FD, a tenfold higher dosage – 10 FD and hundredfold higher dosage – 100 FD, II – amount of NaCl (0, 3% and 6%, III – day of experiment (1, 7, 14, 28 and 56. On days of experiment the activity of alkaline and acid phosphomonoesterase activity was assayed spectrophotometrically. The obtained result showed that the application of Avans Premium 360 SL decreased in acid and alkaline phosphomonoesterase activity in clay soil. Significant interaction effect between the dosage of Avans Premium 360 SL, NaCl amount and day of experiment was reported in the experiment. The inhibitory effect of Avans Premium 360 SL was the highest in soil with NaCl at the amount of 6%.

  10. Combined mild soil washing and compost-assisted phytoremediation in treatment of silt loams contaminated with copper, nickel, and chromium.

    Science.gov (United States)

    Sung, Menghau; Lee, Chi-Yi; Lee, Suen-Zone

    2011-06-15

    A new soil remediation option, combining the soil washing process using pure water followed by the compost-assisted phytoextraction, is evaluated using silt loams contaminated with plating wastewater containing Cu, Ni, and Cr. Plants utilized in this study are the rapeseeds, sunflowers, tomatoes, and soapworts. Phytoextraction operation was carried out in pot experiments over a period of 4 months. Metal concentrations in roots and shoots of plants were analyzed upon completion of each pot experiment. Hypothesis testing was employed in assessing the significance of difference in the experimental data. Results indicated that the rapeseed, a hyperaccumulator, is most effective in extracting metals from the compost-amended silt loams. The fast-growing sunflowers and tomatoes are comparable to rapeseeds in accumulating metals despite their relatively low metal concentrations in tissues. Bioaccumulation coefficients obtained for all plants are less than one, indicating that phytostabilization rather than phytoextraction is the dominant mechanism at this simulated final-phase condition. Copyright © 2011 Elsevier B.V. All rights reserved.

  11. Effect of Jahn-Teller distortion on the short range magnetic order in copper ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Abdellatif, M.H., E-mail: Mohamed.abdellatif@iit.it [Nanostrctures Department, Istituto Italiano di Tecnologia, via Morego 30, I-16163 Genova (Italy); Innocenti, Claudia [INSTM—Department of Chemistry, University of Florence, via della Lastruccia 3, I-50019 Sesto Fiorentino, FI (Italy); Liakos, Ioannis [Nanostrctures Department, Istituto Italiano di Tecnologia, via Morego 30, I-16163 Genova (Italy); Scarpellini, Alice; Marras, Sergio [Nanochemistry Department, Istituto Italiano di Tecnologia, via Morego 30, I-16163 Genova (Italy); Salerno, Marco [Nanostrctures Department, Istituto Italiano di Tecnologia, via Morego 30, I-16163 Genova (Italy)

    2017-02-15

    Copper ferrite of spinel crystal structure was synthesized in the form of nano-particles using citrate-gel auto-combustion method. The sample morphology and composition were identified using scanning electron microscopy, X-ray diffraction, and X-ray spectroscopy. The latter technique reveals an inverse spinel structure with Jahn-Teller tetragonal distortion. The static magnetization was measured using vibrating sample magnetometer. Magnetic force microscopy was used in combination with the magnetization data to demonstrate the finite size effect of the magnetic spins and their casting behavior due to the introduction of copper ions in the tetrahedral magnetic sub-lattices, which results in tetragonal distorting the spinel structure of the copper ferrite. The magnetic properties of materials are a result of the collective behavior of the magnetic spins, and magnetic force microscopy can probe the collective behavior of the magnetic spins in copper ferrite, yet providing a sufficient resolution to map the effects below the micrometer size scale, such as the magnetic spin canting. A theoretical study was done to clarify the finite size effect of Jahn-Teller distortion on the magnetic properties of the material. When the particles are in the nano-scale, below the single domain size, their magnetic properties are very sensitive to their size change. - Highlights: • The spin canting due to Jahn-Teller distortion in Copper ferrite can be detected using magnetic force microscope. • The contrast in the magnetic AFM image can be analyzed to give information not only about the surface spins but also about the canting of the core spins inside the aggregated cluster of magnetic nanoparticle.

  12. Jahn-Teller effect versus Hund's rule coupling in C60N-

    Science.gov (United States)

    Wehrli, S.; Sigrist, M.

    2007-09-01

    We propose variational states for the ground state and the low-energy collective rotator excitations in negatively charged C60N- ions (N=1,…,5) . The approach includes the linear electron-phonon coupling and the Coulomb interaction on the same level. The electron-phonon coupling is treated within the effective mode approximation which yields the linear t1u⊗Hg Jahn-Teller problem whereas the Coulomb interaction gives rise to Hund’s rule coupling for N=2,3,4 . The Hamiltonian has accidental SO(3) symmetry which allows an elegant formulation in terms of angular momenta. Trial states are constructed from coherent states and using projection operators onto angular momentum subspaces which results in good variational states for the complete parameter range. The evaluation of the corresponding energies is to a large extent analytical. We use the approach for a detailed analysis of the competition between Jahn-Teller effect and Hund’s rule coupling, which determines the spin state for N=2,3,4 . We calculate the low-spin-high-spin gap for N=2,3,4 as a function of the Hund’s rule coupling constant J . We find that the experimentally measured gaps suggest a coupling constant in the range J=60-80meV . Using a finite value for J , we recalculate the ground state energies of the C60N- ions and find that the Jahn-Teller energy gain is partly counterbalanced by the Hund’s rule coupling. In particular, the ground state energies for N=2,3,4 are almost equal.

  13. Spin and Pseudospin Symmetries with Trigonometric Pöschl-Teller Potential including Tensor Coupling

    Directory of Open Access Journals (Sweden)

    M. Hamzavi

    2013-01-01

    Full Text Available We study approximate analytical solutions of the Dirac equation with the trigonometric Pöschl-Teller (tPT potential and a Coulomb-like tensor potential for arbitrary spin-orbit quantum number κ under the presence of exact spin and pseudospin ( p -spin symmetries. The bound state energy eigenvalues and the corresponding two-component wave functions of the Dirac particle are obtained using the parametric generalization of the Nikiforov-Uvarov (NU method. We show that tensor interaction removes degeneracies between spin and pseudospin doublets. The case of nonrelativistic limit is studied too.

  14. Study of the giant Gamow-Teller resonance in nuclear beta-decay

    International Nuclear Information System (INIS)

    Dicklage, R.D. von; Hansen, P.G.

    1984-01-01

    A strong effort has been devoted to the development of new target-ion-source systems at ISOLDE which would give higher yields of proton-rich nuclei. The first break-trough has been obtained for the element argon where one recently was able to produce about three orders of magnitude higher yields than in the first experiments. This makes it possible to perform experiments, involving β-delayed protons and gamma-rays, which may give information about the giant Gamow-Teller resonance. This paper gives a report on the status of these experiments

  15. Description of the Gamov-Teller β+-decay of tin isotopes

    International Nuclear Information System (INIS)

    Kuz'min, V.A.; Solov'ev, V.G.

    1988-01-01

    The integrated log(ft) values of Gamow-Teller β + decays of the neutron-deficient tine isotopes are calculated in the random phase approximation with particle-hole and particle-particle residual interactions which parameters have been fixed earlier. For |g A /g V |=1 and |g A /g V |=1.263 a good correspondence with the experimental data is obtained for 104,106,108 Sn and a prediction is made for 102 Sn. It is shown that one cannot define from the rate of neutron-deficient nuclei β + decay the renormalization of the axial-vector weak interaction constant g A

  16. Experimental confirmation of the Jahn-Teller distortion of CH4+

    International Nuclear Information System (INIS)

    Gemmell, D.S.; Kanter, E.P.; Pietsch, W.J.

    1979-01-01

    Measured energy and angular distributions are reported for H + and C/sup n+/ (n = 2,3,4) fragments resulting from the collisional dissociation of 200-keV/amu CH/sub m/ + (m = 0 to 4) in thin carbon targets. From the systematic trends of these Coulomb explosion spectra, qualitative information can be obtained on the structures of these species. In particular, the series displays a narrowing of the carbon angular and energy widths as protons are symmetrically added around a central carbon atom and provide a focusing effect. Because of the Jahn-Teller distortion, the carbon width in CH 4 + is dramatically increased. 8 references

  17. Controllability of pure states for the Poeschl-Teller potential with a dynamical group SU(2)

    International Nuclear Information System (INIS)

    Dong, S.-H.; Tang Yu; Sun, G.-H.; Lara-Rosano, F.; Lozada-Cassou, M.

    2005-01-01

    The controllability of a quantum system for the modified Poeschl-Teller (MPT) potential with the discrete bound states is investigated. The creation and annihilation operators of this potential are constructed directly from the normalized wave function with the factorization method and associated to an su(2) algebra. It is shown that this quantum system with the nondegenerate discrete bound states can, in principle, be strongly completely controllable, i.e., the system eigenstates can be guided by the external field to approach arbitrarily close to a target state, which could be theoretically realized by the actions of the creation and annihilation operators on the ground state

  18. The beta-decay of 48Mn: improved data on Gamow-Teller quenching

    International Nuclear Information System (INIS)

    Szerypo, J.; Bazin, D.; Brown, B.A.

    1991-01-01

    Beta-decay studies of very proton-rich nuclides allow to investigate the phenomenon of quenching of Gamow-Teller transitions. A presentation of the experimental techniques is followed by the discussion of preliminray results of the measurements in comparison to shell-model calculations. A corresponding reinvestigation is discussed. A mass-separated 48 Mn beam was used from 12 C( 40 Ca,p3n) reactions. The 48 Mn decay spectroscopy was performed simultaneously in two beam lines of the mass separator. (G.P.) 13 refs.; 2 figs

  19. Gamow-Teller strength distributions and electron capture rates for 55Co and 56Ni

    International Nuclear Information System (INIS)

    Nabi, Jameel-Un; Rahman, Muneeb-Ur

    2005-01-01

    The Gamow-Teller strength (GT) distributions and electron capture rates on 55 Co and 56 Ni have been calculated using the proton-neutron quasiparticle random phase approximation theory. We calculate these weak interaction mediated rates over a wide temperature (0.01x10 9 -30x10 9 K) and density (10-10 11 gcm -3 ) domain. Electron capture process is one of the essential ingredients involved in the complex dynamics of supernova explosion. Our calculations of electron capture rates show differences with the reported shell model diagonalization approach calculations and are comparatively enhanced at presupernova temperatures. We note that the GT strength is fragmented over many final states

  20. Star wars and strategic defense initiatives: work activity and health symptoms of unionized bank tellers during work reorganization.

    Science.gov (United States)

    Seifert, A M; Messing, K; Dumais, L

    1997-01-01

    Work activity and health symptoms of bank tellers whose work was undergoing reorganization were examined during a university-union study of the health effects of work in women's traditional jobs. Data were gathered through collective and individual interviews, analysis of work activity, and a questionnaire administered to 305 tellers. Employees worked in a standing posture over 80 percent of the time. More than two-thirds frequently suffered pain in back, legs, and feet. The average teller had been involved in 3.7 robberies as a direct victim and six as a witness. Work required feats of memory and concentration. In order to meet job demands, tellers engaged in supportive activities and teamwork. The introduction of individualized objectives threatened the employees' ability to collaborate and induced distress. More than twice as many tellers as other female workers in Québec experience psychological distress (Ilfeld scale), related to: robbery during the past two years (odds ratio = 1.7; confidence interval = 1.0-2.9); difficult relations with superiors (O.R. = 2.6; C.I. = 1.3-5.3); and full-time work (O.R. = 2.3; C.I. = 1.3-3.9). Diverse methods enriched the analysis, and union participation allowed the proposal of concrete correction measures.

  1. Evaluation of Diuron Tolerance and Biotransformation by Fungi from a Sugar Cane Plantation Sandy-Loam Soil.

    Science.gov (United States)

    Perissini-Lopes, Bruna; Egea, Tássia Chiachio; Monteiro, Diego Alves; Vici, Ana Cláudia; Da Silva, Danilo Grünig Humberto; Lisboa, Daniela Correa de Oliveira; de Almeida, Eduardo Alves; Parsons, John Robert; Da Silva, Roberto; Gomes, Eleni

    2016-12-14

    Microorganisms capable of degrading herbicides are essential to minimize the amount of chemical compounds that may leach into other environments. This work aimed to study the potential of sandy-loam soil fungi to tolerate the herbicide Herburon (50% diuron) and to degrade the active ingredient diuron. Verticillium sp. F04, Trichoderma virens F28, and Cunninghamella elegans B06 showed the highest growth in the presence of the herbicide. The evaluation of biotransformation showed that Aspergillus brasiliensis G08, Aspergillus sp. G25, and Cunninghamella elegans B06 had the greatest potential to degrade diuron. Statistical analysis demonstrated that glucose positively influences the potential of the microorganism to degrade diuron, indicating a cometabolic process. Due to metabolites founded by diuron biotransformation, it is indicated that the fungi are relevant in reducing the herbicide concentration in runoff, minimizing the environmental impact on surrounding ecosystems.

  2. Direct and Indirect Short-term Effects of Biochar on Physical Characteristics of an Arable Sandy Loam

    DEFF Research Database (Denmark)

    Sun, Zhencai; Moldrup, Per; Elsgaard, Lars

    2013-01-01

    Biochar addition to agricultural soil is reported in several studies to reduce climate gas emissions, boost carbon storage, and improve soil fertility and crop productivity. These effects may be partly related to soil physical changes resulting from biochar amendment, but knowledge of how biochar...... application mechanistically affects soil physical characteristics is limited. This study investigated the effect of biochar application on soil structural and functional properties, including specific surface area, water retention, and gas transport parameters. Intact soil cores were taken from a field...... experiment on an arable sandy loam that included four reference plots without biochar and four plots with 20 tons ha(-1) biochar incorporated into the upper 20 cm 7 months before sampling. Water retention was measured at matric potentials ranging from wet (pF 1.0) to extremely dry conditions (pF similar to 6...

  3. Soil water retention, air flow and pore structure characteristics after corn cob biochar application to a tropical sandy loam

    DEFF Research Database (Denmark)

    Amoakwah, Emmanuel; Frimpong, Kwame Agyei; Okae-Anti, D

    2017-01-01

    Soil structure is a key soil physical property that affects soil water balance, gas transport, plant growth and development, and ultimately plant yield. Biochar has received global recognition as a soil amendment with the potential to ameliorate the structure of degraded soils. We investigated how...... corn cob biochar contributed to changes in soil water retention, air flow by convection and diffusion, and derived soil structure indices in a tropical sandy loam. Intact soil cores were taken from a field experiment that had plots without biochar (CT), and plots each with 10 t ha− 1 (BC-10), 20 t ha...... to significant increase in soil water retention compared to the CT and BC-10 as a result of increased microporosity (pores biochar had minimal impact. No significant influence of biochar was observed for ka and Dp/D0 for the BC treatments compared to the CT despite...

  4. Biochar effects on wet and dry regions of the soil water retention curve of a sandy loam

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Moldrup, Per; Sun, Zhencai

    2014-01-01

    Reported beneficial effects of biochar on soil physical properties and processes include decreased soil density, and increased soil water transport, water holding capacity and retention (mainly for the wet region). Research is limited on biochar effects on the full soil water retention curve (wet...... and dry regions) for a given soil and biochar amendment scenarios. This study evaluates how biochar applied to a sandy loam field at rates from 0 to 50 Mg ha−1 yr–1 in 2011, 2012, or both years (2011+2012) influences the full water retention curve. Inorganic fertilizer and pig slurry were added to all...... treatments. Six months after the last biochar application, intact and disturbed soil samples were collected for analyses. Soil water retention was measured from −1 kPa to −100 kPa using tension tables and ceramic plates and from −10 MPa to −480 MPa using a Vapor Sorption Analyzer. Soil specific area...

  5. Influence of Long-term Application of Feedlot Manure Amendments on Water Repellency of a Clay Loam Soil.

    Science.gov (United States)

    Miller, Jim J; Beasley, Bruce W; Hazendonk, Paul; Drury, Craig F; Chanasyk, David S

    2017-05-01

    Long-term application of feedlot manure to cropland may increase the quantity of soil organic carbon (C) and change its quality, which may influence soil water repellency. The objective was to determine the influence of feedlot manure type (stockpiled vs. composted), bedding material (straw [ST] vs. woodchips [WD]), and application rate (13, 39, or 77 Mg ha) on repellency of a clay loam soil after 17 annual applications. The repellency was determined on all 14 treatments using the water repellency index ( index), the water drop penetration time (WDPT) method, and molarity of ethanol (MED) test. The C composition of particulate organic matter in soil of five selected treatments after 16 annual applications was also determined using C nuclear magnetic resonance-direct polarization with magic-angle spinning (NMR-DPMAS). Manure type had no significant ( > 0.05) effect on index and WDPT, and MED classification was similar. Mean index and WDPT values were significantly greater and MED classification more hydrophobic for WD than ST. Application rate had no effect on the index, but WDPT was significantly greater and MED classification more hydrophobic with increasing application rate. Strong ( > 0.7) but nonsignificant positive correlations were found between index and WDPT versus hydrophobic (alkyl + aromatic) C, lignin at 74 ppm (O-alkyl), and unspecified aromatic compounds at 144 ppm. Specific aromatic compounds also contributed more to repellency than alkyl, O-alkyl, and carbonyl compounds. Overall, all three methods consistently showed that repellency was greater for WD- than ST-amended clay loam soil, but manure type had no effect. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  6. AES Cardless Automatic Teller Machine (ATM) Biometric Security System Design Using FPGA Implementation

    Science.gov (United States)

    Ahmad, Nabihah; Rifen, A. Aminurdin M.; Helmy Abd Wahab, Mohd

    2016-11-01

    Automated Teller Machine (ATM) is an electronic banking outlet that allows bank customers to complete a banking transactions without the aid of any bank official or teller. Several problems are associated with the use of ATM card such card cloning, card damaging, card expiring, cast skimming, cost of issuance and maintenance and accessing customer account by third parties. The aim of this project is to give a freedom to the user by changing the card to biometric security system to access the bank account using Advanced Encryption Standard (AES) algorithm. The project is implemented using Field Programmable Gate Array (FPGA) DE2-115 board with Cyclone IV device, fingerprint scanner, and Multi-Touch Liquid Crystal Display (LCD) Second Edition (MTL2) using Very High Speed Integrated Circuit Hardware (VHSIC) Description Language (VHDL). This project used 128-bits AES for recommend the device with the throughput around 19.016Gbps and utilized around 520 slices. This design offers a secure banking transaction with a low rea and high performance and very suited for restricted space environments for small amounts of RAM or ROM where either encryption or decryption is performed.

  7. Rotational Parameters from Vibronic Eigenfunctions of Jahn-Teller Active Molecules

    Science.gov (United States)

    Garner, Scott M.; Miller, Terry A.

    2017-06-01

    The structure in rotational spectra of many free radical molecules is complicated by Jahn-Teller distortions. Understanding the magnitudes of these distortions is vital to determining the equilibrium geometric structure and details of potential energy surfaces predicted from electronic structure calculations. For example, in the recently studied {\\widetilde{A}^2E^{''} } state of the NO_3 radical, the magnitudes of distortions are yet to be well understood as results from experimental spectroscopic studies of its vibrational and rotational structure disagree with results from electronic structure calculations of the potential energy surface. By fitting either vibrationally resolved spectra or vibronic levels determined by a calculated potential energy surface, we obtain vibronic eigenfunctions for the system as linear combinations of basis functions from products of harmonic oscillators and the degenerate components of the electronic state. Using these vibronic eigenfunctions we are able to predict parameters in the rotational Hamiltonian such as the Watson Jahn-Teller distortion term, h_1, and compare with the results from the analysis of rotational experiments.

  8. Enhanced way of securing automated teller machine to track the misusers using secure monitor tracking analysis

    Science.gov (United States)

    Sadhasivam, Jayakumar; Alamelu, M.; Radhika, R.; Ramya, S.; Dharani, K.; Jayavel, Senthil

    2017-11-01

    Now a days the people's attraction towards Automated Teller Machine(ATM) has been increasing even in rural areas. As of now the security provided by all the bank is ATM pin number. Hackers know the way to easily identify the pin number and withdraw money if they haven stolen the ATM card. Also, the Automated Teller Machine is broken and the money is stolen. To overcome these disadvantages, we propose an approach “Automated Secure Tracking System” to secure and tracking the changes in ATM. In this approach, while creating the bank account, the bank should scan the iris known (a part or movement of our eye) and fingerprint of the customer. The scanning can be done with the position of the eye movements and fingerprints identified with the shortest measurements. When the card is swiped then ATM should request the pin, scan the iris and recognize the fingerprint and then allow the customer to withdraw money. If somebody tries to break the ATM an alert message is given to the nearby police station and the ATM shutter is automatically closed. This helps in avoiding the hackers who withdraw money by stealing the ATM card and also helps the government in identifying the criminals easily.

  9. On the relation between Jahn-Teller ordering and charge ordering

    International Nuclear Information System (INIS)

    Eijndhoven, J.C.M van.

    1978-01-01

    This thesis compares the structures of KCusup(II)F 3 and Cs 2 Ausup(I)Ausup(III)Cl 6 . Both compounds have a structure that can be thought to result from a deformation of the cubic perovskite structure. The deformation of KCusup(II)F 3 is a result of a cooperative Jahn-Teller effect and the deformation of Cs 2 Ausup(I)Ausup(III)Cl 6 results in two sublattices. The structures of both compounds result from a continuous phase transition from the cubic pervskite structure due to a deformation of symmetry. Using local coordinates and a calculation of the electron-lattice interaction in a static approximation, four structure types were derived. One is the structure of Cs 2 AuAuCl 6 at ambient temperature and pressure and the second contains a group of structures corresponding to the structures found for KCuF 3 . The third structure type was recently suggested for Cs 2 AuAuCl 6 under pressure and the fourth has not been found experimentally. Two types show a Jahn-Teller ordering and the other two charge ordering (Auth./C.F.)

  10. New SUSYQM coherent states for Pöschl–Teller potentials: a detailed mathematical analysis

    International Nuclear Information System (INIS)

    Bergeron, H; Siegl, P; Youssef, A

    2012-01-01

    In a recent short note (Bergeron et al 2010 Europhys. Lett. 92 60003), we have presented the good properties of a new family of semi-classical states for Pöschl–Teller potentials. These states are built from a supersymmetric quantum mechanics (SUSYQM) approach and the parameters of these ‘coherent’ states are points in the classical phase space. In this paper, we develop all the mathematical aspects that have been left out of the previous paper (proof of the resolution of unity, detailed calculations of the quantized version of classical observables and mathematical study of the resulting operators: problems of domains, self-adjointness or self-adjoint extensions). Some additional questions such as asymptotic behavior are also studied. Moreover, the framework is extended to a larger class of Pöschl–Teller potentials. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical devoted to ‘Coherent states: mathematical and physical aspects’. (paper)

  11. Characteristics of the Gamow-Teller Force in the β- Decay of 40Zr98

    International Nuclear Information System (INIS)

    Raden Oktova

    2002-01-01

    The characteristics of the β - decay force for the Gamow-Teller transition in the p-h and the p-p channels in the heavy neutron-rich nucleus 40 Zr 98 have been studied. The ground state single-particle levels in the parent nucleus were calculated self-consistently using the Fayans energy-density functional, and from them the quasi-particle basis was obtained using the BCS model. The residual charge-changing force responsible for the β - transition was taken as having a zero-range (a delta function); in the p-h channel the spin-isospin exchange → σ 1 . → σ 2 → τ 1 . → τ 2 term in the Migdal-Larkin force was used, and that in the p-p channel was a constant. The method employed was the proton-neutron QRPA (pnQRPA). The results show that the proton-neutron pairing p-p force in the Gamow-Teller decay is negligible for the nucleus considered. The value of the p-h force obtained is g ' = 0.735, slightly larger than the standard value of g ' = 0.7 commonly used for stable nuclei. (author)

  12. A study of Gamow-Teller strength in A=37 nuclei

    International Nuclear Information System (INIS)

    Aufderheide, M.B.; Bloom, S.D.; Resler, D.A.; Goodman, C.D.

    1992-01-01

    An analysis is made of the recent β+ decay measurements of Garcia et al., in order to see whether the 1981 37 Cl(p,n) 37 Ar measurements of Rapaport et al. are consistent with them. Garcia et al., were not able to determine the amount of Gamow-Teller strength in the isobaric analog state (IAS) or the Coulomb mixing of Fermi strength to a state near the IAS, and were forced to determine the amount of Gamow-Teller strength in the daughter 1371 keV state by making the branching ratios sum to unity. These uncertainties leave a range of possible values open which we investigate. We find that the experiments are consistent within part of this range. We also examine the effect of this range of allowed values on solar and supernova neutrino cross sections of 37 Cl and find weak dependence on the uncertainties described here. We discuss how this range can be narrowed so that the consistency of the two experiments can be conclusively tested

  13. A Genuine Jahn-Teller System with Compressed Geometry and Quantum Effects Originating from Zero-Point Motion

    DEFF Research Database (Denmark)

    Aramburu, José Antonio; García-Fernández, Pablo; García Lastra, Juan Maria

    2016-01-01

    that the anomalous positive g∥ shift (g∥−g0=0.065) measured at T=20 K obeys the superposition of the |3 z2−r2⟩ and |x2−y2⟩ states driven by quantum effects associated with the zero-point motion, a mechanism first put forward by O'Brien for static Jahn–Teller systems and later extended by Ham to the dynamic Jahn...... of the calculated energy barriers for different Jahn–Teller systems allowed us to explain the origin of the compressed geometry observed for CaO:Ni+....

  14. The Design and Implementation of a Low Cost and High Security Smart Home System Based on Wi-Fi and SSL Technologies

    Science.gov (United States)

    Xu, Chong-Yao; Zheng, Xin; Xiong, Xiao-Ming

    2017-02-01

    With the development of Internet of Things (IoT) and the popularity of intelligent mobile terminals, smart home system has come into people’s vision. However, due to the high cost, complex installation and inconvenience, as well as network security issues, smart home system has not been popularized. In this paper, combined with Wi-Fi technology, Android system, cloud server and SSL security protocol, a new set of smart home system is designed, with low cost, easy operation, high security and stability. The system consists of Wi-Fi smart node (WSN), Android client and cloud server. In order to reduce system cost and complexity of the installation, each Wi-Fi transceiver, appliance control logic and data conversion in the WSN is setup by a single chip. In addition, all the data of the WSN can be uploaded to the server through the home router, without having to transit through the gateway. All the appliance status information and environmental information are preserved in the cloud server. Furthermore, to ensure the security of information, the Secure Sockets Layer (SSL) protocol is used in the WSN communication with the server. What’s more, to improve the comfort and simplify the operation, Android client is designed with room pattern to control home appliances more realistic, and more convenient.

  15. Quantum information entropies of the eigenstates for the P(o)schl-Teller-like potential

    Institute of Scientific and Technical Information of China (English)

    Guo-Hua Sun; M.Avila Aoki; Shi-Hai Dong

    2013-01-01

    Shannon entropy for lower position and momentum eigenstates of P(o)schl-Teller-like potential is evaluated.Based on the entropy densities demonstrated graphically,we note that the wave through of the position information entropy density ρ(x) moves right when the potential parameter V1 increases and its amplitude decreases.However,its wave through moves left with the increase in the potential parameter |V2|.Concerning the momentum information entropy density p(p),we observe that its amplitude increases with increasing potential parameter V1,but its amplitude decreases with increasing |V2|.The Bialynicki-Birula-Mycielski (BBM) inequality has also been tested for a number of states.Moreover,there exist eigenstates that exhibit squeezing in the momentum information entropy.Finally,we note that position information entropy increases with V1,but decreases with |V2|.However,the variation of momentum information entropy is contrary to that of the position information entropy.

  16. Effect on Tensor Correlations on Gamow- Teller States in 90Zr and 208Pb

    International Nuclear Information System (INIS)

    Bai, C. L.; Sagawa, H.; Zhang, H. Q.

    2009-01-01

    The tensor terms of the Skyrme effective interaction are included in the self-consistent Hartree-Fock plus Random Phase Approximation (HF-RPA) model. The Gamow-Teller (GT) strength function of 9 0Z r and 2 08P b are calculated with and without the tensor terms. The main peaks are moved downwards by about 2 MeV when including the tensor contribution. About 10% of the non-energy weighted sum rule is shifted to the excitation energy region above 30 MeV by the RPA tensor correlations. The contribution of the tensor terms to the energy weighted sum rule is given analytically, and compared to the outcome of RPA. A microscopic origin of the quenching of GT sum rule is discussed in relation with the coupling to giant spin-quadrupole excitations by the tensor interactions.(author)

  17. Analysis of the workload of bank tellers of a Brazilian public institution.

    Science.gov (United States)

    Serikawa, Simoni S; Albieri, Ana Carolina S; Bonugli, Gustavo P; Greghi, Marina F

    2012-01-01

    During the last decades there have been many changes in the banking sector organization. It has been also observed the mutual growing of musculoskeletal and mental disorders. This study investigated the workload of bank tellers at a Brazilian public institution. It was performed the Ergonomic Work Analysis (EWA). Three employees participated in this study. During the analysis process, three research instruments were applied: Inventory of Work and Risk of Illness, Yoshitake Fatigue Questionnaire and Nordic Musculoskeletal Questionnaire, beyond the realization of footage recordings and the self-confrontation. The results indicated the existence of an excess of workload on the evaluated workstations, mainly in relation to mental order constraints, that overlaps the physical aspects. Thereby it was found that the employees tend to adopt strategies trying to reduce the impacts of the excess of workload, in order to regulate it.

  18. Effect of Tensor Correlations on Gamow-Teller States in 90Zr and 208Pb

    International Nuclear Information System (INIS)

    Bai, C. L.; Zhang, H. Q.; Zhang, X. Z.

    2009-01-01

    The tensor terms of the Skyrme effective interaction are included in the self-consistent Hartree-Fock plus Random Phase Approximation (HF-RPA) model. The Gamow-Teller (GT) strength functions of 9 0Z r and 2 08P b is calculated with and without the tensor terms. The main peaks are moved downwards by about 2 MeV when including the tensor contribution. About 10% of the non-energy weighted sum rule is shifted to the excitation energy region above 30 MeV by the RPA tensor correlations. The contribution of the tensor terms to the energy weighted sum rule is given analytically, and compared to the outcome of RPA. A microscopic origin of the quenching of GT sum rule due to the tensor force is discussed.(author)

  19. Quantum information entropies of the eigenstates for the Pöschl—Teller-like potential

    International Nuclear Information System (INIS)

    Sun Guo-Hua; Aoki, M. Avila; Dong Shi-Hai

    2013-01-01

    Shannon entropy for lower position and momentum eigenstates of Pöschl—Teller-like potential is evaluated. Based on the entropy densities demonstrated graphically, we note that the wave through of the position information entropy density ρ(x) moves right when the potential parameter V 1 increases and its amplitude decreases. However, its wave through moves left with the increase in the potential parameter |V 2 |. Concerning the momentum information entropy density ρ(p), we observe that its amplitude increases with increasing potential parameter V 1 , but its amplitude decreases with increasing |V 2 |. The Bialynicki—Birula—Mycielski (BBM) inequality has also been tested for a number of states. Moreover, there exist eigenstates that exhibit squeezing in the momentum information entropy. Finally, we note that position information entropy increases with V 1 , but decreases with |V 2 |. However, the variation of momentum information entropy is contrary to that of the position information entropy. (general)

  20. The effect of band Jahn-Teller distortion on the magnetoresistivity of manganites: a model study

    International Nuclear Information System (INIS)

    Rout, G C; Panda, Saswati; Behera, S N

    2011-01-01

    We present a model study of magnetoresistance through the interplay of magnetisation, structural distortion and external magnetic field for the manganite systems. The manganite system is described by the Hamiltonian which consists of the s-d type double exchange interaction, Heisenberg spin-spin interaction among the core electrons, and the static and dynamic band Jahn-Teller (JT) interaction in the e g band. The relaxation time of the e g electron is found from the imaginary part of the Green's function using the total Hamiltonian consisting of the interactions due to the electron and phonon. The calculated resistivity exhibits a peak in the pure JT distorted insulating phase separating the low temperature metallic ferromagnetic phase and the high temperature paramagnetic phase. The resistivity is suppressed with the increase of the external magnetic field. The e g electron band splitting and its effect on magnetoresistivity is reported here. (paper)

  1. The effect of band Jahn-Teller distortion on the magnetoresistivity of manganites: a model study

    Energy Technology Data Exchange (ETDEWEB)

    Rout, G C [Condensed Matter Physics Group, P G Department of Applied Physics and Ballistics, F M University, Balasore 756 019 (India); Panda, Saswati [Trident Academy of Technology, F2/A, Chandaka Industrial Estate, Bhubaneswar 751 024 (India); Behera, S N, E-mail: gcr@iopb.res.in, E-mail: saswatip7@gmail.com [National Institute of Science and Technology, Palur Hills, Berhampur 761 008 (India)

    2011-10-05

    We present a model study of magnetoresistance through the interplay of magnetisation, structural distortion and external magnetic field for the manganite systems. The manganite system is described by the Hamiltonian which consists of the s-d type double exchange interaction, Heisenberg spin-spin interaction among the core electrons, and the static and dynamic band Jahn-Teller (JT) interaction in the e{sub g} band. The relaxation time of the e{sub g} electron is found from the imaginary part of the Green's function using the total Hamiltonian consisting of the interactions due to the electron and phonon. The calculated resistivity exhibits a peak in the pure JT distorted insulating phase separating the low temperature metallic ferromagnetic phase and the high temperature paramagnetic phase. The resistivity is suppressed with the increase of the external magnetic field. The e{sub g} electron band splitting and its effect on magnetoresistivity is reported here. (paper)

  2. Gamow-Teller resonances and a separable approximation for Skyrme tensor interactions

    Directory of Open Access Journals (Sweden)

    Severyukhin A. P.

    2012-12-01

    Full Text Available A finite rank separable approximation for the quasiparticle random phase approximation (QRPA with Skyrme interactions is applied to study properties of the Gamow-Teller (GT resonances in the neutron-rich Cd isotopes. This approximation enables one to reduce considerably the dimension of matrix that must be diagonalized to perform QRPA calculations in a very large configuration space. Our results from the SGII Skyrme interaction with the tensor interactions and the density-dependent zero-range pairing interaction show that the GT distribution is noticeably modified when the tensor correlations are taken into account. In particular, for 130Cd the dominant peak is moved 3.6 MeV downward and 10% of the GT distribution is shifted to the high excitation energy region near E=50MeV.

  3. IMPACT OF NEW GAMOW–TELLER STRENGTHS ON EXPLOSIVE TYPE IA SUPERNOVA NUCLEOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Kanji; Famiano, Michael A.; Kajino, Toshitaka; Suzuki, Toshio [National Astronomical Observatory of Japan 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Hidaka, Jun [Mechanical Engineering Department, Meisei University, 2-1-1 Hodokubo, Hino, Tokyo 191-8506 (Japan); Honma, Michio [Center for Mathematical Sciences, University of Aizu, Aizu-Wakamatsu, Fukushima 965-8580 (Japan); Iwamoto, Koichi [Department of Physics, College of Science and Technology, Nihon University, Tokyo 101-8308 (Japan); Nomoto, Ken’ichi [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Otsuka, Takaharu, E-mail: kanji.mori@nao.ac.jp, E-mail: kajino@nao.ac.jp, E-mail: michael.famiano@wmich.edu, E-mail: suzuki@phys.chs.nihon-u.ac.jp, E-mail: jun.hidaka@meisei-u.ac.jp, E-mail: m-honma@u-aizu.ac.jp, E-mail: iwamoto@phys.cst.nihon-u.ac.jp, E-mail: nomoto@astron.s.u-tokyo.ac.jp, E-mail: otsuka@phys.s.u-tokyo.ac.jp [Department of Physics, Graduate School of Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan)

    2016-12-20

    Recent experimental results have confirmed a possible reduction in the Gamow–Teller (GT{sub +}) strengths of pf-shell nuclei. These proton-rich nuclei are of relevance in the deflagration and explosive burning phases of SNe Ia. While prior GT strengths result in nucleosynthesis predictions with a lower-than-expected electron fraction, a reduction in the GT{sub +} strength can result in a slightly increased electron fraction compared to previous shell model predictions, though the enhancement is not as large as previous enhancements in going from rates computed by Fuller, Fowler, and Newman based on an independent particle model. A shell model parametrization has been developed that more closely matches experimental GT strengths. The resultant electron-capture rates are used in nucleosynthesis calculations for carbon deflagration and explosion phases of SNe Ia, and the final mass fractions are compared to those obtained using more commonly used rates.

  4. Jahn-Teller effect in Rydberg series: A multi-state vibronic coupling problem

    International Nuclear Information System (INIS)

    Staib, A.; Domcke, W.; Sobolewski, A.L.

    1990-01-01

    Two simple limiting cases of Jahn-Teller (JT) coupling in Rydberg states of polyatomic molecules are considered, namely (i) JT coupling in Rydberg orbitals as well as in the ionization continuum (nondegenerate ion core, degenerate Rydberg series) and (ii) JT coupling in the ion core (degenerate ion core, nondegenerate Rydberg series). For both models simple and efficient algorithms for the computation of spectra (dynamical JT effect) are developed. The orbital JT effect is shown to represent a novel type of multi-state vibronic coupling, giving rise to interesting spectroscopic phenomena, among them resonant inter-Rydberg perturbations and JT induced autoionization. Particular attention is paid to the demonstration of the characteristic spectroscopic signatures of the two types of JT coupling in Rydberg states. (orig.)

  5. Gamow-Teller Strengths from (3He,t) Charge-Exchange Reaction

    International Nuclear Information System (INIS)

    Fujita, Yoshitaka

    2006-01-01

    Gamow-Teller (GT) transition is the most popular nuclear weak process with the nature of spin-isospin excitation. GT transitions in pf-shell nuclei, including those starting from unstable nuclei, are of interest, due to their importance in astrophysical processes. Weak processes, however, gives us rather limited information on the GT response of nuclei. We introduce high-resolution ( 3 He, t) reaction at 0 0 and at an intermediate beam energy as a new spectroscopic tool for studying GT excitations. Owing to the high energy-resolution of the reaction (∼ 30 keV), individual transitions can be observed up to the region of GT giant resonance. Assuming isospin symmetry for the T z = ±1 → 0 isobaric analogous transitions in isobars with mass number A, we present a new method to deduce GT transition strengths starting from proton rich exotic nuclei

  6. Role of momentum transfer in the quenching of the Gamow-Teller strength

    International Nuclear Information System (INIS)

    Marketin, T.; Martínez-Pinedo, G.; Paar, N.; Vretenar, D.

    2012-01-01

    A recent analysis of (p,n) and (n,p) reaction data from 90 Zr was performed recently, where a significant amount of Gamow-Teller strength was found above the resonance, an energy region previously unreachable by experimental setups. The extracted strengths in the β − and the β + channel indicate that approximately 10% of the total strength necessary to satisfy the model independent Ikeda sum rule is missing. One possible source of this discrepancy is the treatment of the isovector spin monopole (IVSM) mode of excitation which has been found to occurr at high excitation energies. Employing the relativistic Hartree-Bogoliubov (RHB) model and the protonneutron relativistic quasiparticle random phase approximation (pn-RQRPA) to calculate the nuclear response, we explore the contribution of the IVSM mode to the total L= 0 strength and apply our results to the available data.

  7. Role of momentum transfer in the quenching of the Gamow-Teller strength

    Energy Technology Data Exchange (ETDEWEB)

    Marketin, T.; Martinez-Pinedo, G.; Paar, N.; Vretenar, D. [Institut fuer Kernphysik, Technische Universitaet Darmstadt, D-64289 Darmstadt, Germany and Physics Department, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia); Institut fuer Kernphysik, Technische Universitaet Darmstadt, D-64289 Darmstadt (Germany); Physics Department, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia)

    2012-10-20

    A recent analysis of (p,n) and (n,p) reaction data from {sup 90}Zr was performed recently, where a significant amount of Gamow-Teller strength was found above the resonance, an energy region previously unreachable by experimental setups. The extracted strengths in the {beta}{sub -} and the {beta}{sub +} channel indicate that approximately 10% of the total strength necessary to satisfy the model independent Ikeda sum rule is missing. One possible source of this discrepancy is the treatment of the isovector spin monopole (IVSM) mode of excitation which has been found to occurr at high excitation energies. Employing the relativistic Hartree-Bogoliubov (RHB) model and the protonneutron relativistic quasiparticle random phase approximation (pn-RQRPA) to calculate the nuclear response, we explore the contribution of the IVSM mode to the total L= 0 strength and apply our results to the available data.

  8. Some comments on 'Jahn-Teller effect in coronene monoanion: a comparative study with corannulene monoanion' [Chem. Phys. 287 (2003) 91

    International Nuclear Information System (INIS)

    Breza, M.

    2003-01-01

    A group-theoretical analysis of Jahn-Teller distortions using step-by-step symmetry descent method is based on consecutive removal of symmetry elements during electron degeneracy splitting. The results of this treatment imply that the Jahn-Teller effect in D 6h parent symmetry group may result in stable geometries of D 2h , D 2 , C 2h , C 2v , C 2 , C i , C s and/or C 1 symmetries. The Jahn-Teller effect in D 5h parent group may result in C 2v , C 2 , C s and/or C 1 stable geometries. All these symmetry groups may correspond to classical saddle points of Jahn-Teller energy hypersurfaces. Possible electronic states in these geometries may be also predicted. Such complex hypersurfaces cannot be described by the classical treatments based on Jahn-Teller active coordinates

  9. Jahn-Teller distortions, cation ordering and octahedral tilting in perovskites

    International Nuclear Information System (INIS)

    Lufaso, M.W.; Woodward, P.M.

    2004-01-01

    In transition metal oxides, preferential occupation of specific d orbitals on the transition metal ion can lead to the development of a long-range ordered pattern of occupied orbitals. This phenomenon, referred to as orbital ordering, is usually observed indirectly from the cooperative Jahn-Teller distortions (CJTDs) that result as a consequence of the orbital ordering. This paper examines the interplay between orbital ordering, octahedral tilting and cation ordering in perovskites. Both ternary AMX 3 perovskites containing an active Jahn-Teller (J-T) ion on the octahedral site and quaternary A 2 MM'X 6 perovskites containing a J-T ion on one-half of the octahedral sites have been examined. In AMX 3 perovskites, the tendency is for the occupied 3d 3x 2 -r 2 and 3d 3z 2 -r 2 orbitals to order in the ac plane, as exemplified by the crystal structures of LaMnO 3 and KCuF 3 . This arrangement maintains a favorable coordination environment for the anion sites. In AMX 3 perovskites, octahedral tilting tends to enhance the magnitude of the J-T distortions. In A 2 MM'X 6 perovskites, the tendency is for the occupied 3d 3z 2 -r 2 orbitals to align parallel to the c axis. This pattern maintains a favorable coordination environment about the symmetric M'-cation site. The orbital ordering found in rock-salt ordered A 2 MM'X 6 perovskites is compatible with octahedral rotations about the c axis (Glazer tilt system a 0 a 0 c - ) but appears to be incompatible with GdFeO 3 -type octahedral tilting (tilt system - b + a - ). (orig.)

  10. Energy spectra of the hyperbolic and second Poeschl-Teller like potentials solved by new exact quantization rule

    International Nuclear Information System (INIS)

    Dong Shihai; Gonzalez-Cisneros, A.

    2008-01-01

    A new exact quantization rule simplifies the calculation of the energy levels for the exactly solvable quantum system. In this work we calculate the energy levels of the Schroedinger equation with the hyperbolic potential by this quantization rule. The corresponding eigenfunction is also derived for completeness. The second Poeschl-Teller like potential case is also carried out

  11. Gamow-Teller strength function for 90Zr: Effects of spin and isospin exchange forces, and ground-state correlations

    International Nuclear Information System (INIS)

    Mathews, G.J.; Bloom, S.D.; Hausman, R.F. Jr.

    1983-01-01

    Shell-model calculations of the Gamow-Teller strength function for 90 Zr have been performed utilizing a realistic finite-range two-body interaction in a model space consisting of the 2p and 1g shells. The effects of admixtures of two-particle two-hole excitations in 90 Nb, mostly due to the spin and isospin exchange components of the nucleon-nucleon force, are discussed. Ground state correlations in 90 Zr are also added via seniority-zero two-proton excitations from the 2p shell into the 1g/sub 9/2/ shell. With the correlations the Gamow-Teller strength function is in good agreement with the experimental results and accounts for essentially all of the observed dispersion of strength. The inclusion of these correlations does not, however, produce either a displacement of Gamow-Teller strength to higher excitation energies, or a significant change in the total strength. Thus, they cannot account for the observed Gamow-Teller quenching. The quenching factor derived by a comparison of our calculated results with experiment is 0.52

  12. Isospin symmetry of T-z=+/- 3/2 ->+/- 1/2 Gamow-Teller transitions in A=41 nuclei

    NARCIS (Netherlands)

    Fujita, Y; Shimbara, Y; Adachi, T; Berg, GPA; Fujita, H; Hatanaka, K; Kamiya, J; Nakanishi, K; Sakemi, Y; Sasaki, S; Shimizu, Y; Tameshige, Y; Uchida, M; Wakasa, T; Yosoi, M

    2004-01-01

    Under the assumption that isospin T is a good quantum number, isobaric analog states and various analogous transitions are expected in isobars with mass number A. The, strengths of T-z = +/-3/2 --> 1/2 analogous Gamow-Teller (GT) transitions and analogous M1 transitions within the A = 41 isobar

  13. Isospin symmetry of T-z=+/- 3/2 ->+/- 1/2 Gamow-Teller transitions in A=41 nuclei

    NARCIS (Netherlands)

    Fujita, Y; Shimbara, Y; Adachi, T; Berg, GPA; Fujita, H; Hatanaka, K; Kamiya, J; Nakanishi, K; Sakemi, Y; Sasaki, S; Shimizu, Y; Tameshige, Y; Uchida, M; Wakasa, T; Yosoi, M

    Under the assumption that isospin T is a good quantum number, isobaric analog states and various analogous transitions are expected in isobars with mass number A. The, strengths of T-z = +/-3/2 --> 1/2 analogous Gamow-Teller (GT) transitions and analogous M1 transitions within the A = 41 isobar

  14. The structure of the Gamow-Teller giant resonance and consequences for beta-delayed neutron spectra and element synthesis

    International Nuclear Information System (INIS)

    Klapdor, H.V.

    1976-01-01

    Recent results in β-delayed neutron emission are interpreted by structure of the Gamow-Teller giant resonance not included in the 'gross-theory' of β-decay. Inclusion of this structure of the β-decay function is important for calculations of β-decay production rates for heavy nuclides by astrophysical processes and thermonuclear explosions. (Auth.)

  15. An Inventory-Routing Problem with Pickups and Deliveries Arising in the Replenishment of Automated Teller Machines

    NARCIS (Netherlands)

    van Anholt, Roel G.; Coelho, Leandro C.; Laporte, Gilbert; Vis, Iris F. A.

    The purpose of this paper is to introduce, model, and solve a rich multiperiod inventory-routing problem with pickups and deliveries motivated by the replenishment of automated teller machines in the Netherlands. Commodities can be brought to and from the depot, as well as being exchanged among

  16. An inventory-routing problem with pickups and deliveries arising in the replenishment of automated teller machines

    NARCIS (Netherlands)

    Van Anholt, Roel G.; Coelho, Leandro C.; Laporte, Gilbert; Vis, Iris F.A.

    2016-01-01

    The purpose of this paper is to introduce, model, and solve a rich multiperiod inventory-routing problem with pickups and deliveries motivated by the replenishment of automated teller machines in the Netherlands. Commodities can be brought to and from the depot, as well as being exchanged among

  17. Uncertainty of Deardorff’s soil moisture model based on continuous TDR measurements for sandy loam soil

    Directory of Open Access Journals (Sweden)

    Brandyk Andrzej

    2016-03-01

    Full Text Available Knowledge on soil moisture is indispensable for a range of hydrological models, since it exerts a considerable influence on runoff conditions. Proper tools are nowadays applied in order to gain in-sight into soil moisture status, especially of uppermost soil layers, which are prone to weather changes and land use practices. In order to establish relationships between meteorological conditions and topsoil moisture, a simple model would be required, characterized by low computational effort, simple structure and low number of identified and calibrated parameters. We demonstrated, that existing model for shallow soils, considering mass exchange between two layers (the upper and the lower, as well as with the atmosphere and subsoil, worked well for sandy loam with deep ground water table in Warsaw conurbation. GLUE (Generalized Likelihood Uncertainty Estimation linked with GSA (Global Sensitivity Analysis provided for final determination of parameter values and model confidence ranges. Including the uncertainty in a model structure, caused that the median soil moisture solution of the GLUE was shifted from the one optimal in deterministic sense. From the point of view of practical model application, the main shortcoming were the underestimated water exchange rates between the lower soil layer (ranging from the depth of 0.1 to 0.2 m below ground level and subsoil. General model quality was found to be satisfactory and promising for its utilization for establishing measures to regain retention in urbanized conditions.

  18. Field Performance of Nine Soil Water Content Sensors on a Sandy Loam Soil in New Brunswick, Maritime Region, Canada

    Directory of Open Access Journals (Sweden)

    Lionel Stevens

    2009-11-01

    Full Text Available An in situ field test on nine commonly-used soil water sensors was carried out in a sandy loam soil located in the Potato Research Center, Fredericton, NB (Canada using the gravimetric method as a reference. The results showed that among the tested sensors, regardless of installation depths and soil water regimes, CS615, Trase, and Troxler performed the best with the factory calibrations, with a relative root mean square error (RRMSE of 15.78, 16.93, and 17.65%, and a r2 of 0.75, 0.77, and 0.65, respectively. TRIME, Moisture Point (MP917, and Gopher performed slightly worse with the factory calibrations, with a RRMSE of 45.76, 26.57, and 20.41%, and a r2 of 0.65, 0.72, and 0.78, respectively, while the Gypsum, WaterMark, and Netafim showed a frequent need for calibration in the application in this region.

  19. Empirical Models for Power and Energy Requirements II : A Powered Implement Operation in Serdang Sandy Clay Loam, Malaysia

    Directory of Open Access Journals (Sweden)

    A. F. Kheiralla

    2017-12-01

    Full Text Available Power and energy requirements were measured with an instrumented tractor for rotary tilling in Serdang sandy clay loam soil.  The effects of travel speed and rotor speed upon the measured data were investigated.  Power model from orthogonal regression analysis was formulated based on linear and quadratic functions of travel speed and bite length.  Fuel consumption model from regression analysis was formulated based on linear tractor PTO power as well as linear equivalent tractor PTO power.  Fuel consumption rates predicted by ASAE D497.3 were found to be 25% to 28% overestimates of the values predicted by the model developed.  However, fuel consumption rates reported by OECD Tractor Test were found to be 1% to 9% lower than the fuel consumption rates predicted by the model developed.  A comparison of power and energy requirements for both powered and draught implements showed that the disk harrow was the most energy efficient implement in terms of fuel consumption and specific energy followed by the rotary tiller, disk plough and mouldboard.  Finally, average PTO power, fuel consumption, wheel slip, wheel power and specific energy for a powered implement are presented.

  20. The fate of fresh and stored 15N-labelled sheep urine and urea applied to a sandy and a sandy loam soil using different application strategies

    DEFF Research Database (Denmark)

    Sørensen, P.; Jensen, E.S.

    1996-01-01

    The fate of nitrogen from N-15-labelled sheep urine and urea applied to two soils was studied under field conditions. Labelled and stored urine equivalent to 204 kg N ha(-1) was either incorporated in soil or applied to the soil surface prior to sowing of Italian ryegrass (Lolium multiflorum L...... and soil was not significantly different for incorporated urine and urea. Almost all the supplied labelled N was accounted for in soil and herbage in the sandy loam soil, whereas 33-34% of the labelled N was unaccounted for in the sandy soil. When the stored urine was applied to the soil surface, 20...... was applied to growing ryegrass at the sandy loam soil, the immobilization of urine-derived N was significantly reduced compared to application prior to sowing. The results indicated that the net mineralization of urine N was similar to that of urea in the sandy soil, but only about 75% of the urine N was net...

  1. Crop uptake and leaching losses of 15N labelled fertilizer nitrogen in relation to waterlogging of clay and sandy loam soils

    International Nuclear Information System (INIS)

    Webster, C.P.; Belford, R.K.; Cannell, R.Q.

    1986-01-01

    Ammonium nitrate fertilizer, labelled with 15 N, was applied in spring to winter wheat growing in undisturbed monoliths of clay and sandy loam soil in lysimeters; the rates of application were respectively 95 and 102 kg N ha -1 in the spring of 1976 and 1975. Crops of winter wheat, oilseed rape, peas and barley grown in the following 5 or 6 years were treated with unlabelled nitrogen fertilizer at rates recommended for maximum yields. During each year of the experiments the lysimeters were divided into treatments which were either freely drained or subjected to periods of waterlogging. Another labelled nitrogen application was made in 1980 to a separate group of lysimeters with a clay soil and a winter wheat crop to study further the uptake of nitrogen fertilizer in relation to waterlogging. In the first growing season, shoots of the winter wheater at harvest contained 46 and 58% of the fertilizer nitrogen applied to the clay and sandy loam soils respectively. In the following year the crops contained a further 1-2% of the labelled fertilizer, and after 5 and 6 years the total recoveries of labelled fertilizer in the crops were 49 and 62% on the clay and sandy loam soils respectively. In the first winter after the labelled fertilizer was applied, less than 1% of the fertilizer was lost in the drainage water, and only about 2% of the total nitrogen (mainly nitrate) in the drainage water from both soils was derived from the fertilizer

  2. Impacts of soil conditioners and water table management on phosphorus loss in tile drainage from a clay loam soil.

    Science.gov (United States)

    Zhang, T Q; Tan, C S; Zheng, Z M; Welacky, T W; Reynolds, W D

    2015-03-01

    Adoption of waste-derived soil conditioners and refined water management can improve soil physical quality and crop productivity of fine-textured soils. However, the impacts of these practices on water quality must be assessed to ensure environmental sustainability. We conducted a study to determine phosphorus (P) loss in tile drainage as affected by two types of soil conditioners (yard waste compost and swine manure compost) and water table management (free drainage and controlled drainage with subirrigation) in a clay loam soil under corn-soybean rotation in a 4-yr period from 1999 to 2003. Tile drainage flows were monitored and sampled on a year-round continuous basis using on-site auto-sampling systems. Water samples were analyzed for dissolved reactive P (DRP), particulate P (PP), and total P (TP). Substantially greater concentrations and losses of DRP, PP, and TP occurred with swine manure compost than with control and yard waste compost regardless of water table management. Compared with free drainage, controlled drainage with subirrigation was an effective way to reduce annual and cumulative losses of DRP, PP, and TP in tile drainage through reductions in flow volume and P concentration with control and yard waste compost but not with swine manure compost. Both DRP and TP concentrations in tile drainage were well above the water quality guideline for P, affirming that subsurface loss of P from fine-textured soils can be one critical source for freshwater eutrophication. Swine manure compost applied as a soil conditioner must be optimized by taking water quality impacts into consideration. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  3. Nitrogen Amendment Stimulated Decomposition of Maize Straw-Derived Biochar in a Sandy Loam Soil: A Short-Term Study.

    Directory of Open Access Journals (Sweden)

    Weiwei Lu

    Full Text Available This study examined the effect of nitrogen (N on biochar stability in relation to soil microbial community as well as biochar labile components using δ13C stable isotope technology. A sandy loam soil under a long-term rotation of C3 crops was amended with biochar produced from maize (a C4 plant straw in absence (BC0 and presence (BCN of N and monitored for dynamics of carbon dioxide (CO2 flux, phospholipid fatty acids (PLFAs profile and dissolved organic carbon (DOC content. N amendment significantly increased the decomposition of biochar during the first 5 days of incubation (P < 0.05, and the proportions of decomposed biochar carbon (C were 2.30% and 3.28% in BC0 and BCN treatments, respectively, during 30 days of incubation. The magnitude of decomposed biochar C was significantly (P < 0.05 higher than DOC in biochar (1.75% and part of relatively recalcitrant biochar C was mineralized in both treatments. N amendment increased soil PLFAs concentration at the beginning of incubation, indicating that microorganisms were N-limited in test soil. Furthermore, N amendment significantly (P < 0.05 increased the proportion of gram-positive (G+ bacteria and decreased that of fungi, while no noticeable changes were observed for gram-negative (G- bacteria and actinobacteria at the early stage of incubation. Our results indicated that N amendment promoted more efficiently the proliferation of G+ bacteria and accelerated the decomposition of relatively recalcitrant biochar C, which in turn reduced the stability of maize straw-derived biochar in test soil.

  4. Gamow-Teller transitions and neutron-proton-pair transfer reactions

    Science.gov (United States)

    Van Isacker, P.; Macchiavelli, A. O.

    2018-05-01

    We propose a schematic model of nucleons moving in spin-orbit partner levels, j = l ± 1/2, to explain Gamow-Teller and two-nucleon transfer data in N = Z nuclei above 40Ca. Use of the LS coupling scheme provides a more transparent approach to interpret the structure and reaction data. We apply the model to the analysis of charge-exchange, 42Ca(3He,t)42Sc, and np-transfer, 40Ca(3He,p)42Sc, reactions data to define the elementary modes of excitation in terms of both isovector and isoscalar pairs, whose properties can be determined by adjusting the parameters of the model (spin-orbit splitting, isovector pairing strength and quadrupole matrix element) to the available data. The overall agreement with experiment suggests that the approach captures the main physics ingredients and provides the basis for a boson approximation that can be extended to heavier nuclei. Our analysis also reveals that the SU(4)-symmetry limit is not realized in 42Sc.

  5. Hour-Glass Neural Network Based Daily Money Flow Estimation for Automatic Teller Machines

    Science.gov (United States)

    Karungaru, Stephen; Akashi, Takuya; Nakano, Miyoko; Fukumi, Minoru

    Monetary transactions using Automated Teller Machines (ATMs) have become a normal part of our daily lives. At ATMs, one can withdraw, send or debit money and even update passbooks among many other possible functions. ATMs are turning the banking sector into a ubiquitous service. However, while the advantages for the ATM users (financial institution customers) are many, the financial institution side faces an uphill task in management and maintaining the cash flow in the ATMs. On one hand, too much money in a rarely used ATM is wasteful, while on the other, insufficient amounts would adversely affect the customers and may result in a lost business opportunity for the financial institution. Therefore, in this paper, we propose a daily cash flow estimation system using neural networks that enables better daily forecasting of the money required at the ATMs. The neural network used in this work is a five layered hour glass shaped structure that achieves fast learning, even for the time series data for which seasonality and trend feature extraction is difficult. Feature extraction is carried out using the Akamatsu Integral and Differential transforms. This work achieves an average estimation accuracy of 92.6%.

  6. Cyclopropenyl Anions: Carbon Tunneling or Diradical Formation? A Contest between Jahn-Teller and Hund.

    Science.gov (United States)

    Kozuch, Sebastian

    2015-07-14

    The π bond shifting (automerization) by carbon tunneling of cyclopropenyl anions was computationally analyzed by the small curvature tunneling methodology. Similar to other antiaromatic cases, the process is hindered by substituents departing from planarity, since these groups must be realigned along with the π bond shifting. With hydrogens as substituents the tunneling is extremely fast, in a case of both heavy and light atom tunneling. But, with more massive substituents (such as Me and F), and especially with longer groups (such as CN), the tunneling probability is reduced or even virtually canceled. The automerization of triphenylcyclopropyl anion by tunneling was supposed to be impossible due to the high mass of the phenyl groups. However, it was found that the ground state of this species is actually a D3h aromatic triplet, a single-well system that cannot undergo automerization. For this and other systems with π acceptor groups, the superposition of states that generates the second-order Jahn-Teller distortion is diminished, and by Hund's rule, the triplet results in the ground state.

  7. Nuclear structure properties and stellar weak rates for 76Se: Unblocking of the Gamow Teller strength

    Science.gov (United States)

    Nabi, Jameel-Un; Ishfaq, Mavra; Böyükata, Mahmut; Riaz, Muhammad

    2017-10-01

    At finite temperatures (≥ 107K), 76Se is abundant in the core of massive stars and electron capture on 76Se has a consequential role to play in the dynamics of core-collapse. The present work may be classified into two main categories. In the first phase we study the nuclear structure properties of 76Se using the interacting boson model-1 (IBM-1). The IBM-1 investigations include the energy levels, B (E 2) values and the prediction of the geometry. We performed the extended consistent-Q formalism (ECQF) calculation and later the triaxial formalism calculation (constructed by adding the cubic term to the ECQF). The geometry of 76Se can be envisioned within the formalism of the potential energy surface based on the classical limit of IBM-1 model. In the second phase, we reconfirm the unblocking of the Gamow-Teller (GT) strength in 76Se (a test case for nuclei having N > 40 and Z fashion. Results are compared with experimental data and previous calculations. The calculated GT distribution fulfills the Ikeda sum rule. Rates for β-delayed neutrons and emission probabilities are also calculated. Our study suggests that at high stellar temperatures and low densities, the β+-decay on 76Se should not be neglected and needs to be taken into consideration along with electron capture rates for simulation of presupernova evolution of massive stars.

  8. Beta decay of 97Ag: evidence for the Gamow-Teller resonance near 100Sn

    International Nuclear Information System (INIS)

    Hu Zhiqiang

    1999-03-01

    In two complementary measurements, a cube like array of 6 Euroball-Cluster germanium detectors and a total-absorption γ-spectrometer were used to investigate the β decay of 97 Ag, a three proton-hole nucleus with respect to the 100 Sn core. The half-life and Q EC value of the decay of the 9/2 + ground-state of 97 Ag were determined to be 25.9(4) s and 6.98(11) MeV respectively. A total of 603 γ rays (578 new) was observed, and 151 levels (132 new) in 97 Pd have been identified. An interesting β-delayed γ cascade was observed, which comprises 6 γ-transitions with a de-excitation pattern involving an initial increase of the level spin. The Gamow-Teller (GT) β-decay strength distributions from the two measurements reveal a large GT resonance around 4 MeV with a width of about 1.8 MeV. The hindrance factor for the total GT strength summed from the ground-state up to 6 MeV excitation energy in 97 Pd, amounts to 4.3(6) with reference to a shell-model prediction. This factor is discussed in comparison with a core-polarization and a Monte-Carlo shell-model calculation. (orig.)

  9. Gamow-Teller strength in the continuum studied via the (p,n) reaction

    International Nuclear Information System (INIS)

    Wakasa, T.; Hatanaka, K.; Sakai, H.

    2002-01-01

    The double differential cross sections for θ lab between 0.0deg and 14.7deg and the polarization transfer coefficient D NN (0deg) for the 27 Al (p vector, n vector) reaction have been measured at a bombarding energy of 295 MeV. A multipole decomposition technique is applied for the cross section data to extract L=0, 1, 2, and 3 contributions. The Gamow-Teller (GT) strength B(GT) deduced from the L=0 contribution is compared with the B(GT) values calculated in a full sd shell-model space. The sum of B(GT) values up to 20 MeV excitation is S β- =4.0 ± 0.1 ± 0.1. A fairly large L=0 contribution is observed in the continuum region up to 50 MeV, which could be in part ascribed to the quenched GT strength. A limit on the effect that the Δ(1232)-isobar nucleon-hole admixture has upon the GT strength is estimated. (author)

  10. Double Gamow-Teller Transitions and its Relation to Neutrinoless β β Decay

    Science.gov (United States)

    Shimizu, Noritaka; Menéndez, Javier; Yako, Kentaro

    2018-04-01

    We study the double Gamow-Teller (DGT) strength distribution of 48Ca with state-of-the-art large-scale nuclear shell model calculations. Our analysis shows that the centroid energy of the DGT giant resonance depends mostly on the isovector pairing interaction, while the resonance width is more sensitive to isoscalar pairing. Pairing correlations are also key in neutrinoless β β (0 ν β β ) decay. We find a simple relation between the centroid energy of the 48Ca DGT giant resonance and the 0 ν β β decay nuclear matrix element. More generally, we observe a very good linear correlation between the DGT transition to the ground state of the final nucleus and the 0 ν β β decay matrix element. The correlation, which originates on the dominant short-range character of both transitions, extends to heavier systems including several β β emitters and also holds in energy-density functional results. Our findings suggest that DGT experiments can be a very valuable tool to obtain information on the value of 0 ν β β decay nuclear matrix elements.

  11. Quantum friction of pseudorotation in Jahn-Teller system: Passage through conical intersection

    Energy Technology Data Exchange (ETDEWEB)

    Pae, Kaja, E-mail: kaja.pae@gmail.com; Hizhnyakov, Vladimir [Institute of Physics, University of Tartu, W. Ostwaldi 1, 50411 Tartu (Estonia)

    2016-08-14

    A theoretical study of the relaxation of an excited impurity center with strong E × e-type Jahn-Teller effect, caused by the emission of phonons to the bulk, is presented. The dependence of the passing the system through the conical intersection of the potential surface on the momentum of the pseudorotation is figured out. An analytical description of the quantum states of the conical intersection (Slonczewski resonances) is given. It is found that for realistic vibronic interactions with phonons, the characteristic time of the energy loss is several tenths of mean periods of phonons, i.e., it is in the picosecond range. It is also found that there is a finite probability of the speeding-up of the pseudorotation of the system at the intermediate stage of relaxation. In particular, this probability increases close to the Slonczewski resonances. During the relaxation, the system may change the direction of the pseudomoment; the probability of such a change also increases near the resonances.

  12. Quantifying the effects of higher order coupling terms on fits using a second order Jahn-Teller Hamiltonian

    Science.gov (United States)

    Tran, Henry K.; Stanton, John F.; Miller, Terry A.

    2018-01-01

    The limitations associated with the common practice of fitting a quadratic Hamiltonian to vibronic levels of a Jahn-Teller system have been explored quantitatively. Satisfactory results for the prototypical X∼2E‧ state of Li3 are obtained from fits to both experimental spectral data and to an "artificial" spectrum calculated by a quartic Hamiltonian which accurately reproduces the adiabatic potential obtained from state-of-the-art quantum chemistry calculations. However the values of the Jahn-Teller parameters, stabilization energy, and pseudo-rotation barrier obtained from the quadratic fit differ markedly from those associated with the ab initio potential. Nonetheless the RMS deviations of the fits are not strikingly different. Guidelines are suggested for comparing parameters obtained from fits to experiment to those obtained by direct calculation, but a principal conclusion of this work is that such comparisons must be done with a high degree of caution.

  13. Magnetic Dipole and Gamow-Teller Modes in Neutrino-Nucleus Reactions: Impact on Supernova Dynamics and Nucleosynthesis

    International Nuclear Information System (INIS)

    Neumann-Cosel, P. von; Byelikov, A.; Richter, A.; Shevchenko, A.; Adachi, T.; Fujita, Y.; Shimbara, Y.; Fujita, H.; Heger, A.; Kolbe, E.; Langanke, K.; Martinez-Pinedo, G.

    2006-01-01

    Some aspects of the importance of neutrino-induced reactions on nuclei within supernova physics are discussed. It is argued that important constraints on the experimentally unknown cross sections can be obtained from experimental studies of the nuclear response in selected cases. Examples are neutral-current induced reactions on fp-shell nuclei extracted from high-resolution inelastic electron scattering data providing the M1 strength distributions and the production of the exotic heavy, odd-odd nuclei 138La and 180Ta through charged-current reactions dominated by Gamow-Teller transitions. The Gamow-Teller strength can deduced from the (3He,t) charge-exchange reaction at zero degree

  14. Binding energy and photoionization cross-section of hydrogen-like impurity in a Poschl-Teller quantum well

    International Nuclear Information System (INIS)

    Hakimifard, A.

    2010-01-01

    The effect of the donor impurity position and the form of confining potential on the binding energy and the photoionization cross-section if a semiconductor quantum well with Poschl-Teller potential is investigated. An analytical expression for the photoionization cross-section is obtained for the case when the polarization vector of light wave is directed along the direction of size quantization. It is shown that the photoionization cross-section has a threshold behavior

  15. An Exploratory Study of the Critical Factors Affecting the Acceptability of Automated Teller Machine (ATM) in Nigeria

    OpenAIRE

    Olusegun Folorunso; Oluwafunmilayo Ayobami Ateji; Gabriel Oludare Awe

    2010-01-01

    This paper uses the Technology Acceptance Model (TAM) as a basis for studying critical factors that affects the acceptability of Automated Teller Machine (ATM) in Nigeria. Questionnaire approach was used with the respondents predominantly between 20-29 years old. Factor analysis was used to test which of the factors are the main factors affecting the adoption of the technology in Nigeria. It was discovered that the major factors affecting people’s intention to accept ATM are the security issu...

  16. Microbial functional diversity responses to 2 years since biochar application in silt-loam soils on the Loess Plateau.

    Science.gov (United States)

    Zhu, Li-Xia; Xiao, Qian; Shen, Yu-Fang; Li, Shi-Qing

    2017-10-01

    The structure and function of soil microbial communities have been widely used as indicators of soil quality and fertility. The effect of biochar application on carbon sequestration has been studied, but the effect on soil microbial functional diversity has received little attention. We evaluated effects of biochar application on the functional diversities of microbes in a loam soil. The effects of biochar on microbial activities and related processes in the 0-10 and 10-20cm soil layers were determined in a two-year experiment in maize field on the Loess Plateau in China. Low-pyrolysis biochar produced from maize straw was applied into soils at rates of 0 (BC0), 10 (BC10) and 30 (BC30)tha -1 . Chemical analysis indicated that the biochar did not change the pH, significantly increased the amounts of organic carbon and nitrogen, and decreased the amount of mineral nitrogen and the microbial quotient. The biochar significantly decreased average well colour development (AWCD) values in Biolog EcoPlates™ for both layers, particularly for the rate of 10tha -1 . Biochar addition significantly decreased substrate richness (S) except for BC30 in the 0-10cm layer. Effects of biochar on the Shannon-Wiener index (H) and Simpson's dominance (D) were not significant, except for a significant increase in evenness index (E) in BC10 in the 10-20cm layer. A principal component analysis clearly differentiated the treatments, and microbial use of six categories of substrates significantly decreased in both layers after biochar addition, although the use of amines and amides did not differ amongst the three treatments in the deeper layer. Maize above ground dry biomass and height did not differ significantly amongst the treatments, and biochar had no significant effect on nitrogen uptake by maize seedlings. H was positively correlated with AWCD, and negatively with pH. AWCD was positively correlated with mineral N and negatively with pH. Our results indicated that shifts in soil

  17. Microbial Community Patterns Associated with Automated Teller Machine Keypads in New York City.

    Science.gov (United States)

    Bik, Holly M; Maritz, Julia M; Luong, Albert; Shin, Hakdong; Dominguez-Bello, Maria Gloria; Carlton, Jane M

    2016-01-01

    In densely populated urban environments, the distribution of microbes and the drivers of microbial community assemblages are not well understood. In sprawling metropolitan habitats, the "urban microbiome" may represent a mix of human-associated and environmental taxa. Here we carried out a baseline study of automated teller machine (ATM) keypads in New York City (NYC). Our goal was to describe the biodiversity and biogeography of both prokaryotic and eukaryotic microbes in an urban setting while assessing the potential source of microbial assemblages on ATM keypads. Microbial swab samples were collected from three boroughs (Manhattan, Queens, and Brooklyn) during June and July 2014, followed by generation of Illumina MiSeq datasets for bacterial (16S rRNA) and eukaryotic (18S rRNA) marker genes. Downstream analysis was carried out in the QIIME pipeline, in conjunction with neighborhood metadata (ethnicity, population, age groups) from the NYC Open Data portal. Neither the 16S nor 18S rRNA datasets showed any clustering patterns related to geography or neighborhood demographics. Bacterial assemblages on ATM keypads were dominated by taxonomic groups known to be associated with human skin communities ( Actinobacteria , Bacteroides , Firmicutes , and Proteobacteria ), although SourceTracker analysis was unable to identify the source habitat for the majority of taxa. Eukaryotic assemblages were dominated by fungal taxa as well as by a low-diversity protist community containing both free-living and potentially pathogenic taxa ( Toxoplasma , Trichomonas ). Our results suggest that ATM keypads amalgamate microbial assemblages from different sources, including the human microbiome, eukaryotic food species, and potentially novel extremophilic taxa adapted to air or surfaces in the built environment. DNA obtained from ATM keypads may thus provide a record of both human behavior and environmental sources of microbes. IMPORTANCE Automated teller machine (ATM) keypads represent

  18. Antibiogram of bacteria isolated from automated teller machines in Hamadan, West Iran

    Directory of Open Access Journals (Sweden)

    Mahmoudi, Hassan

    2017-02-01

    Full Text Available Aim: Bacteria are ubiquitous in the environment. In keeping with the continued expansion of urbanization and the growing population, an increasing number of people use automated banking, i.e. automated teller machines (ATMs. The aim of this study was to investigate the bacterial contamination and its antibiotic sensitivity on computer keyboards located at ATMs in Hamadan province, Iran. Method: Out of 360 ATMs at four locations in Hamadan, 96 were randomly selected for this study. The antibiotic susceptibility pattern of all isolates was determined by the agar disk diffusion method using gentamicin (10 µg, vancomycin (30 µg, trimethoprim/sulfamethoxazole (25 µg, amikacin (30 µg, tobramycin (10 µg, cephalotin (30 µg, norfloxacin (5 µg, and ceftizoxim (30 µg disks. Results: Melli and Saderat Banks had the most frequently contaminated ATMS, with 18 (27.7% and 12 (18.5%, respectively. The most frequently isolated bacteria were in 12 (18.5% ATMs, in in 11 (16.9%, in 6 (9.2%, spp. in 8 (12.3%, spp. in 2 (3.1%, in 6 (9.2%, in 3 (4.6%, and spp. in 5 (7.69% cases. All isolated bacteria were susceptible to gentamicin, cephalotin, tobramycin, amikacin, norfloxacin, and vancomycin. The resistance rate to trimethoprim/sulfamole was 50%. Conclusion: All tested ATM keyboards were contaminated with at least one species of bacteria. Based on these findings, it is recommendable to disinfect the hands after entering one’s own apartment, work area or a hospital, in order to hinder the spread of critical pathogens in the personal environment or in the hospital.

  19. Gamow-Teller strength and lepton captures rates on 66-71Ni in stellar matter

    Science.gov (United States)

    Nabi, Jameel-Un; Majid, Muhammad

    Charge-changing transitions play a significant role in stellar weak-decay processes. The fate of the massive stars is decided by these weak-decay rates including lepton (positron and electron) captures rates, which play a consequential role in the dynamics of core collapse. As per previous simulation results, weak interaction rates on nickel (Ni) isotopes have significant influence on the stellar core vis-à-vis controlling the lepton content of stellar matter throughout the silicon shell burning phases of high mass stars up to the presupernova stages. In this paper, we perform a microscopic calculation of Gamow-Teller (GT) charge-changing transitions, in the β-decay and electron capture (EC) directions, for neutron-rich Ni isotopes (66-71Ni). We further compute the associated weak-decay rates for these selected Ni isotopes in stellar environment. The computations are accomplished by employing the deformed proton-neutron quasiparticle random phase approximation (pn-QRPA) model. A recent study showed that the deformed pn-QRPA theory is well suited for the estimation of GT transitions. The astral weak-decay rates are determined over densities in the range of 10-1011g/cm3 and temperatures in the range of 0.01 × 109-30 × 109K. The calculated lepton capture rates are compared with the previous calculation of Pruet and Fuller (PF). The overall comparison demonstrates that, at low stellar densities and high temperatures, our EC rates are bigger by as much as two orders of magnitude. Our results show that, at higher temperatures, the lepton capture rates are the dominant mode for the stellar weak rates and the corresponding lepton emission rates may be neglected.

  20. Antibiogram of bacteria isolated from automated teller machines in Hamadan, West Iran

    Science.gov (United States)

    Mahmoudi, Hassan; Arabestani, Mohammad Reza; Alikhani, Mohammad Yousef; Sedighi, Iraj; Kohan, Hamed Farhadi; Molavi, Mohammad

    2017-01-01

    Aim: Bacteria are ubiquitous in the environment. In keeping with the continued expansion of urbanization and the growing population, an increasing number of people use automated banking, i.e. automated teller machines (ATMs). The aim of this study was to investigate the bacterial contamination and its antibiotic sensitivity on computer keyboards located at ATMs in Hamadan province, Iran. Method: Out of 360 ATMs at four locations in Hamadan, 96 were randomly selected for this study. The antibiotic susceptibility pattern of all isolates was determined by the agar disk diffusion method using gentamicin (10 µg), vancomycin (30 µg), trimethoprim/sulfamethoxazole (25 µg), amikacin (30 µg), tobramycin (10 µg), cephalotin (30 µg), norfloxacin (5 µg), and ceftizoxim (30 µg) disks. Results: Melli and Saderat Banks had the most frequently contaminated ATMS, with 18 (27.7%) and 12 (18.5%), respectively. The most frequently isolated bacteria were Staphylococcus epidermidis in 12 (18.5%) ATMs, Pseudomonas aeruginosa in 12 (18.5%), Bacillus subtilis in 11 (16.9%), Escherichia coli in 6 (9.2%), Klebsiella spp. in 8 (12.3%), Enterobacter spp. in 2 (3.1%), Bacillus cereus in 6 (9.2%), Staphylococcus aureus in 3 (4.6%), and Micrococcaceae spp. in 5 (7.69%) cases. All isolated bacteria were susceptible to gentamicin, cephalotin, tobramycin, amikacin, norfloxacin, and vancomycin. The S. aureus resistance rate to trimethoprim/sulfamethoxazole was 50%. Conclusion: All tested ATM keyboards were contaminated with at least one species of bacteria. Based on these findings, it is recommendable to disinfect the hands after entering one’s own apartment, work area or a hospital, in order to hinder the spread of critical pathogens in the personal environment or in the hospital. PMID:28197394

  1. Weeds of cereal stubble-fields on various soils in the Kielce region. P. 1. Podzolic and brown soils developed from sands and loams

    Directory of Open Access Journals (Sweden)

    Franciszek Pawłowski

    2013-12-01

    Full Text Available Occupying cereal stubble-fields weed flora is the most characteristic of the environmental (especially soil conditions. Because of its developing and accomplishing the reproductive stages there it can threatens cultivated plants. They are considered to complete the seed store in a soil by 393 min per ha. The results presented in the paper concern the species composition, number and constancy (S and indice of coverage (D of the cereal stubble-field weed species on various soils in the Kielce region (the central part of Poland. The report was based upon 885 phytosociological records collected in the 268 stands. The records were carried out after the crop harvest, in the latter part of September, in 1976-1980. Soil were chosen on the base of soil maps. The analyse of soil samples, taken at the investigation process, were done in order to confirm the soil quality. The worked out material was divided into three parts. The first part, including 369 phytosociological records collected in the 112 stands (in 90 localities concerns stubble-field weeds on podzolic and brown soils developed from sands (loose, weakly loamy and loamy and loams (light and medium. It was found that these soils were grown by 108 (loamy sands to 132 (weakly loamy sands weed species. Among them 66 species were common for all of the soils. Species composition was not differentiated by the soil type (brown, podzolic within kind of the. soil (sand or loams. Among soil examined, the brown loams was the most abundant with species of high constancy degree (30 species but brown loose sands and podzolic loamy sands was the poorest one with (16 species.

  2. Changes to soil water content and biomass yield under combined maize and maize-weed vegetation with different fertilization treatments in loam soil

    Directory of Open Access Journals (Sweden)

    Lehoczky Éva

    2016-06-01

    Full Text Available Especially during early developmental stages, competition with weeds can reduce crop growth and have a serious effect on productivity. Here, the effects of interactions between soil water content (SWC, nutrient availability, and competition from weeds on early stage crop growth were investigated, to better understand this problem. Field experiments were conducted in 2013 and 2014 using long-term study plots on loam soil in Hungary. Plots of maize (Zea mays L. and a weed-maize combination were exposed to five fertilization treatments. SWC was observed along the 0–80 cm depth soil profile and harvested aboveground biomass (HAB was measured.

  3. Effect of organic amendments on nitrate leaching mitigation in a sandy loam soil of Shkodra district, Albania

    Directory of Open Access Journals (Sweden)

    Erdona Demiraj

    2018-03-01

    Full Text Available European lacustrine systems are frequently exposed to nitrate (NO3– pollution causing eutrophication processes. An example of these lakes is Shkodra Lake, a large, shallow lake shared by Albania and Montenegro, in the Balkans Peninsula. Shkodra Lake is a natural sink that collects NO3– from agricultural activities, widely diffused in the surrounding area. The additions of wheat straw and biochar have been suggested to increase soil NO3– retention of agricultural lands. To better understand the role of these two organic soil amendments in mitigating NO3– leaching from arable lands, a pot experiment using a representative sandy loam soil of the Skodra Lake basin was performed. More specifically, a greenhouse experiment with Lolium multiflorum L. and Zea mays L., was carried out for three months, to evaluate the concentrations of NO3–-N in leachate and the cumulative leaching losses of NO3–-N, after wheat straw (10 Mg ha–1 and biochar (10 Mg ha–1 soil addition, under the same rate of NPK fertiliser (300 kg ha–1. The effect of the two organic amendments on nitrate retention, was evaluated according to two methods: i Soil NO3–-N leaching with distilled water; and ii Soil NO3–-N extraction with 2M KCl. The leached NO3–-N and the Potentially Leachable NO3–-N (2M KCl extraction were respectively determined. N uptake by plants, as well as the Nitrogen Use Efficiency were also calculated. A retention effect on nitrate was found in Lolium multiflorum L. and wheat straw treatments compared to control, by reducing leached NO3–-N almost to 35%. In SBFL (soil+biochar+fertiliser+Lolium treatment, biochar effectively reduced the total amount of nitrate in leachate of 27% and 26% compared to SFL (soil+fertiliser+Lolium and SSFL (soil+straw+fertiliser+Lolium treatments, respectively. The potentially leachable NO3–-N was two to four times higher than the leached NO3–-N. The amount of potentially leachable NO3–-N per hectare ranged

  4. Gamow-Teller strength functions from (→p,→p') scattering experiments

    International Nuclear Information System (INIS)

    Hausser, O.

    1987-01-01

    We present here recent (→p, →'p) results from TRIUMF that are relevant to the determination of spin-flip isovector strength functions in nuclei. Distortion factors needed for the extraction of nuclear-structure information have been deduced from cross sections and analyzing powers in elastic scattering for several energies and targets. Nonrelativistic optical potentials obtained by folding effective nucleon (N)-nucleus interactions with nuclear densities are found to overpredict both elastic and reaction cross sections, whereas Dirac calculations that include Pauli blocking are in good agreement with the data. Spin observables (S nn and A y ) for the quasi-elastic region in 54 Fe(→p, →p) at 290 MeV provide some evidence for the reduction of the effective proton mass predicted in relativistic mean-field theories as a consequence of the attractive scalar field in the nuclear medium. The energy dependence of the effective N-nucleus interaction at small momentum transfers has been investigated using isoscalar and isovector 1 + states in 28 Si as probe states. We find that the cross sections for the isovector transitions are in good agreement with predictions for the dominant Vστ part of the Franey-Love interaction. Gamow-Teller (GT) strength functions have been obtained in 24 Mg and 54 Fe from measurements of both cross sections and spin-flip probabilities S nn . The spin-flip cross sections σS nn are particularly useful in heavier nuclei to discriminate against a continuous background of ΔS = 0 excitations. In the (s, d) shell where full shell-model wave functions are available, the GT quenching factors (g A eff / g A free ) 2 ≅ 0.7 are in good agreement with those from recent (p, n) and (n, p) experiments. We show that a state-by-state comparison of (p, p') and (e, e') results has the potential of identifying pionic current contributions in (e, e'). The GT quenching factors in 54 Fe are smaller than in the (s, d) shell probably because of severely

  5. Gamow-Teller strength in deformed nuclei within self-consistent pnQRPA with the Gogny force

    Directory of Open Access Journals (Sweden)

    Martini M.

    2014-03-01

    Full Text Available In recent years fully consistent quasiparticle random-phase approximation (QRPA calculations using finite range Gogny force have been performed to study electromagnetic excitations of several axially-symmetric deformed nuclei up to the 238U. Here we present the extension of this approach to the charge-exchange nuclear excitations (pn-QRPA. In particular we focus on the Gamow-Teller (GT excitations. A comparison of the predicted GT strength distribution with existing experimental data is presented The role of nuclear deformation is shown. Special attention is paid to β-decay half-lives calculations for which experimental data exist.

  6. Influence of electric field, hydrostatic pressure and temperature on the electric state in a Poschl-Teller quantum well

    International Nuclear Information System (INIS)

    Hakimyfard, A.; Barseghyan, M.G.; Kirakosyan, A.A.; Duque, C.A.

    2010-01-01

    Influence of the electric field and hydrostatic pressure on the electronic states in a Poschl-Teller quantum well is studied. In the framework of variational method the dependences of the ground state energy on the electric field and hydrostatic pressure are calculated for different values of the potential parameters and the temperature. It is shown that the increase in the electric field leads to the increase in the ground state energy, while the increase in the well width leads to the strengthening of the electric field effect. The ground state energy decreases with increasing pressure and increases with increasing temperature

  7. Gamow-Teller strength distribution in the beta-decay of 100Ag from total-absorption gamma spectrometry

    International Nuclear Information System (INIS)

    Batist, L.; Bykov, A.; Moroz, F.; Wittmann, V.; Alkhazov, G.D.; Keller, H.; Kirchner, R.; Klepper, O.; Roeckl, E.; Huyse, M.; Duppen, P. van; Reusen, G.; Plochocki, A.; Pfuetzner, M.; Rykaczewski, K.; Szerypo, J.; Zylicz, J.; Brown, B.A.

    1994-10-01

    The EC/β + -decay of the odd-odd nucleus 100 Ag was studied by means of total absorption γ-ray spectrometry. Most of the Gamow-Teller strength was found to be concentrated at an excitation energy of 5.6 MeV in 100 Pd, the FWHM of this resonance being 1.5 MeV. The measured strength distribution which is interpreted within the BCS approximation as being due to the dominant population of four-quasiparticle excitations, resembles the distribution predicted by an advanced shell-model calculation for the 98 Ag→ 98 Cd decay. (orig.)

  8. An Exploratory Study of the Critical Factors Affecting the Acceptability of Automated Teller Machine (ATM in Nigeria

    Directory of Open Access Journals (Sweden)

    Olusegun Folorunso

    2010-01-01

    Full Text Available This paper uses the Technology Acceptance Model (TAM as a basis for studying critical factors that affects the acceptability of Automated Teller Machine (ATM in Nigeria. Questionnaire approach was used with the respondents predominantly between 20-29 years old. Factor analysis was used to test which of the factors are the main factors affecting the adoption of the technology in Nigeria. It was discovered that the major factors affecting people’s intention to accept ATM are the security issues and poor internet connectivity.

  9. Direct probe of the bent and linear geometries of the core-excited Renner-Teller pair states by means of the triple-ion-coincidence momentum imaging technique

    International Nuclear Information System (INIS)

    Muramatsu, Y.; Ueda, K.; Chiba, H.; Saito, N.; Lavollee, M.; Czasch, A.; Weber, T.; Jagutzki, O.; Schmidt-Boecking, H.; Moshammer, R.; Becker, U.; Kubozuka, K.; Koyano, I.

    2002-01-01

    The doubly degenerate core-excited Π state of CO 2 splits into two due to static Renner-Teller effect. Using the triple-ion-coincidence momentum imaging technique and focusing on the dependence of the measured quantities on the polarization of the incident light, we have probed, directly and separately, the linear and bent geometries for the B 1 and A 1 Renner-Teller pair states, as a direct proof of the static Renner-Teller effect

  10. Gamow-Teller strength functions from N-nucleus scattering experiments at 200-400 MeV

    International Nuclear Information System (INIS)

    Haeusser, O.; British Columbia Univ., Vancouver; Vetterli, M.C.

    1988-01-01

    Recent measurements of (n,p), (p vector, p vector') and (p,n) reactions at TRIUMF have made possible a detailed examination of the spin-isospin structure of nuclear excitations up to 50 MeV. Cross sections for 54 Fe(n,p) 54 Mn and spin-flip cross sections for 54 Fe (p vector, p vector') near 300 MeV have been used to estimate the nuclear response for different multipoles L, spin transfers (ΔS = 0,1), and isospins of the residual nucleus (T f = 1,2). Qualitative features of the spin-flip probabilities in (p vector, p vector') are in good agreement with recent surface-RPA calculations. Between 200 and 400 MeV the ΔL=0 spin-flip isovector component is well described by the central part V στ of the Franey-Love interaction. The Gamow-Teller strength S + in 54 Fe, which is of significance in models of pre-collapse supernovae, is found to be smaller by a factor of two than the best available shell model calculations. In (sd)-shell nuclei ( 24,26 Mg, 28 Si) about (70±15)% of the Gamow-Teller strength predicted by untruncated shell-model calculations is found at low excitation. (orig.)

  11. Influence of static Jahn-Teller distortion on the magnetic excitation spectrum of PrO2: A synchrotron x-ray and neutron inelastic scattering study

    International Nuclear Information System (INIS)

    Webster, C. H.; Helme, L. M.; Boothroyd, A. T.; McMorrow, D. F.; Wilkins, S. B.; Detlefs, C.; Detlefs, B.; Bewley, R. I.; McKelvy, M. J.

    2007-01-01

    A synchrotron x-ray diffraction study of the crystallographic structure of PrO 2 in the Jahn-Teller distorted phase is reported. The distortion of the oxygen sublattice, which was previously ambiguous, is shown to be a chiral structure in which neighboring oxygen chains have opposite chiralities. A temperature dependent study of the magnetic excitation spectrum, probed by neutron inelastic scattering, is also reported. Changes in the energies and relative intensities of the crystal field transitions provide an insight into the interplay between the static and dynamic Jahn-Teller effects

  12. USE OF THE “ROTHC” MODEL TO SIMULATE SOIL ORGANIC CARBON DYNAMICS ON A SILTY-LOAM INCEPTISOL IN NORTHERN ITALY UNDER DIFFERENT FERTILIZATION PRACTICES

    Directory of Open Access Journals (Sweden)

    Rosa Francaviglia

    2014-01-01

    Full Text Available We evaluated the efficiency of the RothC model to simulate Soil Organic Carbon (SOC dynamics after 12 years of organic and mineral fertilization practices in a study area located in northern Italy, on a silty-loam Inceptisol with a rotation including tomato, maize and alfalfa. The model performance was assessed by RMSE and EF coefficients. RothC simulated well observed SOC decreases in 71 samples (RMSE=7.42; EF=0.79, while performed with less accuracy when considering all samples (96 samples; RMSE=12.37; EF=0.58, due to the fact that the model failed in case of measured SOC increases (25 samples; RMSE=20.77; EF=-0.038. The model was used to forecast the SOC dynamics over a 50 year period under the same pedoclimatic conditions. Only clay contents >15% allowed to predict increasing levels of SOC respect to the starting values.

  13. Influence of N,K and CaSO4 on utilisation of sulfur by rice in red sandy loam soil

    International Nuclear Information System (INIS)

    Patnaik, M.C.; Sathe, Arun

    1993-01-01

    A greenhouse study with rice on red sandy loam soil showed that uptake of sulphur increased from both native as well as applied source with increase in the application of sulphur from 20-60 kg S ha -1 through gypsum. The grain yields were influenced by nitrogen application but there was only relative increase with the application of potassium and sulphur. There was positive effect of applied nitrogen and sulphur for the total sulphur removal by the rice crop. The per cent sulphur utilisation decreased with increase in sulphur application from 20-60 kg S ha -1 through gypsum but increased with increase in the application of nitrogen from 0-150 kg N ha -1 . Sulphur utilization by rice crop was more in potassium treated pots compared to that without its application. (author). 7 refs., 3 tabs

  14. Jahn-Teller effect in vanadium, niobium and tantalum tetrafluoride molecules: ab initio study by the CASSCF method

    International Nuclear Information System (INIS)

    Solomonik, V.G.; Pogrebnaya, T.P.

    2001-01-01

    The basic and the first exciting electronic state of the VF 4 , NbF 4 and TaF 4 molecules were studied by the self-consistent field multifunctional method in the approximation of active orbitals full space. The symmetry of these states is defined as 2 E and 2 T 2 at tetrahedron configuration of the nuclei. The energies of electron excitation 2 E → 2 T 2 comprise 11610 (VF 4 ), 13450 (NbF 4 ) and 12560 cm -1 (TaF 4 ). In line to Jahn-Teller theorem the calculations evidenced instability of tetrahedron configuration of the molecules in the orbital-singular electronic states 2 E and 2 T 2 . The properties of the systems of the molecule potential energies were found, in keeping with deformation of tetrahedron configuration of the nuclei along the oscillation coordinates of the e symmetry, active in the Jahn-Teller effect. Equilibrium geometric configuration of the molecules with the lowest energy has a symmetry D 2d as in the basic ( 2 A 1 ), so in the first excited electronic state. The energy of the adiabatic electronic excitation 2 A 1 → 2 B 2 is equal to 8440 (VF 4 ), 9050 (NbF 4 ) and 11920 cm -1 (TaF 4 ). Deviations of molecules equilibrium geometry on the structure of the normal tetrahedron and the energy of Jahn-Teller stabilization E JT grow essentially in the series of the molecules VF 4 → NbF 4 → TaF 4 : E JT =E(T d , 2 E)Epy - E(D 2d , 2 A 1 )=412, 1856, 5970 cm -1 ; E JT =E(T d , 2 T 2 ) - E(D 2d , 2 B 2 )=3584, 6259, 6611 cm -1 . The quadratic force constants, the frequencies of normal oscillations and the intensities in the IR spectra of the VF 4 , NbF 4 and TaF 4 molecules in the basic state were calculated [ru

  15. Observation of Fermi and Gamow-Teller strength in the 800 MeV(p,n) reaction

    Energy Technology Data Exchange (ETDEWEB)

    King, N S.P.; Lisowski, P W; Morgan, G L; Craig, P N; Jeppesen, R G; Lind, D A; Shepard, J R; Ullmann, J L; Zafiratos, C D; Goodman, C D

    1986-08-07

    Angular distributions have been measured for the (p,n) reaction on targets of /sup 6/Li, /sup 12/C, /sup 13/C, and /sup 15/N at 800 MeV with an energy resolution of 2.7 MeV allowing observation of discrete nuclear levels. As is the case at lower energies, this reaction is very selective, emphasizing Gamow-Teller (GT) and Fermi transitions. Absolute cross sections of pure GT transitions are reproduced by impulse approximation calculations. The ratio vertical strokeJsub(sigmatau)vertical stroke/sup 2//vertical strokeJsub(tau)vertical stroke/sup 2/ was extracted from /sup 13/C and /sup 15/N measurements at 800 MeV and from a /sup 13/C measurement at 318 MeV.

  16. Reduction of the Jahn-Teller distortion at the insulator-to-metal transition in mixed valence manganites

    International Nuclear Information System (INIS)

    Garcia-Munoz, J.L.; Suaaidi, M.; Fontcuberta, J.; Rodriguez-Carvajal, J.

    1997-01-01

    The insulator-to-metal transition in the manganite La 0.52 Y 0.15 Ca 0.33 MnO 3 (T IM ∼115 K) has been studied by high-resolution neutron powder diffraction. The cell volume contraction at the Curie point is accompanied by a remarkable decrease of the Jahn-Teller distortion in MnO 6 octahedra. The change of the Mn-O bond lengths at T IM is anisotropic and brings about a drop out of the basal-plane collective distortion mode Q 2 , proposed to be the deformation responsible for the band split of e g↑ orbitals. This is consistent with the double-exchange picture, and precludes simple ferromagnetic exchange. copyright 1997 The American Physical Society

  17. Jahn-Teller distortion in the phosphorescent excited state of three-coordinate Au(I) phosphine complexes.

    Science.gov (United States)

    Barakat, Khaldoon A; Cundari, Thomas R; Omary, Mohammad A

    2003-11-26

    DFT calculations were used to optimize the phosphorescent excited state of three-coordinate [Au(PR3)3]+ complexes. The results indicate that the complexes rearrange from their singlet ground-state trigonal planar geometry to a T-shape in the lowest triplet luminescent excited state. The optimized structure of the exciton contradicts the structure predicted based on the AuP bonding properties of the ground-state HOMO and LUMO. The rearrangement to T-shape is a Jahn-Teller distortion because an electron is taken from the degenerate e' (5dxy, 5dx2-y2) orbital upon photoexcitation of the ground-state D3h complex. The calculated UV absorption and visible emission energies are consistent with the experimental data and explain the large Stokes' shifts while such correlations are not possible in optimized models that constrained the exciton to the ground-state trigonal geometry.

  18. The position–momentum uncertainty relations for a Pöschl–Teller type potential and its squeezed phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Chang-Yuan, E-mail: yctcccy@163.net [School of Physics and Electronics, Yancheng Teachers University, Yancheng 224051 (China); You, Yuan; Lu, Fa-Lin [School of Physics and Electronics, Yancheng Teachers University, Yancheng 224051 (China); Dong, Shi-Hai, E-mail: dongsh2@yahoo.com [Departamento de Física, Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Edificio 9, Unidad Profesional Adolfo López Mateos, Mexico D.F. 07738 (Mexico)

    2013-06-17

    We present the position–momentum uncertainties for the Pöschl–Teller potential. We observe that the Δx decreases with the potential depth λ but increases with quantum number n. Interestingly, we find that the Δp first increases and then decreases with the n. The ΔxΔp first decreases and then increases with the λ, but almost becomes a constant (n+1/2)ℏ for a larger λ. Particularly, there exists a squeezed phenomenon in position x for the lower states. The squeezing in x compensated for by an increase in momentum p, such that ΔxΔp⩾ℏ/2 is still satisfied.

  19. The position–momentum uncertainty relations for a Pöschl–Teller type potential and its squeezed phenomena

    International Nuclear Information System (INIS)

    Chen, Chang-Yuan; You, Yuan; Lu, Fa-Lin; Dong, Shi-Hai

    2013-01-01

    We present the position–momentum uncertainties for the Pöschl–Teller potential. We observe that the Δx decreases with the potential depth λ but increases with quantum number n. Interestingly, we find that the Δp first increases and then decreases with the n. The ΔxΔp first decreases and then increases with the λ, but almost becomes a constant (n+1/2)ℏ for a larger λ. Particularly, there exists a squeezed phenomenon in position x for the lower states. The squeezing in x compensated for by an increase in momentum p, such that ΔxΔp⩾ℏ/2 is still satisfied.

  20. Breaking of the SU(4) limit for the Gamow-Teller strength in N{proportional_to}Z nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Petermann, I. [Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Gesellschaft fuer Schwerionenforschung Darmstadt, Darmstadt (Germany); Martinez-Pinedo, G. [Gesellschaft fuer Schwerionenforschung Darmstadt, Darmstadt (Germany); Langanke, K. [Gesellschaft fuer Schwerionenforschung Darmstadt, Darmstadt (Germany); Technische Universitaet Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Caurier, E. [Universite Louis Pasteur, Institut de Recherches Subatomiques, Strasbourg (France)

    2007-12-15

    We have performed large-scale shell model calculations of the Gamow-Teller strength distributions in N{proportional_to}Z pf-shell nuclei. These calculations were motivated by the experimental attempts to measure the low-lying GT strength for the even-even N=Z+2 or N=Z-2 nuclei {sup 46}Ti, {sup 50}Cr, {sup 54}Fe and {sup 62}Ge, where a sizable low-energy GT strength could be interpreted as reminiscence of SU(4) symmetry; in the limit of exact SU(4) symmetry the GT{sub -} strength would be concentrated in a single transition to the lowest T=0, J=1{sup +} state in the daughter. We confirm that the SU(4) symmetry is strongly broken by the spin-orbit interaction and by increasing neutron excess. (orig.)

  1. The influence of band Jahn-Teller effect and magnetic order on the magneto-resistance in manganite systems

    Energy Technology Data Exchange (ETDEWEB)

    Rout, G.C., E-mail: gcr@iopb.res.i [Condensed Matter Physics Group, Department of Applied Physics and Ballistics, F.M. University, Balasore, Orissa 756019 (India); Parhi, Nilima [Department of Physics, M.P.C. (Autonomous) College, Baripada, Orissa 757001 (India); Behera, S.N. [Institute of Material Science, Bhubaneswar 751004 (India)

    2009-08-01

    A model calculation is presented in order to study the magneto-resistivity through the interplay between magnetic and structural transitions for the manganite systems. The model consists of an orbitally doubly degenerate conduction band and a periodic array of local moments of the t{sub 2g} electrons. The band electrons interact with the local t{sub 2g} electrons via the s-f hybridization. The phonons interact with the band electrons through static and dynamic band Jahn-Teller (J-T) interaction. The model Hamiltonian including the above terms is solved for the single particle Green's functions and the imaginary part of the self-energy gives the electron relaxation time. Thus the magneto-resistivity (MR) is calculated from the Drude formula. The MR effect is explained near the magnetic and structural transition temperatures.

  2. A study of cooperative Jahn-Teller phase transitions in rare-earth vanadates by linear birefringence

    International Nuclear Information System (INIS)

    Gehring, G.A.; Harley, R.T.; Macfarlane, R.M.

    1980-01-01

    Changes in linear birefringence (Δn) associated with the cooperative Jahn-Teller phase transition of DyV04 near 14K as as a function of temperature and magnetic fields, B, between 0.024 and 0.095T have been measured. Theoretical arguments show that Δn is directly proportional to the order parameter of the transition and that B(2) is equivalent to the conjugate ordering field. By extrapolation to zero field the temperature dependence of the order parameter and the susceptibility were obtained. The data are compared with calculations based on a mean-field 'compressible' Ising model. For a reasonable choice of adjustable parameters this classical description gives a good fit to the data close to Tsub(D) consistent with general theoretical arguments and more detailed calculations, but it deviates progressively away from Tsub(D) presumably because of the known importance of short-range interactions in the system. (author)

  3. Synthetic, structural, spectroscopic and theoretical study of a Mn(III)-Cu(II) dimer containing a Jahn-Teller compressed Mn ion

    DEFF Research Database (Denmark)

    Berg, Nelly; Hooper, Thomas N.; Liu, Junjie

    2013-01-01

    The heterobimetallic complex [Cu(II)Mn(III)(L)(2)(py)(4)](ClO(4))·EtOH (1) built using the pro-ligand 2,2'-biphenol (LH(2)), contains a rare example of a Jahn-Teller compressed Mn(III) centre. Dc magnetic susceptibility measurements on 1 reveal a strong antiferromagnetic exchange between the Cu...

  4. PERSAMAAN SCHRODINGER D-DIMENSI BAGIAN SUDUT POTENSIAL POSCHL-TELLER HIPERBOLIK TERDEFORMASI Q PLUS ROSEN-MORSE TRIGONOMETRI MENGGUNAKAN METODE NIKIFOROV-UVAROV

    Directory of Open Access Journals (Sweden)

    S. Suparmi

    2016-11-01

    Full Text Available Metode Nikivarof Uvarov merupakan metode penyelesaian persamaan diferensial orde dua dengan mengubah persamaan diferensial orde dua yang umum (persamaan Schrodinger menjadi persamaan diferensial tipe hipergeometrik melalui substitusi variabel yang sesuai untuk memperoleh eigen value dan fungsi gelombang bagian sudut. Penelitian ini merupakan studi literatur untuk menyelesaikan persamaan Schrodinger D-dimensi bagian sudut dengan potensial Poschl-Teller Hiperbolik Terdeformasi q plus Rosen Morse Trigonometri Terdeformasi q menggunakan metode Nikiforov-Uvarov (NU. Pada penelitian ini bertujuan untuk mengetahui bagaimana fungsi gelombang bagian sudut persamaan schrodinger D-dimensi  untuk potensial Poschl-Teller Hiperbolik Terdeformasi q plus Rosen Morse Trigonometri Terdeformasi q menggunakan metode Nikiforov-Uvarov (NU.Nikivarof Uvarov is a method to solve second order differential equations by changing general second order differential equation to hyper-geometric differential equation type through substituting relevant variable to obtain eigenvalues and the angle of wave function. This is a literature study to solve the D-dimensional Schrodinger equation with a corner section q Deformed Hyperbolic Poschl Teller plus q Deformed Trigonometric Rosen-Morse Potential using Nikiforov-Uvarov (NU. This study aims to determine the way the angle of wave function of D-dimensional Schrodinger equation for q-Deformed Hyperbolic Poschl Teller plus q Deformed  Trigonometric Rosen-Morse Potential using Nikiforov-Uvarov (NU. 

  5. Gamow-Teller decay and nuclear deformation: implementing of a new total absorption spectrometer, study of isotopes N ≅ Z krypton and strontium

    International Nuclear Information System (INIS)

    Poirier, E.

    2002-12-01

    Nuclei with A ∼ 70 along the N=Z line are known to be the scene of phenomena closely related to the nuclear deformation and are of particular interest since theoretical mean field calculations predict that a large part of the Gamow-Teller resonance might be located below the ground state of the mother nucleus and then be accessible through β-decay studies. These results have shown the effect of the shape of the ground state on the intensity of the Gamow-Teller strength. Thus, the experimental determination, through δ-decay, of the Gamow-Teller strength distribution and the comparison to the theoretical predictions allow to pin down the quadrupolar deformation parameter of the ground state of the parent nucleus. In order to study the neutron deficient isotopes of krypton (A=72,73,74,75) and strontium (A=76,77,78) and to establish the β-strength on the full energy range, a new total absorption spectrometer (TAgS) has been built in the frame of an international collaboration and installed at the (SOLDE/CERN mass separator. For the data analysis, the response function R of the spectrometer has been calculated by means of Monte-Carlo simulations, based on the GEANT4 code, and of a statistical description of the level scheme in the daughter nucleus. The β-feeding distribution has been obtained from experimental spectra through a method based on Bayes theorem and then converted into Gamow-Teller strength. The results coming from the 74 Kr decay analysis allow to describe the ground state of such a nucleus as the coexistence of an oblate shape and of a prolate shape. In the case of 76 Sr, the experimental Gamow-Teller strength distribution strongly indicates a prolate deformation. (author)

  6. The impacts of pyrolysis temperature and feedstock type on biochar properties and the effects of biochar application on the properties of a sandy loam

    Science.gov (United States)

    Aston, Steve; Doerr, Stefan; Street-Perrott, Alayne

    2013-04-01

    The production of biochar and its application to soil has the potential to make a significant contribution to climate change mitigation whilst simultaneously improving soil fertility, crop yield and soil water-holding capacity. Biochar is produced from various biomass feedstock materials at varying pyrolysis temperatures, but relatively little is known about how these parameters affect the properties of the resultant biochars and their impact on the properties of the soils to which they are subsequently applied. Salix viminalis, M. giganteus and Picea sitchensis feedstocks were chipped then sieved to 2 - 5 mm, oven dried to constant weight, then pyrolyzed at 350, 500, 600 and 800° C in a nitrogen-purged tube furnace. Biochar yields were measured by weighing the mass of each sample before and after pyrolysis. Biochar hydrophobicity was assessed by using a goniometer to measure water-droplet contact-angles. Cation-exchange-capacity (CEC) was measured using the ammonium acetate method. Biochars were also produced in a rotary kiln from softwood pellets at 400, 500, 600 and 700° C then ground to 0.4 - 1 mm and applied to a sandy loam at a rate of 50 g kg-1. Bulk densities of these soil-biochar mixtures were measured on a tapped, dry, basis. The water-holding-capacity (WHC) of each mixture was measured gravimetrically following saturation and free-draining. The filter paper method was used to assess how pyrolysis temperature influences the effect of biochar application on matric suction. For all feedstocks, large decreases in biochar yield were observed between the pyrolysis temperatures of 350° C and 500° C. For Salix viminalis and M. giganteus feedstocks, subsequent reductions in the yield with increasing pyrolysis temperature were much lower. There were significant differences in hydrophobicity between biochars produced from different biomass and mean biochar hydrophobicity decreased with increasing pyrolysis temperature for all feedstocks. Results for CEC and WHC

  7. Jahn-Teller and Non-Jahn-Teller Systems Involving CuF64- Units: Role of the Internal Electric Field in Ba2ZnF6:Cu2+ and Other Insulating Systems

    DEFF Research Database (Denmark)

    Aramburu, J. A.; Garcia-Fernandez, P.; García Lastra, Juan Maria

    2017-01-01

    The applicability of the Jahn-Teller (JT) framework to 6-fold coordinated d9 ions whose local symmetry is not strictly octahedral is explored by means of first principle calculations. Our results contradict much of the existing literature where these systems are analyzed within the quasi-JT regime...... transitions for CuF64- units formed in Cu2+-doped the tetragonal Ba2ZnF6 host lattice. While the experimental d-d transitions cannot be reproduced through the isolated CuF64- unit at the equilibrium geometry, a reasonable agreement is reached adding in the calculation the internal electric field, ER...... state with the hole in the a1g(∼ 3z2-r2) level while it is always placed in the b1g(∼ x2-y2) level for MX6 complexes (M = Cu2+, Ag2+, NiΤ; X = F--, Cl-) in cubic lattices displaying a static JT effect. While the experimental results of CuF64- in Ba2ZnF6 cannot be understood within the JT framework...

  8. Contribution of Jahn-Teller and charge transfer excitations to the photovoltaic effect of manganite/titanite heterojunctions

    Science.gov (United States)

    Ifland, Benedikt; Hoffmann, Joerg; Kressdorf, Birte; Roddatis, Vladimir; Seibt, Michael; Jooss, Christian

    2017-06-01

    The effect of correlation effects on photovoltaic energy conversion at manganite/titanite heterojunctions is investigated. As a model system we choose a heterostructure consisting of the small polaron absorber Pr0.66Ca0.34MnO3 (PCMO) epitaxially grown on single-crystalline Nb-doped SrTi0.998Nb0.002O3 (STNO) substrates. The high structural and chemical quality of the interfaces is proved by detailed characterization using high-resolution transmission electron microscopy (TEM) and electron energy loss spectroscopy (EELS) studies. Spectrally resolved and temperature-dependent photovoltaic measurements show pronounced contributions of both the Jahn-Teller (JT) excitations and the charge transfer (CT) transitions to the photovoltaic effect at different photon energies. A linear temperature dependence of the open-circuit voltage for an excitation in the PCMO manganite is only observed below the charge-ordering temperature, indicating that the diffusion length of the photocarrier exceeds the size of the space charge region. The photovoltaic response is compared to that of a heterojunction of lightly doped Pr0.05Ca0.95MnO3 (CMO)/STNO, where the JT transition is absent. Here, significant contributions of the CT transition to the photovoltaic effect set in below the Neel temperature. We conclude that polaronic correlations and ordering effects are essentials for photovoltaic energy conversion in manganites.

  9. Modulation of Jahn-Teller effect on magnetization and spontaneous electric polarization of CuFeO2

    Science.gov (United States)

    Xiao, Guiling; Xia, Zhengcai; Wei, Meng; Huang, Sha; Shi, Liran; Zhang, Xiaoxing; Wu, Huan; Yang, Feng; Song, Yujie; Ouyang, Zhongwen

    2018-03-01

    CuFe0.99Mn0.01O2 and CuFe0.99Co0.01O2 single crystal samples are grown by a floating zone technique and their magnetization and spontaneous electric polarization have been investigated. Similarly with pure CuFeO2, an obviously anisotropic magnetization and spontaneous electric polarization were observed in the both doped samples, and their phase transition critical fields and temperatures are directly doping ion dependent. Considering the different d-shell configuration and ionic size between Mn3+, Co3+ and Fe3+ ions, in which the Mn3+ ion with Jahn-Teller (J-T) effect has different distortion on the geometry frustration from both of Fe3+ and Co3+ ion. Since for Mn3+ ion, the orbital splitting results from the low-symmetry J-T distortion in a crystal-field environment leads to a distorted MnO6 octahedron, which different from undistorted FeO6 and CoO6 octahedrons. The strain between distorted and undistorted octahedrons produces different effects on the spin reorientation transition and spontaneous electric polarization. Although the pure CuFeO2 has a very strong and robust frustration, the presence of the strain due to the random distribution of distorted MnO6 octahedron and undistorted CoO6 (FeO6) octahedrons leads to its spin reorientation transitions and spontaneous electric polarization different from CuFeO2.

  10. Gamow-Teller transitions and proton-neutron pair correlation in N =Z odd-odd p -shell nuclei

    Science.gov (United States)

    Morita, Hiroyuki; Kanada-En'yo, Yoshiko

    2017-10-01

    We have studied the Gamow-Teller (GT) transitions from N =Z +2 neighbors to N =Z odd-odd nuclei in the p -shell region by using isospin-projected and β γ -constraint antisymmetrized molecular dynamics combined with the generator coordinate method. The calculated GT transition strengths from 0+1 states to 1+0 states such as 6He(01+1 ) →6Li(11+0 ) , 10Be(01+1 ) →10B(11+0 ) , and 14C(01+1 ) →14N(12+0 ) exhaust more than 50% of the sum rule. These N =Z +2 initial states and N =Z odd-odd final states are found to dominantly have S =0 ,T =1 n n pairs and S =1 ,T =0 p n pairs, respectively. Based on the two-nucleon (N N ) pair picture, we can understand the concentration of the GT strengths as the spin-isospin-flip transition n n (S =0 ,T =1 )→p n (S =1 ,T =0 ) in L S coupling. The GT transition can be a good probe to identify the spin-isospin partner states with n n pairs and p n pairs of N =Z +2 and N =Z odd-odd nuclei, respectively.

  11. A framework for evaluating the performance of automated teller machine in banking industries: A queuing model-cum-TOPSIS approach

    Directory of Open Access Journals (Sweden)

    Christopher Osita Anyaeche

    2018-04-01

    Full Text Available The improvement in the provision of banking services to customers enhances bank’s performance (profitability and productivity and the amounts of dividend declared to shareholders as well as bank’s competitiveness. One means of fast tracking the service time for bank customers is through the use of self-servicing machines, such as automated teller machine (ATM. Total service cost, expected waiting time in queue, ATM utilization and percentage of customer loss are some of the performance indices that are used to evaluate the service rendered by a bank’s ATM. This study proposes a framework for evaluating the performance of ATM by integrating queuing model and Technique for Order of Preference by Similarity to Ideal Solution (TOPSIS methodology. Applicability of the framework was tested using practical data obtained from four banks in Nigeria. It was observed that the average ATM usage in the study area was less than 50%. The TOPSIS results identified Bank A as the best ranked bank. In addition, the results obtained revealed that banks with two ATM were ranked higher than banks with more than two ATM

  12. Electronic Correlations, Jahn-Teller Distortions and Mott Transition to Superconductivity in Alkali-C60 Compounds

    Directory of Open Access Journals (Sweden)

    Alloul H.

    2012-03-01

    Full Text Available The discovery in 1991 of high temperature superconductivity (SC in A3C60 compounds, where A is an alkali ion, has been rapidly ascribed to a BCS mechanism, in which the pairing is mediated by on ball optical phonon modes. While this has lead to consider that electronic correlations were not important in these compounds, further studies of various AnC60 with n=1, 2, 4 allowed to evidence that their electronic properties cannot be explained by a simple progressive band filling of the C60 six-fold degenerate t1u molecular level. This could only be ascribed to the simultaneous influence of electron correlations and Jahn-Teller Distortions (JTD of the C60 ball, which energetically favour evenly charged C60 molecules. This is underlined by the recent discovery of two expanded fulleride Cs3C60 isomeric phases which are Mott insulators at ambient pressure. Both phases undergo a pressure induced first order Mott transition to SC with a (p, T phase diagram displaying a dome shaped SC, a common situation encountered nowadays in correlated electron systems. NMR experiments allowed us to study the magnetic properties of the Mott phases and to evidence clear deviations from BCS expectations near the Mott transition. So, although SC involves an electron-phonon mechanism, the incidence of electron correlations has an importance on the electronic properties, as had been anticipated from DMFT calculations.

  13. Beta decay of {sup 97}Ag: evidence for the Gamow-Teller resonance near {sup 100}Sn

    Energy Technology Data Exchange (ETDEWEB)

    Hu Zhiqiang

    1999-03-01

    In two complementary measurements, a cube like array of 6 Euroball-Cluster germanium detectors and a total-absorption {gamma}-spectrometer were used to investigate the {beta} decay of {sup 97}Ag, a three proton-hole nucleus with respect to the {sup 100}Sn core. The half-life and Q{sub EC} value of the decay of the 9/2{sup +} ground-state of {sup 97}Ag were determined to be 25.9(4) s and 6.98(11) MeV respectively. A total of 603 {gamma} rays (578 new) was observed, and 151 levels (132 new) in {sup 97}Pd have been identified. An interesting {beta}-delayed {gamma} cascade was observed, which comprises 6 {gamma}-transitions with a de-excitation pattern involving an initial increase of the level spin. The Gamow-Teller (GT) {beta}-decay strength distributions from the two measurements reveal a large GT resonance around 4 MeV with a width of about 1.8 MeV. The hindrance factor for the total GT strength summed from the ground-state up to 6 MeV excitation energy in {sup 97}Pd, amounts to 4.3(6) with reference to a shell-model prediction. This factor is discussed in comparison with a core-polarization and a Monte-Carlo shell-model calculation. (orig.)

  14. Conduction band-edge d-states in high-k dielectrics due to Jahn-Teller term splittings

    International Nuclear Information System (INIS)

    Lucovsky, G.; Fulton, C.C.; Zhang, Y.; Luning, J.; Edge, L.; Whitten, J.L.; Nemanich, R.J.; Schlom, D.G.; Afanase'v, V.V.

    2005-01-01

    X-ray absorption spectroscopy (XAS) is used to study conduction band edge electronic structure of high-k transition metal (TM) and trivalent lanthanide series rare earth (RE) oxide dielectrics. Empty TM/RE d-states are studied by intra-atomic transitions originating in core level spin-orbit split p-states, and conduction band states are studied in inter-atomic transitions which originate in the oxygen atom 1s core level state. In non-crystalline Zr and Hf silicate alloys, the local bonding symmetry, or crystal field splits these d-states into doubly and triply degenerate features. In nano-crystalline oxides, there are additional d-state splittings due to contributions of more distant neighbors that completely remove d-state degeneracies via the Jahn-Teller effect mechanism. This gives rise to highly localized band edge states that are electronically active in photoconductivity, internal photoemission, and act as bulk traps in metal oxide semiconductor (MOS) devices

  15. Modified automatic teller machine prototype for older adults: a case study of participative approach to inclusive design.

    Science.gov (United States)

    Chan, Chetwyn C H; Wong, Alex W K; Lee, Tatia M C; Chi, Iris

    2009-03-01

    The goal of this study was to enhance an existing automated teller machine (ATM) human-machine interface in order to accommodate the needs of older adults. Older adults were involved in the design and field test of the modified ATM prototype. The design of the user interface and functionality took the cognitive and physical abilities of older adults into account. The modified ATM system included only "cash withdrawal" and "transfer" functions based on the task demands and needs for services of older adults. One hundred and forty-one older adults (aged 60 or above) participated in the field test by operating modified or existing ATM systems. Those who operated the modified system were found to have significantly higher success rates than those who operated the existing system. The enhancement was most significant among older adults who had lower ATM-related abilities, a lower level of education, and no prior experience of using ATMs. This study demonstrates the usefulness of using a universal design and participatory approach to modify the existing ATM system for use by older adults. However, it also leads to a reduction in functionality of the enhanced system. Future studies should explore ways to develop a universal design ATM system which can satisfy the abilities and needs of all users in the entire population.

  16. Solution Of Schrödinger Equation For Poschl-Teller Plus Scarf Non-Central Potential Using Supersymmetry Quantum Mechanics Aproach

    Directory of Open Access Journals (Sweden)

    Antomi Saregar

    2015-04-01

    Full Text Available In this paper, we show that the exact energy eigenvalues and eigenfunctions of the Schrödinger equation for charged particles moving in a certain class of noncentral potentials can be easily calculated analytically in a simple and elegant manner by using Supersymmetric method (SUSYQM. We discuss the Poschl-Teller plus Scarf non-central potential systems. Then, by operating the lowering operator we get the ground state wave function, and the excited state wave functions are obtained by operating raising operator repeatedly. The energy eigenvalue is expressed in the closed form obtained using the shape invariant properties. The results are in exact agreement with other methods. Keyword: supersymmetry, non-central potentials, poschl teller plus scarf.

  17. Effects of a novel poly (AA-co-AAm)/AlZnFe₂O₄/potassium humate superabsorbent hydrogel nanocomposite on water retention of sandy loam soil and wheat seedling growth.

    Science.gov (United States)

    Shahid, Shaukat Ali; Qidwai, Ansar Ahmad; Anwar, Farooq; Ullah, Inam; Rashid, Umer

    2012-10-25

    A novel poly(acrylic acid-co-acrylamide)AlZnFe₂O₄/potassium humate( )superabsorbent hydrogel nanocomposite (PHNC) was synthesized and its physical properties characterized using SEM, Energy Dispersive X-ray (EDX) and FTIR spectroscopic techniques. Air dried sandy loam soil was amended with 0.1 to 0.4 w/w% of PHNC to evaluate its soil moisture retention attributes. Effect of PHNC amendment on pH, electrical conductivity (EC), porosity, bulk density and hydraulic conductivity of sandy loam soil was also studied. The soil amendment with 0.1 to 0.4 w/w% of PHNC remarkably enhanced the moisture retention at field capacity as compared to the un-amended soils. Seed germination and seedling growth of wheat (Triticum aestivum L.) was considerably increased and a delay by 6-9 days in wilting of seedlings was observed in the soil amended with PHNC, resulting in improved wheat plant establishment and growth.

  18. Ratio of Gamow-Teller to Fermi strength observed in /sup 13,14/C(p,n) at 492 and 590 MeV

    International Nuclear Information System (INIS)

    Ullmann, J.L.; Rapaport, J.; Lisowski, P.W.

    1988-01-01

    It has been recognized for a number of years that certain spin-isospin components of the nucleon-nucleus effective interaction can be inferred from (p,n) reactions to states of known nuclear structure. For L = 0, S = 0 and L = 0, S = 1 transitions, the 0-degree (p,n) cross section can be related respectively to Fermi and Gamow-Teller beta decay matrix elements. If these transitions occur in the same nucleus, the ratio of isovector spin-flip to non-spin-flip effective interactions can be measured without regard for absolute normalization. The best reaction to measure this is /sup 14/C(p,n) which goes by a pure Gamow-Teller transition to the 1/sup /plus// state at 3.95 MeV in /sup 14/N, and Fermi transition to the 2.31 MeV 0/sup /plus// state. This work extends the ratio measurements made at lower energies (ref. 1, 2, 3) to 492 and 590 MeV. We also report on the /sup 13/C(p,n) reaction which goes by a pure GT transition to the 3.51 MeV 3/2/sup /minus// state in /sup 13/N, but by a mixed Fermi plus Gamow-Teller transition to the 1/2/sup /minus// ground state. 11 refs., 4 figs., 2 tabs

  19. System Ba/sub 2/Znsub(1-x)Cusub(x)UO/sub 6/ - a vibrational spectroscopic proof of the Jahn Teller effect

    Energy Technology Data Exchange (ETDEWEB)

    Kemmler-Sack, S; Rother, H J [Tuebingen Univ. (Germany, F.R.). Inst. fuer Chemie

    1979-01-01

    The ordered perovskites Ba/sub 2/ZnUO/sub 6/ (cubic, space group Fm3m) and Ba/sub 2/CuUO/sub 6/ (tetragonal, space group I/sub 4//mmm) form solid solutions. For small Cu content the lattice symmetry is cubic, with x>=0.25 an increasing tetragonal distortion (c/a ..sqrt..2 > 1) is observed. From the vibrational spectra and in accordance with the factor group analysis the symmetry of the UO/sub 6/ octahedra is for small Cu content Osub(h) and on the Cu-rich side Dsub(4h). In the region of the lattice vibrations (T/sub 2/ field) the lifting of the degeneracy - due to the Jahn Teller effect of Cu/sup 2 +/ - leads to a band separation, which decreases with sinking copper content. Therefore the Jahn Teller effect is easily noticeable with vibrational spectroscopic methods. In the corresponding series with Wsup(VI) the vibrational spectroscopic investigations lead qualitatively to the same results as in the Usup(VI) system. As further examples the stacking polytypes Ba/sub 2/ZnTeO/sub 6/ and Ba/sub 2/CuTeO/sub 6/ are considered. The vibrational spectra show, that the Jahn Teller effect in this lattice, which is strengthened by partial face-sharing of octahedra, is less pronounced than in the perovskites in which only corner-sharing is present.

  20. Delphi4LED - From measurements to standardized multi-domain compact models of LED : A new European R&D project for predictive and efficient multi-domain modeling and simulation of LEDs at all integration levels along the SSL supply chain

    NARCIS (Netherlands)

    Bornoff, R.; Hildenbrand, V.; Lungten, S.; Martin, G.; Marty, C.; Poppe, A.; Rencz, M.; Schilders, W.H.A.; Yu, Joan

    2016-01-01

    There are a few bottlenecks hampering efficient design of products on different integration lepels of the ssL supply chain. one major issue is that data sheet information propided about packaged LEDs is usually insufficient and inconsistent among different LED pendors. Many data such as temperature

  1. Gamow-Teller decay and nuclear deformation: implementing of a new total absorption spectrometer, study of isotopes N {approx_equal} Z krypton and strontium; Decroissance Gamow-Teller et deformation nucleaire: mise en oeuvre d'un nouveau spectrometre a absorption totale, etude d'isotopes N {approx_equal} Z de krypton et strontium

    Energy Technology Data Exchange (ETDEWEB)

    Poirier, E

    2002-12-01

    Nuclei with A {approx} 70 along the N=Z line are known to be the scene of phenomena closely related to the nuclear deformation and are of particular interest since theoretical mean field calculations predict that a large part of the Gamow-Teller resonance might be located below the ground state of the mother nucleus and then be accessible through {beta}-decay studies. These results have shown the effect of the shape of the ground state on the intensity of the Gamow-Teller strength. Thus, the experimental determination, through {delta}-decay, of the Gamow-Teller strength distribution and the comparison to the theoretical predictions allow to pin down the quadrupolar deformation parameter of the ground state of the parent nucleus. In order to study the neutron deficient isotopes of krypton (A=72,73,74,75) and strontium (A=76,77,78) and to establish the {beta}-strength on the full energy range, a new total absorption spectrometer (TAgS) has been built in the frame of an international collaboration and installed at the (SOLDE/CERN mass separator. For the data analysis, the response function R of the spectrometer has been calculated by means of Monte-Carlo simulations, based on the GEANT4 code, and of a statistical description of the level scheme in the daughter nucleus. The {beta}-feeding distribution has been obtained from experimental spectra through a method based on Bayes theorem and then converted into Gamow-Teller strength. The results coming from the {sup 74}Kr decay analysis allow to describe the ground state of such a nucleus as the coexistence of an oblate shape and of a prolate shape. In the case of {sup 76}Sr, the experimental Gamow-Teller strength distribution strongly indicates a prolate deformation. (author)

  2. Physical-hydraulic properties of a sandy loam typic paleudalf soil under organic cultivation of 'montenegrina' mandarin (Citrus deliciosa Tenore¹

    Directory of Open Access Journals (Sweden)

    Caroline Valverde dos Santos

    2014-12-01

    Full Text Available Citrus plants are the most important fruit species in the world, with emphasis to oranges, mandarins and lemons. In Rio Grande do Sul, Brazil, most fruit production is found on small properties under organic cultivation. Soil compaction is one of the factors limiting production and due to the fixed row placement of this crop, compaction can arise in various manners in the interrows of the orchard. The aim of this study was to evaluate soil physical properties and water infiltration capacity in response to interrow management in an orchard of mandarin (Citrus deliciosa Tenore 'Montenegrina' under organic cultivation. Interrow management was performed through harrowing, logs in em "V", mowing, and cutting/knocking down plants with a knife roller. Soil physical properties were evaluated in the wheel tracks of the tractor (WT, between the wheel tracks (BWT, and in the area under the line projection of the canopy (CLP, with undisturbed soil samples collected in the 0.00-0.15, 0.15-0.30, 0.30-0.45, and 0.45-0.60 m layers, with four replicates. The soil water infiltration test was performed using the concentric cylinder method, with a maximum time of 90 min for each test. In general, soil analysis showed a variation in the physical-hydraulic properties of the Argissolo Vermelho-Amarelo distrófico arênico (sandy loam Typic Paleudalf in the three sampling sites in all layers, regardless of the management procedure in the interrows. Machinery traffic leads to heterogeneity in the soil physical-hydraulic properties in the interrows of the orchard. Soil porosity and bulk density are affected especially in the wheel tracks of the tractor (WT, which causes a reduction in the constant rate of infiltration and in the accumulated infiltration of water in this sampling site. The use of the disk harrow and mower leads to greater harmful effects on the soil, which can interfere with mandarin production.

  3. Uranium hydrogeochemical and stream-sediment reconnaissance of the Teller NTMS Quadrangle, Alaska. National Uranium Resource Evaluation

    International Nuclear Information System (INIS)

    1982-06-01

    This report presents results of a Hydrogeochemical and Stream Sediment Reconnaissance (HSSR) of the Teller NTMS quadrangle, Alaska. In addition to this abbreviated data release, more complete data are available to the public in machine-readable form. These machine-readable data, as well as quarterly or semiannual program progress reports containing further information on the HSSR program in general, or on the Los Alamos National Laboratory (LANL) portion of the program in particular, are available from DOE's Technical Library at its Grand Junction Area Office. Presented in this data release are location data, field analyses, and laboratory analyses of several different sample media. For the sake of brevity, many field site observations have not been included in this volume; these data are, however, available on the magnetic tape. Appendices A through D describe the sample media and summarize the analytical results for each medium. The data have been subdivided by one of the Los Alamos National Laboratory sorting programs of Zinkl and others (1981a) into groups of stream-sediment, lake-sediment, stream-water, lake-water, and ground-water samples. For each group which contains a sufficient number of observations, statistical tables, tables of raw data, and 1:1,000,000 scale maps of pertinent elements have been included in this report. Also included are maps showing results of multivariate statistical analyses. Information on the field and analytical procedures used by the Los Alamos National Laboratory during sample collection and analysis may be found in any HSSR data release prepared by the Laboratory and will not be included in this report

  4. High-resolution study of Gamow-Teller transitions in the 47Ti(3He,t)47V reaction

    Science.gov (United States)

    Ganioǧlu, E.; Fujita, H.; Fujita, Y.; Adachi, T.; Algora, A.; Csatlós, M.; Deaven, J. M.; Estevez-Aguado, E.; Guess, C. J.; Gulyás, J.; Hatanaka, K.; Hirota, K.; Honma, M.; Ishikawa, D.; Krasznahorkay, A.; Matsubara, H.; Meharchand, R.; Molina, F.; Okamura, H.; Ong, H. J.; Otsuka, T.; Perdikakis, G.; Rubio, B.; Scholl, C.; Shimbara, Y.; Susoy, G.; Suzuki, T.; Tamii, A.; Thies, J. H.; Zegers, R. G. T.; Zenihiro, J.

    2013-01-01

    Given the importance of Gamow-Teller (GT) transitions in nuclear structure and astrophysical nuclear processes, we have studied Tz=+3/2→+1/2, GT transitions starting from the 47Ti nucleus in the (3He,t) charge-exchange reaction at 0∘ and at an intermediate incident energy of 140 MeV/nucleon. The experiments were carried out at the Research Center for Nuclear Physics (RCNP), Osaka, using the high-resolution facility with a high-dispersion beam line and the Grand-Raiden spectrometer. With an energy resolution of 20 keV, individual GT transitions were observed and GT strength was derived for each state populated up to an excitation energy (Ex) of 12.5 MeV. The GT strength was widely distributed from low excitation energy up to 12.5 MeV, where we had to stop the analysis because of the high level density. The distribution of the GT strengths was compared with the results of shell model calculations using the GXPF1 interaction. The calculations could reproduce the experimental GT distributions well. The GT transitions from the ground state of 47Ti and the M1 transitions from the isobaric analog state in 47V to the same low-lying states in 47V are analogous. It was found that the ratios of GT transition strengths to the ground state, the 0.088-MeV state, and the 0.146-MeV state are similar to the ratios of the strengths of the analogous M1 transitions from the isobaric analog state (IAS) to these states. The measured distribution of the GT strengths was also compared with those starting from the Tz=+3/2 nucleus 41K to the Tz=+1/2 nucleus 41Ca.

  5. Ab initio theory of spin-orbit coupling for quantum bits in diamond exhibiting dynamic Jahn-Teller effect

    Science.gov (United States)

    Gali, Adam; Thiering, Gergő

    Dopants in solids are promising candidates for implementations of quantum bits for quantum computing. In particular, the high-spin negatively charged nitrogen-vacancy defect (NV) in diamond has become a leading contender in solid-state quantum information processing. The initialization and readout of the spin is based on the spin-selective decay of the photo-excited electron to the ground state which is mediated by spin-orbit coupling between excited states states and phonons. Generally, the spin-orbit coupling plays a crucial role in the optical spinpolarization and readout of NV quantum bit (qubit) and alike. Strong electron-phonon coupling in dynamic Jahn-Teller (DJT) systems can substantially influence the effective strength of spin-orbit coupling. Here we show by ab initio supercell density functional theory (DFT) calculations that the intrinsic spin-orbit coupling is strongly damped by DJT effect in the triplet excited state that has a consequence on the rate of non-radiative decay. This theory is applied to the ground state of silicon-vacancy (SiV) and germanium-vacancy (GeV) centers in their negatively charged state that can also act like qubits. We show that the intrinsic spin-orbit coupling in SiV and GeV centers is in the 100 GHz region, in contrast to the NV center of 10 GHz region. Our results provide deep insight in the nature of SiV and GeV qubits in diamond. EU FP7 DIADEMS project (Contract No. 611143).

  6. Nodeless vibrational amplitudes and quantum nonadiabatic dynamics in the nested funnel for a pseudo Jahn-Teller molecule or homodimer

    Science.gov (United States)

    Peters, William K.; Tiwari, Vivek; Jonas, David M.

    2017-11-01

    The nonadiabatic states and dynamics are investigated for a linear vibronic coupling Hamiltonian with a static electronic splitting and weak off-diagonal Jahn-Teller coupling through a single vibration with a vibrational-electronic resonance. With a transformation of the electronic basis, this Hamiltonian is also applicable to the anti-correlated vibration in a symmetric homodimer with marginally strong constant off-diagonal coupling, where the non-adiabatic states and dynamics model electronic excitation energy transfer or self-exchange electron transfer. For parameters modeling a free-base naphthalocyanine, the nonadiabatic couplings are deeply quantum mechanical and depend on wavepacket width; scalar couplings are as important as the derivative couplings that are usually interpreted to depend on vibrational velocity in semiclassical curve crossing or surface hopping theories. A colored visualization scheme that fully characterizes the non-adiabatic states using the exact factorization is developed. The nonadiabatic states in this nested funnel have nodeless vibrational factors with strongly avoided zeroes in their vibrational probability densities. Vibronic dynamics are visualized through the vibrational coordinate dependent density of the time-dependent dipole moment in free induction decay. Vibrational motion is amplified by the nonadiabatic couplings, with asymmetric and anisotropic motions that depend upon the excitation polarization in the molecular frame and can be reversed by a change in polarization. This generates a vibrational quantum beat anisotropy in excess of 2/5. The amplitude of vibrational motion can be larger than that on the uncoupled potentials, and the electronic population transfer is maximized within one vibrational period. Most of these dynamics are missed by the adiabatic approximation, and some electronic and vibrational motions are completely suppressed by the Condon approximation of a coordinate-independent transition dipole between

  7. Usability of a virtual reality environment simulating an automated teller machine for assessing and training persons with acquired brain injury.

    Science.gov (United States)

    Fong, Kenneth N K; Chow, Kathy Y Y; Chan, Bianca C H; Lam, Kino C K; Lee, Jeff C K; Li, Teresa H Y; Yan, Elaine W H; Wong, Asta T Y

    2010-04-30

    This study aimed to examine the usability of a newly designed virtual reality (VR) environment simulating the operation of an automated teller machine (ATM) for assessment and training. Part I involved evaluation of the sensitivity and specificity of a non-immersive VR program simulating an ATM (VR-ATM). Part II consisted of a clinical trial providing baseline and post-intervention outcome assessments. A rehabilitation hospital and university-based teaching facilities were used as the setting. A total of 24 persons in the community with acquired brain injury (ABI)--14 in Part I and 10 in Part II--made up the participants in the study. In Part I, participants were randomized to receive instruction in either an "early" or a "late" VR-ATM program and were assessed using both the VR program and a real ATM. In Part II, participants were assigned in matched pairs to either VR training or computer-assisted instruction (CAI) teaching programs for six 1-hour sessions over a three-week period. Two behavioral checklists based on activity analysis of cash withdrawals and money transfers using a real ATM were used to measure average reaction time, percentage of incorrect responses, level of cues required, and time spent as generated by the VR system; also used was the Neurobehavioral Cognitive Status Examination. The sensitivity of the VR-ATM was 100% for cash withdrawals and 83.3% for money transfers, and the specificity was 83% and 75%, respectively. For cash withdrawals, the average reaction time of the VR group was significantly shorter than that of the CAI group (p = 0.021). We found no significant differences in average reaction time or accuracy between groups for money transfers, although we did note positive improvement for the VR-ATM group. We found the VR-ATM to be usable as a valid assessment and training tool for relearning the use of ATMs prior to real-life practice in persons with ABI.

  8. Cultivos de cobertura: efectos sobre la macroporosidad y la estabilidad estructural de un suelo franco-limoso Cover crops: effects on soil macroporosity and soil structural stability in a silt loam soil

    Directory of Open Access Journals (Sweden)

    María Florencia Varela

    2011-07-01

    Full Text Available Los suelos franco-limosos manejados con siembra directa a menudo poseen porosidad estructural baja e inestable. Con el objetivo de determinar la capacidad de los cultivos de cobertura (CC de mejorar la porosidad y estabilidad estructural de estos suelos se llevaron a cabo experimentos de campo y de invernáculo. Ambos tuvieron tratamientos con y sin CC (avena, Avena sativa L., en rotación con soja (Glicine max L. Merr.. Luego de los CC se midieron densidad aparente (DA, el índice de inestabilidad estructural (IE y en el ensayo de invernáculo además, se midió la evolución de la distribución de tamaño de poros (DTP. En ambos ensayos la introducción de CC no disminuyó la DA, aunque incrementó la estabilidad del suelo (PNo- till (NT silt loam topsoils have often a low and unstable structural porosity. The objective of this study was to determine the capability of cover crops (CC of improving the structural porosity and stability of silt loam soils under NT. Greenhouse and field experiments were carried out on a silt loam soil (Typic Argiudoll with and without CC (oat, Avena sativa L. in crop sequences with soybean (Glicine max L. Merr.. Soil bulk density (DA and aggregate instability index (IE were measured after the CC in both experiments. In the greenhouse experiment, soil pore size distribution (DTP was measured. The use of CC did not change DA, but soil IE was significantly lower in crop sequences with CC (P < 0.05 both under field and greenhouse conditions. Stability increases were likely due to the effect of CC residues and root mass. No differences in DTP were found between treatments, although a significant effect of sampling date was observed (P<0.05. Changes in DTP were due to significant increases in mesopore (517.5% and macropore (52.7% volumes. Such changes occurred in all the treatments, probably due to the soil wetting-drying cycles. The results found in this study agree with other studies carried out on silt loams in the

  9. The Effects of Land Configuration and Wood-Shavings Mulch on the Properties of a Sandy Loam Soil in Northeast Nigeria. 2. Changes in Physical Properties

    Directory of Open Access Journals (Sweden)

    Chiroma, AM.

    2006-01-01

    Full Text Available Mulching and ridge tillage are proven technologies for improving soil productivity in semi-arid regions. Yet data quantifying the combined influences of these practices are limited. Our objectives were to determine the changes in selected physical properties of a sandy loam after 4-years of annual tillage and wood-shavings mulching. The tillage and wood-shavings treatments consisted of: Flat bed (FB, Open ridge (OR, Tiedridge (TR, FBM, ORM and TRM were same as FB, OR and TR, respectively except that wood-shavings at a rate of 10 t/ha were surface applied ≈ 2 weeks after sowing each year to serve as both a mulch and an organic amendment. At the end of the trial in 2002, bulk density, penetration resistance, total porosity and soil water content from each of 0-0.075, 0.075-0.15 and 0.15-0.30 m depths were determined. Composite samples from the surface (0.075 and 0.075-0.15 m layers from 3 replicates of each treatment were also collected for the determination of wet aggregate stability and from 0-0.15 m and 0.15-0.30 m layers for determination of saturated hydraulic conductivity (Ksat. After 4 years of annual tillage and addition of woodshavings, soil bulk density and penetration resistance were consistently lower and total porosity higher in the FBM, ORM and TRM treatments than in the FB, OR and TR treatments. Penetration resistance in all treatments was strongly related to soil water content. A 'hoe pan' was established below 0.15 m depth beneath the furrows of the ridged treatments. This could be attributed to human traffic during field operations and ponding of water, which occurred in the furrows following heavy rains. Wet aggregate stability estimated as the proportion of aggregates of size > 0.25 mm (macro-aggregates in the 0-0.15 m layer were significantly (P< 0.05 higher under FBM, ORM and TRM than under FB, OR or TR treatments. Ksat was not influenced by either tillage or wood-shavings treatments but were higher for the mulched plots

  10. Peanut plant growth and yield as influenced by co-inoculation with Bradyrhizobium and some rhizo-microorganisms under sandy loam soil conditions

    Directory of Open Access Journals (Sweden)

    F.Sh.F. Badawi

    2011-06-01

    Full Text Available The ability of tested rhizomicrobial isolates (Serratia marcescens and Trichoderma harzianum along with a strain of root nodule bacteria (Bradyrhizobium spp. to exhibit some PGP-properties was evaluated in vitro conditions. The main PGP-properties, namely the ability to solubilize-P and production of IAA, as well as production of siderophores and HCN were examined. Additionally, field trials were conducted on sandy loam soil at El-Tahrir Province during two successive summer seasons to study the effect of co-inoculation with Bradyrhizobium either individually or together with S. marcescens and/or T. harzianum on nodulation, some plant growth characters, peanut yield and its yield components. The in vitro experiment revealed that all of the tested microorganisms were apparently able to trigger PGP-properties. Phosphate solubilization was the common feature of the employed microorganisms. However, T. harzianum appeared to be superior to other microorganisms, and Bradyrhizobium displayed the lowest capacity. The ability of the microorganisms to produce indole compounds showed that S. marcescens was more effective in IAA production and followed by Bradyrhizobium. Capacity of S. marcescens and T. harzianum to excrete ferric-specific ligands (siderophores and HCN was detected, while Bradyrhizobium failed to produce such compounds. Results of field trials showed that the uninoculated peanut had the least nodulation status, N2-ase activity and all vegetative growth characters in both studied seasons. Bacterization of peanut seeds with bradyrhizobia exerted considerable improvement in number and mass of root nodules, increased the rate of acetylene reduction and all growth characters in comparison to the uninoculated control. The synergy inoculation between bradyrhizobia and any of the tested microorganisms led to further increases of all mentioned characters and strengthened the stimulating effect of the bacterial inoculation. However, the promotive

  11. [Characteristics of N2, N2O, NO, CO2 and CH4 Emissions in Anaerobic Condition from Sandy Loam Paddy Soil].

    Science.gov (United States)

    Cao, Na; Wang, Rui; Liao, Ting-ting; Chen, Nuo; Zheng, Xun-hua; Yao, Zhi-sheng; Zhang, Hai; Butterbach-Bahl, Klaus

    2015-09-01

    Understanding the characteristics of the production of nitrogen gases (N2, N2O and NO), CO2 and CH4 in anaerobic paddy soils is not only a prerequisite for an improved mechanistic understanding of key microbial processes involved in the production of atmospheric greenhouse gases (GHG), but might also provide the basis for designing greenhouse gas mitigation strategies. Moreover, quantifying the composition fractions of denitrification gaseous products is of key importance for improving parameterization schemes of microbial processes in process-oriented models which are increasingly used for assessing soil GHG emissions at site and national scales. In our experiments we investigated two sandy loam soils from two paddy fields. The initial concentrations of soil nitrate and dissolved organic carbon (DOC) were set at approximately 50 mg.kg-1 and mg.kg-1, respectively, by adding a mixture solution of KNO3 and glucose. The emissions of N2, N2O NO, CO2 and CH4, as well as concentrations of carbon and nitrogen substrates for each soil sample were measured simultaneously, using a gas-flow-soil-core technique and a paralleling substrate monitoring system. The results showed that the accumulative emissions of N2, N2O and NO of the two soil samples for the entire incubation period were 6 - 8, 20, and 15 - 18 mg.kg-1, respectively. By measuring the cumulative emissions of denitrification gases (N, = N2 + N2O + NO) we were able to explain 95% to 98% of observed changes in s1ifr nilrate concentrations. The mass fractions of N2, N2O and NO emissions to Nt were approximately 15% -19%, 47% -49%, and 34% -36%, respectively. Thus, in our experiments N2O and NO were the main products of denitrification for the entire incubation period. However, as the temporal courses of hourly or daily production of the denitrification gases showed, NO production dominated and peaked firstly, and then N2O, before finally N2 became the dominant product. Our results show the high temporal dynamic of

  12. Usability of a virtual reality environment simulating an automated teller machine for assessing and training persons with acquired brain injury

    Directory of Open Access Journals (Sweden)

    Li Teresa HY

    2010-04-01

    Full Text Available Abstract Objective This study aimed to examine the usability of a newly designed virtual reality (VR environment simulating the operation of an automated teller machine (ATM for assessment and training. Design Part I involved evaluation of the sensitivity and specificity of a non-immersive VR program simulating an ATM (VR-ATM. Part II consisted of a clinical trial providing baseline and post-intervention outcome assessments. Setting A rehabilitation hospital and university-based teaching facilities were used as the setting. Participants A total of 24 persons in the community with acquired brain injury (ABI - 14 in Part I and 10 in Part II - made up the participants in the study. Interventions In Part I, participants were randomized to receive instruction in either an "early" or a "late" VR-ATM program and were assessed using both the VR program and a real ATM. In Part II, participants were assigned in matched pairs to either VR training or computer-assisted instruction (CAI teaching programs for six 1-hour sessions over a three-week period. Outcome Measures Two behavioral checklists based on activity analysis of cash withdrawals and money transfers using a real ATM were used to measure average reaction time, percentage of incorrect responses, level of cues required, and time spent as generated by the VR system; also used was the Neurobehavioral Cognitive Status Examination. Results The sensitivity of the VR-ATM was 100% for cash withdrawals and 83.3% for money transfers, and the specificity was 83% and 75%, respectively. For cash withdrawals, the average reaction time of the VR group was significantly shorter than that of the CAI group (p = 0.021. We found no significant differences in average reaction time or accuracy between groups for money transfers, although we did note positive improvement for the VR-ATM group. Conclusion We found the VR-ATM to be usable as a valid assessment and training tool for relearning the use of ATMs prior to real

  13. Generalized Born-Oppenheimer treatment of Jahn-Teller systems in Hilbert spaces of arbitrary dimension: theory and application to a three-state model potential.

    Science.gov (United States)

    Varandas, A J C; Sarkar, B

    2011-05-14

    Generalized Born-Oppenheimer equations including the geometrical phase effect are derived for three- and four-fold electronic manifolds in Jahn-Teller systems near the degeneracy seam. The method is readily extendable to N-fold systems of arbitrary dimension. An application is reported for a model threefold system, and the results are compared with Born-Oppenheimer (geometrical phase ignored), extended Born-Oppenheimer, and coupled three-state calculations. The theory shows unprecedented simplicity while depicting all features of more elaborated ones.

  14. A study of Gamow-Teller transitions for N = Z nuclei, {sup 24}Mg, {sup 28}Si, and {sup 32}S, by a deformed QRPA

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Eunja; Cheoun, Myung-Ki [Soongsil University, Origin of Matter and Evolution of Galaxy Institute and Department of Physics, Seoul (Korea, Republic of)

    2017-02-15

    We investigated Gamow-Teller (GT) transitions and strength distributions of s-d shell N = Z nuclei, {sup 24}Mg, {sup 28}Si, and {sup 32}S, by a deformed quasi-particle random phase approximation (DQRPA). In the DQRPA, we included particle model space up to p-f shell and considered explicitly the deformation as well as the like- and unlike-pairing correlations. Shell evolution by deformation and attractive force by unlike-pairing correlations turned out to play vital roles to reproduce the experimental GT data. Correlations between the deformation and the pairing correlations are also discussed with the comparison to the experimental data shape. (orig.)

  15. Minimum dipole moment required to bind an electron--molecular theorists rediscover phenomenon mentioned in Fermi--Teller paper on another subject twenty years earlier

    International Nuclear Information System (INIS)

    Turner, J.E.

    1976-07-01

    Work leading to the discovery of the minimum dipole moment for electron binding, D/sub min/ = 0.639 ea 0 (atomic units), by several groups in 1967-68 is described. It was subsequently learned that this number had been published in 1947 by Fermi and Teller, who did not, however, indicate how they derived it. The author has found a numerical solution in Fermi's notebooks from 1946-50 at the University of Chicago Library. Fermi's work is described and presented here with relevant material from his notebooks

  16. Pseudo Jahn–Teller origin of ferroelectric instability in BaTiO{sub 3} type perovskites: The Green's function approach and beyond

    Energy Technology Data Exchange (ETDEWEB)

    Polinger, V., E-mail: polinv@uw.edu [Department of Physics, University of Washington, Seattle, WA 98195-1560 (United States); Garcia-Fernandez, P. [Ciencias de la Tierra y Física de la Materia Condensada, Universidad de Cantabria, Avenida de los Castros s/n, E-39005 Santander (Spain); Bersuker, I.B. [Department of Chemistry and Biochemistry, The University of Texas at Austin, Austin, TX 78712-0165 (United States)

    2015-01-15

    The local origin of dipolar distortions in ABO{sub 3} perovskite crystals is reexamined by means of a novel approach, the Green's function method augmented by DFT computations. The ferroelectric distortions are shown to be induced by the pseudo Jahn–Teller effect (PJTE). The latter involves vibronic hybridization (admixture) of the ground state to same-spin opposite-parity excited electronic bands. Similar to numerous molecular calculations, the PJT approach provides a deeper insight into the nature of chemical bonding in the octahedral cluster [BO{sub 6}] and, in particular, reveals the local origin of its polar instability. This allows predicting directly which transition ions can create ferroelectricity. In particular, the necessary conditions are established when an ABO{sub 3} perovskite crystal with an electronic d{sup n} configuration of the complex ion [BO{sub 6}] can possess both proper ferroelectric and magnetic properties. Distinguished from the variety of cluster approaches to local properties, the Green's function method includes the influence of the local vibronic-coupling perturbation on the whole crystal via the inter-cell interaction responsible for creation of electronic and vibrational bands. Calculated Green's functions combined with the corresponding numeric estimates for the nine electronic bands, their density of states, and the local adiabatic potential energy surface (APES) confirm the eight-minimum form of this surface and feasibility of the PJT origin of the polar instability in BaTiO{sub 3}. We show also that multicenter long-range dipole–dipole interactions critically depend on the PJTE largely determining the magnitude of the local dipoles. DFT calculations for the bulk crystal and its clusters confirm that the dipolar distortions are of local origin, but become possible only when their influence on (relaxation of) the whole lattice is taken into account. The results are shown to be in full qualitative and

  17. Minimum dipole moment required to bind an electron: molecular theorists rediscover phenomenon mentioned in Fermi-Teller paper twenty years earlier

    International Nuclear Information System (INIS)

    Turner, J.E.

    1977-01-01

    Work leading to the discovery of the minimum dipole moment for electron binding, D/sub min/=0.639 ea 0 (atomic units), by several groups in 1967--1968 is described. It was subsequently learned that this number had been published in 1947 by Fermi and Teller, who did not, however, indicate how they derived it. The author has found a numerical solution in Fermi's notebooks from 1946--1950 at the University of Chicago Library. Fermi's work is described and presented here with relevant material from his notebooks

  18. Analysis of D Dimensional Dirac equation for q -deformed Posch-Teller combined with q -deformed trigonometric Manning Rosen Non-Central potential using Asymptotic Iteration Method (AIM)

    International Nuclear Information System (INIS)

    Alam, Y.; Suparmi; Cari; Anwar, F.

    2016-01-01

    In this study, we used asymptotic iteration method (AIM) to obtain the relativistic energy spectra and wavefunctions for D Dimensional Dirac equation. Solution of the D Dimensional Dirac equation using asymptotic iteration method was done by four steps. The first step, we substitutied q deformed Poschl-Teller potential plus q-deformed Manning Rosen Non-Central potential into D dimensional Dirac equation. And then, general term of D dimensioanl Dirac equation for q deformed Poschl-Teller potential plus q-deformed Manning Rosen Non-Central potential was reduced into one dimensioanal Dirac equation, consist of radial part and angular part. The second step, both of one dimensional part must be reduced to hypergeometric type differential equation by suitable parameter change. And then, hypergeometric type differential equation was transformed into AIM type differential equation. For the last step, AIM type differential equation can be solved to obtain the relativistic energy and wavefunctions of Dirac equation. Relativistic energy and wavefunctions were visualized by using Matlab software. (paper)

  19. Measurement of Gamow-Teller and spin dipole strength in the 45Sc(n,p)45Ca reaction at 198 MeV

    International Nuclear Information System (INIS)

    Alford, W.P.; Celler, A.; Brown, B.A.; Long, S.; Raywood, K.

    1990-11-01

    The reaction 45 Sc(n,p) 45 Ca has been studied at an energy of 198 MeV with energy resolution of about 1 MeV. Measurements were carried out at nominal angles 0, 3, 6, 9, 12, 15, and 18 degrees and spectra obtained up to ∼40 MeV excitation energy in 45 Ca. Significant Gamow-Teller strength is observed at an excitation energy of about 7 MeV, somewhat higher than predicted by shell model calculations. The strength observed is in agreement with calculations using g A /g V ≅ 1. The spin dipole giant resonance is seen with centroid at about 15 MeV excitation and total cross section of 25 mb/sr at an angle of 6 degrees. (Author) (22 refs., 9 figs.)

  20. An Anomaly in the Inglis-Teller Limits of the C VI Lyman and Balmer Series in Laser-Produced Plasmas

    Science.gov (United States)

    Elton, R.; Iglesias, E.; Griem, H.; Weaver, J.; Pien, G.; Mancini, R.

    2002-11-01

    Soft x-ray spectra from thin carbon layers heated by the OMEGA and NIKE lasers have been obtained with both spherical and planar targets, respectively, using a flat-field grazing incidence spectrograph equipped with a gated microchannel plate for temporal resolution. In both experiments, late-time (recombining) hydrogenic C VI spectra show an n-to-1 Lyman spectral series blending with the continuum at n=4, contrary to n=9 in the n-to-2 Balmer series. It appears unlikely that plasma inhomogeneities are the sole cause of this anomaly, given the difference in the experimental configurations. Other explanations for the line-to-continuum merging (other than the usual Stark-broadened Inglis-Teller effect) under consideration include non-thermal Doppler broadening, deviations from statistical sublevel population distributions, and opacity effects. Collisional-radiative and hydrodynamic modeling, including cascades, is employed to further understand this phenomenon.

  1. Synthesis under pressure and characterizations through optical spectroscopy of jahn-teller cations (LS Ni3+, is Co3+) as probes diluted in a perovskite matrix

    Science.gov (United States)

    Sanz-Ortiz, M. N.; Rodríguez, F.; Baranov, A.; Demazeau, G.

    2008-07-01

    The objective is to explore through optical spectroscopy and magnetic measurements the coordination and electronic structures of transition-metal ions introduced as impurities with unusual valence states in the oxide perovskite LaAlO3. The selected transition-metal ions Ni3+(3d7) and Co3+(3d6) are characterized by an electronic configuration likely leading to an orbital degenerate E state in Oh symmetry, and thus electron-lattice coupling due to the Jahn-Teller effect may induce low symmetry distortion around the impurity oxygen octahedron. We show that a sol-gel process followed by high oxygen pressure treatments yields stabilization of trivalent state in oxide perovskite. Information about the coordination, electronic structure and aggregation around the magnetic impurity was obtained from X-ray diffraction, FTIR and optical spectroscopy. Finally, evidence on the possible existence of intermediate spin state in Co3+ is under consideration.

  2. Jahn-Teller coupling of Cr2+ ion with degenerate modes in ZnS, ZnSe, and ZnTe crystals: microscopic treatment

    International Nuclear Information System (INIS)

    Natadze, A.L.; Ryskin, A.I.

    1980-01-01

    The Jahn-Teller (JT) interaction energy is calculated for 5 T 2 and 5 E states of the Cr 2+ ion in ZnS, ZnSe, and ZnTe crystals. The calculations are made within the framework of a particular microscopic model of the crystal field in the distorted crystal (model of point-like exchange charges), the multimode interaction is taken into account. For the 5 T 2 term the energies of interaction with tetragonal and trigonal modes are of the same order of magnitude. This circumstance results in a small height of the barriers that separate various minima of the adiabatic potential and is responsible for the dynamic aspect of the static JT effect in these systems. (author)

  3. Synthesis under pressure and characterizations through optical spectroscopy of jahn-teller cations (LS Ni3+, is Co3+) as probes diluted in a perovskite matrix

    International Nuclear Information System (INIS)

    Sanz-Ortiz, M N; RodrIguez, F; Baranov, A; Demazeau, G

    2008-01-01

    The objective is to explore through optical spectroscopy and magnetic measurements the coordination and electronic structures of transition-metal ions introduced as impurities with unusual valence states in the oxide perovskite LaAlO 3 . The selected transition-metal ions Ni 3+ (3d 7 ) and Co 3+ (3d 6 ) are characterized by an electronic configuration likely leading to an orbital degenerate E state in Oh symmetry, and thus electron-lattice coupling due to the Jahn-Teller effect may induce low symmetry distortion around the impurity oxygen octahedron. We show that a sol-gel process followed by high oxygen pressure treatments yields stabilization of trivalent state in oxide perovskite. Information about the coordination, electronic structure and aggregation around the magnetic impurity was obtained from X-ray diffraction, FTIR and optical spectroscopy. Finally, evidence on the possible existence of intermediate spin state in Co 3+ is under consideration

  4. Ashkin-Teller criticality and weak first-order behavior of the phase transition to a fourfold degenerate state in two-dimensional frustrated Ising antiferromagnets

    Science.gov (United States)

    Liu, R. M.; Zhuo, W. Z.; Chen, J.; Qin, M. H.; Zeng, M.; Lu, X. B.; Gao, X. S.; Liu, J.-M.

    2017-07-01

    We study the thermal phase transition of the fourfold degenerate phases (the plaquette and single-stripe states) in the two-dimensional frustrated Ising model on the Shastry-Sutherland lattice using Monte Carlo simulations. The critical Ashkin-Teller-like behavior is identified both in the plaquette phase region and the single-stripe phase region. The four-state Potts critical end points differentiating the continuous transitions from the first-order ones are estimated based on finite-size-scaling analyses. Furthermore, a similar behavior of the transition to the fourfold single-stripe phase is also observed in the anisotropic triangular Ising model. Thus, this work clearly demonstrates that the transitions to the fourfold degenerate states of two-dimensional Ising antiferromagnets exhibit similar transition behavior.

  5. Thermodynamics properties study of diatomic molecules with q-deformed modified Poschl-Teller plus Manning Rosen non-central potential in D dimensions using SUSYQM approach

    Science.gov (United States)

    Suparmi, A.; Cari, C.; Pratiwi, B. N.

    2016-04-01

    D-dimensional Dirac equation of q-deformed modified Poschl-Teller plus Manning Rosen non-central potential was solved using supersymmetric quantum mechanics (SUSY QM). The relativistic energy spectra were analyzed by using SUSY QM and shape invariant properties from radial part of D dimensional Dirac equation and the angular quantum numbers were obtained from angular part of D dimensional Dirac equation. The SUSY operators was used to generate the D dimensional relativistic wave functions both for radial and angular parts. In the non-relativistic limit, the relativistic energy equation was reduced to the non-relativistic energy. In the classical limit, the partition function of vibrational, the specific heat of vibrational, and the mean energy of vibrational of some diatomic molecules were calculated from the equation of non-relativistic energy with the help of error function and Mat-lab 2011.

  6. Study of Gamow-Teller giant resonance in /sup 90/Nb by the /sup 90/Zr(/sup 3/He,t)/sup 90/Nb reaction at 90 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, M.; Fujita, Y.; Katayama, I.; Morinobu, S.; Yamazaki, T.; Itahashi, T.; Ikegami, H. [Osaka Univ., Suita (Japan). Research Center for Nuclear Physics; Hayakawa, S. I.; Ikegami, Hidetsugu; Muraoka, Mitsuo [eds.; Osaka Univ., Suita (Japan). Research Center for Nuclear Physics

    1980-01-01

    A Gamow-Teller giant resonance in /sup 90/Nb was excited by the /sup 90/Zr(/sup 3/He, t) reaction at 89.5 MeV. The strength of the resonance was localized in the energy region of Ex = 4.5 - 7.5 MeV. The transition was found to be dominated by the L = 2 transfer.

  7. Radiological aspects of choice of a system of cultivation of sod-podzolic sandy loam soils with different degree of humidity on lands of Mogilev region contaminated with 137Cs

    International Nuclear Information System (INIS)

    Lazarevich, S.S.; Ermolenko, A.V.; Shapsheeva, T.P.

    2010-01-01

    In the conditions of the Republic of Belarus there were presented data about the influence of technological factors on entry of 137Cs into plant products (grain and green mass). In course of the study there were analyzed the following variants of soil cultivation: moldboard plowing; subsurface chisel soil tillage; subsurface surface soil tillage; minimal tillage. There were presented data on specific activity of 137Cs in plant product samples of oat (Avena sativa) grain; field pea (Pisum arvense L.) and oat mixture grain and green mass; wheat (Triticum aestivum) grain. There were determined the main principles of influence of cultivation systems of sod-podzolic sandy loam soil with different degree of humidity on transition of 137Cs into plants depending on the degree of soil and crop humidity. On the automorphic soil there was revealed a tendency of increased transition of 137Cs into grain and green mass after application of subsurface surface soil tillage system

  8. Pseudo-Jahn-Teller Distortion in Two-Dimensional Phosphorus: Origin of Black and Blue Phases of Phosphorene and Band Gap Modulation by Molecular Charge Transfer.

    Science.gov (United States)

    Chowdhury, Chandra; Jahiruddin, Sheik; Datta, Ayan

    2016-04-07

    Phosphorene (Pn) is stabilized as a layered material like graphite, yet it possess a natural direct band gap (Eg = 2.0 eV). Interestingly, unlike graphene, Pn exhibits a much richer phase diagram which includes distorted forms like the stapler-clip (black Pn, α form) and chairlike (blue Pn, β form) structures. The existence of these phases is attributed to pseudo-Jahn-Teller (PJT) instability of planar hexagonal P6(6-) rings. In both cases, the condition for vibronic instability of the planar P6(6-) rings is satisfied. Doping with electron donors like tetrathiafulvalene and tetraamino-tetrathiafulvalene and electron acceptors like tetracyanoquinodimethane and tetracyanoethylene convert blue Pn into N-type and black Pn into efficient P-type semiconductors, respectively. Interestingly, pristine blue Pn, an indirect gap semiconductor, gets converted into a direct gap semiconductor on electron or hole doping. Because of comparatively smaller undulation in blue Pn (with respect to black Pn), the van der Waals interactions between the dopants and blue Pn is stronger. PJT distortions for two-dimensional phosphorus provides a unified understanding of structural features and chemical reactivity in its different phases.

  9. Vibronic coupling in molecular crystals: A Franck-Condon Herzberg-Teller model of H-aggregate fluorescence based on quantum chemical cluster calculations

    Energy Technology Data Exchange (ETDEWEB)

    Wykes, M., E-mail: mikewykes@gmail.com; Parambil, R.; Gierschner, J. [Madrid Institute for Advanced Studies, IMDEA Nanoscience, Calle Faraday 9, Campus Cantoblanco, 28049 Madrid (Spain); Beljonne, D. [Laboratory for Chemistry of Novel Materials, University of Mons, Place du Parc 20, 7000 Mons (Belgium)

    2015-09-21

    Here, we present a general approach to treating vibronic coupling in molecular crystals based on atomistic simulations of large clusters. Such clusters comprise model aggregates treated at the quantum chemical level embedded within a realistic environment treated at the molecular mechanics level. As we calculate ground and excited state equilibrium geometries and vibrational modes of model aggregates, our approach is able to capture effects arising from coupling to intermolecular degrees of freedom, absent from existing models relying on geometries and normal modes of single molecules. Using the geometries and vibrational modes of clusters, we are able to simulate the fluorescence spectra of aggregates for which the lowest excited state bears negligible oscillator strength (as is the case, e.g., ideal H-aggregates) by including both Franck-Condon (FC) and Herzberg-Teller (HT) vibronic transitions. The latter terms allow the adiabatic excited state of the cluster to couple with vibrations in a perturbative fashion via derivatives of the transition dipole moment along nuclear coordinates. While vibronic coupling simulations employing FC and HT terms are well established for single-molecules, to our knowledge this is the first time they are applied to molecular aggregates. Here, we apply this approach to the simulation of the low-temperature fluorescence spectrum of para-distyrylbenzene single-crystal H-aggregates and draw comparisons with coarse-grained Frenkel-Holstein approaches previously extensively applied to such systems.

  10. An EPR investigation of the dynamic Jahn-Teller effect in SrCl2:y(2 plus) and SrCl2:Sc(2 plus)

    Science.gov (United States)

    Herrington, J. R.; Estle, T. L.; Boatner, L. A.

    1972-01-01

    EPR spectra have been observed for SrCl2:Y(2+) and SrCl2:Sc(2+) at liquid helium temperatures. At 1.2 K the spectra were dominated by anisotropic hyperfine patterns whose lineshapes and angular dependences were explained using second order solutions of the effective Hamiltonian for an isolated 2Eg state split by large random internal strains. Pronounced asymmetries in some of the strin produced lineshapes for Srcl2:Sc(2+) are shown to result from second order terms in the solution of the effective Hamiltonian. Coexisting with the anisotropic hyperfine patterns are weak nearly isotropic hyperfine patterns with typical lineshapes. Variations in the apparent intensity of lines in these weak hyperfine patterns as functions of the applied magnetic field direction and temperature imply that these lines result from averaging by vibronic relaxation of a portion of the anisotropic pattern. The effective Hamiltonian parameters for SrCl2:La(2+), SrCl2:y(2+), and SrCl2:SC(2+) are analyzed in terms of crystal field theory modified to include a dynamic Jahn-Teller effect.

  11. Bcc and Fcc transition metals and alloys: a central role for the Jahn-Teller effect in explaining their ideal and distorted structures.

    Science.gov (United States)

    Lee, Stephen; Hoffmann, Roald

    2002-05-01

    Transition metal elements, alloys, and intermetallic compounds often adopt the body centered cubic (bcc) and face centered cubic (fcc) structures. By comparing quantitative density functional with qualitative tight-binding calculations, we analyze the electronic factors which make the bcc and fcc structures energetically favorable. To do so, we develop a tight-binding function, DeltaE(star), a function that measures the energetic effects of transferring electrons within wave vector stars. This function allows one to connect distortions in solids to the Jahn-Teller effect in molecules and to provide an orbital perspective on structure determining deformations in alloys. We illustrate its use by considering first a two-dimensional square net. We then turn to three-dimensional fcc and bcc structures, and distortions of these. Using DeltaE(star), we rationalize the differences in energy of these structures. We are able to deduce which orbitals are responsible for instabilities in seven to nine valence electron per atom (e(-)/a) bcc systems and five and six e(-)/a fcc structures. Finally we demonstrate that these results account for the bcc and fcc type structures found in both the elements and binary intermetallic compounds of group 4 through 9 transition metal atoms. The outline of a theory of metal structure deformations based on loss of point group operation rather than translational symmetry is presented.

  12. Electromagnetic dipole and Gamow-Teller responses of even and odd {sup 90-94}{sub 40}Zr isotopes in QRPA calculations with the D1M Gogny force

    Energy Technology Data Exchange (ETDEWEB)

    Deloncle, I. [CSNSM, CNRS et Universite Paris-Sud, Orsay (France); CEA, DAM, DIF, Arpajon (France); Peru, S. [CEA, DAM, DIF, Arpajon (France); Martini, M. [ESNT, CEA-Saclay, DSM, Irfu, Service de Physique Nucleaire, Gif-sur-Yvette (France)

    2017-08-15

    In this paper we present theoretical results on the dipole response in the proton spin-saturated {sup 90-94}Zr isotopes. The electric and magnetic dipole excitations are obtained in Hartree-Fock-Bogolyubov plus Quasi-particle Random Phase Approximation (QRPA) calculations performed with the D1M Gogny force. A pnQRPA charge exchange code is used to study the Gamow-Teller response. The results on the pygmy, the giant dipole resonances as well as those on the magnetic nuclear spin-flip excitation and the Gamow-Teller transitions are compared with available experimental or theoretical information. In our approach, the proton pairing plays a role in the phonon excitations, in particular in the M1 nuclear spin-flip resonance. (orig.)

  13. Corrections to the free-nucleon values of the single-particle matrix elements of the M1 and Gamow-Teller operators, from a comparison of shell-model predictions with sd-shell data

    International Nuclear Information System (INIS)

    Brown, B.A.; Wildenthal, B.H.

    1983-01-01

    The magnetic dipole moments of states in mirror pairs of the sd-shell nuclei and the strengths of the Gamow-Teller beta decays which connect them are compared with predictions based on mixed-configuration shell-model wave functions. From this analysis we extract the average effective values of the single-particle matrix elements of the l, s, and [Y/sup( 2 )xs]/sup( 1 ) components of the M1 and Gamow-Teller operators acting on nucleons in the 0d/sub 5/2/, 1s/sub 1/2/, and 0d/sub 3/2/ orbits. These results are compared with the recent calculations by Towner and Khanna of the corrections to the free-nucleon values of these matrix elements which arise from the effects of isobar currents, mesonic-exchange currents, and mixing with configurations outside the sd shell

  14. Jahn-Teller glass formation in beta-lithium ammonium sulfate monocrystals studied by means of the electron paramagnetic resonance of Mn sup 2 sup + and Cu sup 2 sup + ions

    CERN Document Server

    Waplak, S

    2002-01-01

    The EPR (electron paramagnetic resonance) spectra of non-Jahn-Teller (JT) Mn sup 2 sup + and JT Cu sup 2 sup + ions have been studied for alpha- or beta-LAS structure modification in the temperature range of 4.2-480 K. The experimental evidence for JT glass with frozen-in random strain fields due to the presence of the JT Cu sup 2 sup + ions is presented.

  15. Case Study: OpenSSL 2012 Validation

    Science.gov (United States)

    2013-08-01

    there are probably millions of users who are impacted directly, and hundreds of millions who are indirectly affected. Cryptographic libraries are...UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESSES 8. PERFORMING ORGANIZATION REPORT NUMBER D-4991 H13 -001174 Institute for Defense

  16. Improvement in the water retention characteristics of sandy loam soil using a newly synthesized poly(acrylamide-co-acrylic acid)/AlZnFe2O4 superabsorbent hydrogel nanocomposite material.

    Science.gov (United States)

    Shahid, Shaukat Ali; Qidwai, Ansar Ahmad; Anwar, Farooq; Ullah, Inam; Rashid, Umer

    2012-08-03

    The use of some novel and efficient crop nutrient-based superabsorbent hydrogel nanocomposites (SHNCs), is currently becoming increasingly important to improve the crop yield and productivity, due to their water retention properties. In the present study a poly(Acrylamide-co-acrylic acid)/AlZnFe2O4 superabsorbent hydrogel nanocomposite was synthesized and its physical properties characterized using Energy Dispersive X-ray (EDX), FE-SEM and FTIR spectroscopic techniques. The effects of different levels of SHNC were studied to evaluate the moisture retention properties of sandy loam soil (sand 59%, silt 21%, clay 19%, pH 7.4, EC 1.92 dS/m). The soil amendment with 0.1, 0.2, 0.3 and 0.4 w/w% of SHNC enhanced the moisture retention significantly at field capacity compared to the untreated soil. Besides, in a separate experiment, seed germination and seedling growth of wheat was found to be notably improved with the application of SHNC. A delay in wilting of seedlings by 5-8 days was observed for SHNC-amended soil, thereby improving wheat plant growth and establishment.

  17. Measurement of effective analyzing powers for the NTOF polarimeter at LAMPF and DLL(0 degree) for Gamow-Teller transitions in p-shell nuclei

    International Nuclear Information System (INIS)

    Mercer, D.J.

    1993-01-01

    Measurements of neutron polarization from (rvec p,rvec n) reactions can provide valuable clues toward understanding the isovector nucleon-nucleus interaction. A neutron time-of-flight polarimeter has been constructed at the Los Alamos Meson Physics Facility to perform such measurements, but before the polarimeter can be used, its effective analyzing powers must be determined. This is accomplished by using the 14 C(rvec p,rvec n) 14 N reaction at a bombarding energy of 494 MeV to produce a beam of neutrons with known polarization, illuminating the detector with these neutrons, and measuring the azimuthal asymmetries after scattering from a hydrogenous analyzer fluid within the detector. Secondary measurements are made using the 2 H(rvec p,rvec n) 2 p reaction with bombarding energies of 318 and 494 MeV to produce a polarized neutron beam. The results from (rvec np) analyzing reactions within the detector agree with values anticipated from free nucleon-nucleon analyzing powers, but the results from (rvec np) analyzing reactions display a more than 33% reduction from the anticipated values. Additionally, measurements are made of the polarization transfer coefficient D LL (0 degree) for rvec p,rvec n Gamow-Teller reactions on 2 H, 7 Li 12 C, and 14 C targets. For a purely central interaction, one would expect that D LL (0 degree) ∼ -1/3 in the plane wave limit, but a simple average of the Jπ = 0 + → 1 + results at a bombardment energy of 494 MeV gives D LL (0 degree) = -0.689 ± 0.044. Thus, the measurements indicate that the nucleon-nucleus interaction -- which is largely central at 200 MeV -- has strong tensor contributions at higher energy

  18. Walén test and de Hoffmann-Teller frame of interplanetary large-amplitude Alfvén waves

    International Nuclear Information System (INIS)

    Chao, J. K.; Hsieh, Wen-Chieh; Lee, L. C.; Yang, L.

    2014-01-01

    In this study, three methods of analysis are compared to test the Walén relation. Method 1 requires a good de Hoffmann-Teller (HT) frame. Method 2 uses three components separately to find the frame that is slightly modified from Method 1. This method is intended to improve the accuracy of the HT frame and able to demonstrate the anisotropic property of the fluctuations. The better the relation is, the closer the slope of a regression fitting the data of plasma versus Alfvén velocities is to 1. However, this criterion is based on an average HT frame, and the fitted slope does not always work for the Walén test because the HT frame can change so fast in the high-speed streams. We propose Method 3 to check the Walén relation using a sequence of data generated by taking the difference of two consecutive values of plasma and Alfvén velocities, respectively. The difference data are independent of the HT frame. We suggest that the ratio of the variances between plasma and Alfvén velocities is a better parameter to qualify the Walén relation. Four cases in two solar wind streams are studied using these three methods. Our results show that when the solar wind HT frame remains stable, all three methods can predict Alfvénic fluctuations well, but Method 3 can better predict the Walén relation when solar wind contains structures with several small streams. A simulated case also demonstrates that Method 3 is better and more robust than Methods 1 and 2. These results are important for a better understanding of Alfvénic fluctuations and turbulence in the solar wind.

  19. Density functional theory study on Herzberg-Teller contribution in Raman scattering from 4-aminothiophenol-metal complex and metal-4-aminothiophenol-metal junction

    Science.gov (United States)

    Liu, Shasha; Zhao, Xiuming; Li, Yuanzuo; Zhao, Xiaohong; Chen, Maodu

    2009-06-01

    Density functional theory (DFT) and time-dependent DFT calculations have been performed to investigate the Raman scattering spectra of metal-molecule complex and metal-molecule-metal junction architectures interconnected with 4-aminothiophenol (PATP) molecule. The simulated profiles of normal Raman scattering (NRS) spectra for the two complexes (Ag2-PATP and PATP-Au2) and the two junctions (Ag2-PATP-Au2 and Au2-PATP-Ag2) are similar to each other, but exhibit obviously different Raman intensities. Due to the lager static polarizabilities of the two junctions, which directly influence the ground state chemical enhancement in NRS spectra, the calculated normal Raman intensities of them are stronger than those of two complexes by the factor of 102. We calculate preresonance Raman scattering (RRS) spectra with incident light at 1064 nm, which is much lower than the S1 electronic transition energy of complexes and junctions. Ag2-PATP-Au2 and Au2-PATP-Ag2 junctions yield higher Raman intensities than those of Ag2-PATP and PATP-Au2 complexes, especially for b2 modes. This effect is mainly attributed to charge transfer (CT) between the metal gap and the PAPT molecule which results in the occurrence of CT resonance enhancement. The calculated pre-RRS spectra strongly depend on the electronic transition state produced by new structures. With excitation at 514.5 nm, the calculated pre-RRS spectra of two complexes and two junctions are stronger than those of with excitation at 1064 nm. A charge difference densities methodology has been used to visually describe chemical enhancement mechanism of RRS spectrum. This methodology aims at visualizing intermolecular CT which provides direct evidence of the Herzberg-Teller mechanism.

  20. Off-centre dynamic Jahn-Teller effect studied by electron spin relaxation of Cu2+ ions in SrF2 crystal

    International Nuclear Information System (INIS)

    Hoffmann, S.K.

    2000-01-01

    Temperature cw-EPR and pulsed EPR electron spin echo experiments were performed for a low concentration of Cu 2+ ions in cubic SrF 2 crystals. The well resolved EPR spectrum at low temperatures (below 30 K) with parameters g parallel = 2.493, g perpendicular = 2.083, A parallel = 121, A perpendicular = 8.7, A parallel ( 19 F) = 135, A parallel ( 19 F) = 33.0 (A-values in 10 -4 cm -1 ) is transformed continuously into a single broad line above 225 K on heating, due to the g-factor shift and EPR line broadening. These data along with the angular variation EPR data are described in terms of a pseudo-Jahn-Teller effect of (T 2g +A 2u )x(a 1g +e g +t 1u ) type producing six off-centre positions of the Cu 2+ ion in the fluorine cube. Above 30 K a two-step averaging g -factor process occurs and is governed by vibronic dynamics between potential wells of the off-centre positions. This dynamics governs the electron spin relaxation in the whole temperature range. The electron spin-lattice relaxation rate 1/T 1 grows rapidly by six orders of magnitude in the temperature range 30-100 K and is determined by the Orbach-type process with excitations to two excited vibronic levels of energy 83 and 174 cm -1 . For higher temperatures the relaxation is dominated by overbarrier jumps leading to the isotropic EPR spectrum above 225 K. The phase memory time T M has the rigid lattice value 3.5 μs determined by nuclear spectral diffusion and its temperature variation is governed by the vibronic dynamics indicating that the excitations between vibronic levels produce a dephasing of the electron spin precessional motion. (author)

  1. Variation of the Jahn-Teller distortion with pressure in the layered perovskite Rb{sub 2}CuCl{sub 4}: local and crystal compressibilities

    Energy Technology Data Exchange (ETDEWEB)

    Aguado, F [DCITIMAC, Facultad de Ciencias, Universidad de Cantabria, Santander 39005 (Spain); RodrIguez, F [DCITIMAC, Facultad de Ciencias, Universidad de Cantabria, Santander 39005 (Spain); Valiente, R [Departamento de Fisica Aplicada, Universidad de Cantabria, Santander 39005 (Spain); Hanfland, M [ESRF, BP220, 156 rue des Martires, 38043 Grenoble Cedex (France); Itie, J P [Universite Pierre et Marie Curie, B77 4 Place Jussieu 75252 Paris Cedex 05 (France)

    2007-08-29

    This work investigates the effect of pressure on the Jahn-Teller distortion (JTD) associated with the axially elongated CuCl{sub 6} octahedra in the A{sub 2}CuCl{sub 4} perovskite layer (A: Rb, CH{sub 3}NH{sub 3}, C{sub 2}H{sub 5}NH{sub 3}, C{sub 3}H{sub 7}NH{sub 3}). The aim is to elucidate whether pressure favours disappearance of the JTD in the antiferrodistortive (AFD) structure exhibited by Cu{sup 2+} within the layers or whether it induces tilts of the CuCl{sub 6} octahedra preserving the molecular distortion associated with the JT effect. We have carried out x-ray absorption (XAS) and x-ray diffraction (XRD) experiments under pressure along the compound series, whose interlayer distances at ambient pressure vary from 7.77 to 12.33 A. The use of both XAS and XRD techniques allows us a complete local- and crystal-structure characterization in Rb{sub 2}CuCl{sub 4} as a function of pressure in the 0-16 GPa range. We show that pressure reduces the axial (long) and equatorial (short) Cu-Cl distances, R{sub ax} and R{sub eq}, as well as the intralayer and interlayer Cu-Cu distances, d{sub Cu-Cu} and d{sub inter}. Interestingly, the variation of R{sub ax} is an order of magnitude bigger than that of the corresponding R{sub eq}, yielding a reduction of the JTD. However, no evidence of JTD suppression has been observed below 16 GPa. Pressure-induced CuCl{sub 6} tilting preserves the JTD in a wide pressure range. Estimates based on structural data suggest that JT suppression would occur at about 40 GPa.

  2. Variation of the Jahn-Teller distortion with pressure in the layered perovskite Rb2CuCl4: local and crystal compressibilities

    International Nuclear Information System (INIS)

    Aguado, F; RodrIguez, F; Valiente, R; Hanfland, M; Itie, J P

    2007-01-01

    This work investigates the effect of pressure on the Jahn-Teller distortion (JTD) associated with the axially elongated CuCl 6 octahedra in the A 2 CuCl 4 perovskite layer (A: Rb, CH 3 NH 3 , C 2 H 5 NH 3 , C 3 H 7 NH 3 ). The aim is to elucidate whether pressure favours disappearance of the JTD in the antiferrodistortive (AFD) structure exhibited by Cu 2+ within the layers or whether it induces tilts of the CuCl 6 octahedra preserving the molecular distortion associated with the JT effect. We have carried out x-ray absorption (XAS) and x-ray diffraction (XRD) experiments under pressure along the compound series, whose interlayer distances at ambient pressure vary from 7.77 to 12.33 A. The use of both XAS and XRD techniques allows us a complete local- and crystal-structure characterization in Rb 2 CuCl 4 as a function of pressure in the 0-16 GPa range. We show that pressure reduces the axial (long) and equatorial (short) Cu-Cl distances, R ax and R eq , as well as the intralayer and interlayer Cu-Cu distances, d Cu-Cu and d inter . Interestingly, the variation of R ax is an order of magnitude bigger than that of the corresponding R eq , yielding a reduction of the JTD. However, no evidence of JTD suppression has been observed below 16 GPa. Pressure-induced CuCl 6 tilting preserves the JTD in a wide pressure range. Estimates based on structural data suggest that JT suppression would occur at about 40 GPa

  3. Gamow-Teller strength distributions in 76Ge, 76,82Se, and 90,92Zr by the deformed proton-neutron QRPA

    Science.gov (United States)

    Ha, Eunja; Cheoun, Myung-Ki

    2015-02-01

    The deformed proton-neutron quasiparticle random phase approximation (QRPA) has been developed and applied to evaluate Gamow-Teller (GT) transition strength distributions, including high-lying excited states. The data of high-lying excited states are recently available beyond one or two nucleon threshold by charge exchange reactions using hundreds of MeV projectiles. Our calculations started with single-particle states calculated using a deformed, axially symmetric Woods-Saxon potential. The neutron-neutron and proton-proton pairing correlations are explicitly taken into account at the deformed Bardeen-Cooper-Schriffer theory. Additionally, the ground state correlations and two-particle and two-hole mixing states were included in the deformed QRPA. In this work, we used a realistic two-body interaction, given by the Brueckner G-matrix based on the CD Bonn potential to reduce the ambiguity on the nucleon-nucleon interactions inside nuclei. We applied our formalism to the GT transition strengths for 76Ge, 76,82Se, and 90,92Zr, and compared the results with the available experimental data. The GT strength distributions were sensitive to the deformation parameter as well as its sign, i.e., oblate or prolate. The Ikeda sum rule, which is usually thought to be satisfied under the one-body current approximation, regardless of nucleon models, was used to test our numerical calculations and shown to be satisfied without introducing the quenching factor, if high-lying GT excited states were properly taken into account. Most of the GT strength distributions of the nuclei considered in this work have the high-lying GT excited states beyond one-nucleon threshold, which are shown to be consistent with the available experimental data.

  4. Eu/RG absorption and excitation spectroscopy in the solid rare gases: state dependence of crystal field splitting and Jahn-Teller coupling.

    Science.gov (United States)

    Byrne, Owen; McCaffrey, John G

    2011-03-28

    Absorption spectroscopy recorded for annealed samples of matrix-isolated atomic europium reveals a pair of thermally stable sites in Ar and Kr while a single site exists in Xe. Plots of the matrix shifts of the visible s → p bands versus host polarizability, allowed the association of the single site in Xe and the blue sites in Ar and Kr. On the basis of the similar ground state bond lengths expected for the Eu-rare gas (RG) diatomics and the known Na-RG molecules, the blue sites are attributed to Eu occupancy in the smaller tetra-vacancy while the red sites are proposed to arise from hexa-vacancy sites. Both sites are of cubic symmetry, consistent with the pronounced Jahn-Teller structure present on the y(8)P ← a(8)S(7/2) transition for these bands in the three hosts studied. Site-selective excitation spectroscopy has been used to reanalyze complex absorption spectra previously published by Jakob et al. [Phys. Lett. A 57, 67 (1976)] for the near-UV f → d transitions. On the basis that a pair of thermally stable sites exist in solid argon, the occurrence of crystal field splitting has been identified to occur for the J ≥ 5/2 level of the (8)P state when isolated in these two sites with cubic symmetry. From a detailed lineshape analysis, the magnitude of the crystal field splittings on the J = 5/2 level in Ar is found to be 105 and 123 cm(-1) for the red and blue sites, respectively.

  5. Geochemical reanalysis of historical U.S. Geological Survey sediment samples from the Kougarok area, Bendeleben and Teller quadrangles, Seward Peninsula, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Granitto, Matthew; Azain, Jaime S.

    2015-01-01

    The State of Alaska’s Strategic and Critical Minerals (SCM) Assessment project, a State-funded Capital Improvement Project (CIP), is designed to evaluate Alaska’s statewide potential for SCM resources. The SCM Assessment is being implemented by the Alaska Division of Geological & Geophysical Surveys (DGGS), and involves obtaining new airborne-geophysical, geological, and geochemical data. As part of the SCM Assessment, thousands of historical geochemical samples from DGGS, U.S. Geological Survey (USGS), and U.S. Bureau of Mines archives are being reanalyzed by DGGS using modern, quantitative, geochemical-analytical methods. The objective is to update the statewide geochemical database to more clearly identify areas in Alaska with SCM potential. The USGS is also undertaking SCM-related geologic studies in Alaska through the federally funded Alaska Critical Minerals cooperative project. DGGS and USGS share the goal of evaluating Alaska’s strategic and critical minerals potential and together created a Letter of Agreement (signed December 2012) and a supplementary Technical Assistance Agreement (#14CMTAA143458) to facilitate the two agencies’ cooperative work. Under these agreements, DGGS contracted the USGS in Denver to reanalyze historical USGS sediment samples from Alaska. For this report, DGGS funded reanalysis of 302 historical USGS sediment samples from the statewide Alaska Geochemical Database Version 2.0 (AGDB2; Granitto and others, 2013). Samples were chosen from the Kougarok River drainage as well as smaller adjacent drainages in the Bendeleben and Teller quadrangles, Seward Peninsula, Alaska (fig. 1). The USGS was responsible for sample retrieval from the National Geochemical Sample Archive (NGSA) in Denver, Colorado through the final quality assurance/quality control (QA/QC) of the geochemical analyses obtained through the USGS contract lab. The new geochemical data are published in this report as a coauthored DGGS report, and will be incorporated

  6. Isospin symmetry of Tz =±3/2→±1/2 Gamow-Teller transitions in A=41 nuclei

    Science.gov (United States)

    Fujita, Y.; Shimbara, Y.; Adachi, T.; Berg, G. P.; Brown, B. A.; Fujita, H.; Hatanaka, K.; Kamiya, J.; Nakanishi, K.; Sakemi, Y.; Sasaki, S.; Shimizu, Y.; Tameshige, Y.; Uchida, M.; Wakasa, T.; Yosoi, M.

    2004-11-01

    Under the assumption that isospin T is a good quantum number, isobaric analog states and various analogous transitions are expected in isobars with mass number A . The strengths of Tz =±3/2→±1/2 analogous Gamow-Teller (GT) transitions and analogous M1 transitions within the A=41 isobar quartet are compared in detail. The Tz =+3/2→+1/2 GT transitions from the Jπ = 3/2+ ground state of 41K leading to excited Jπ = 1/2+ , 3/2+ , and 5/2+ states in 41Ca were measured using the ( 3He ,t) charge-exchange reaction. With a high energy resolution of 35 keV , many fragmented states were observed, and the GT strength distribution was determined up to 10 MeV excitation energy ( Ex ) . The main part of the strength was concentrated in the Ex =4 6 MeV region. A shell-model calculation could reproduce the concentration, but not so well details of the strength distribution. The obtained distribution was further compared with two results of 41Ti β decay studying the analogous Tz =-3/2→-1/2 GT strengths. They reported contradicting distributions. One-to-one correspondences of analogous transitions and analog states were assigned up to Ex =6 MeV in the comparison with one of these 41Ti β -decay results. Combining the spectroscopic information of the analog states in 41Ca and 41Sc , the most probable Jπ values were deduced for each pair of analog states. It was found that 5/2+ states carry the main part of the observed GT strength, while much less GT strength was carried by 1/2+ and 3/2+ states. The gross features of the GT strength distributions for each J were similar for the isospin analogous Tz =±3/2→±1/2 transitions, but the details were somewhat different. From the difference of the distributions, isospin-asymmetry matrix elements of ≈8 keV were deduced. The Coulomb displacement energy, which is sensitive to the configuration of states, showed a sudden increase of about 50 keV at the excitation energy of 3.8 MeV . The strengths of several M1 transitions to the

  7. Uranium Hydrogeochemical and Stream Sediment Reconnaissance data from the area of the Teller, Bendeleben, Candle, and Kateel River Quadrangles, Seward Peninsula and vicinity, Alaska

    International Nuclear Information System (INIS)

    Sharp, R.R. Jr.; Hill, D.E.

    1978-05-01

    During July-August 1976, 2026 natural waters and 2085 bottom sediments were collected from 2209 sample locations (at a nominal density of one location each 23 km 2 ) on streams and small lakes throughout the Teller, Bendeleben, Candle, and western one-third of the Kateel River NTMS quadrangles, Alaska. Total uranium was measured in the waters by fluorometry and in the sediments and a few waters by delayed-neutron counting. The uranium content of the waters ranged from below the detection limit of 0.02 parts per billion (ppB) to a high of 14.50 ppB, averaging 0.44 ppB, and that of the sediments ranged from a low of 0.2 parts per million (ppM) to a high of 107.4 ppM, averaing 3.93 ppM. The uranium data for water and sediment are separately presented--as computer listings that include pertinent field measurements from each location, as graphically portrayed concentration overlays at 1:250,000 scale for each quadrangle, and as reduced figures showing contours drawn at various concentration levels for each quadrangle--and their areal distributions are compared and correlated with the known features and uranium showings. A test of increasingly detailed methods of data evaluation shows that the more extensive the evaluation, the more useful the reconnaissance uranium data are likely to be. The validity and potential usefulness of the HSSR uranium data are conclusively substantiated by the fact that evidence of all 23 of the reported uranium showings in the 50,000-km 2 study area can be discerned. Several new locations of interest for further field investigation are identified in each of the quadrangles, and most notably in the Bendeleben Mountains. However, the data presented would appear equally useful in guiding field investigation around the uranium occurrences already known, as noteworthy samples often come from close by but on tributary drainages adjacent, opposite, or above them

  8. Gamow-Teller response in the configuration space of a density-functional-theory-rooted no-core configuration-interaction model

    Science.gov (United States)

    Konieczka, M.; Kortelainen, M.; Satuła, W.

    2018-03-01

    Background: The atomic nucleus is a unique laboratory in which to study fundamental aspects of the electroweak interaction. This includes a question concerning in medium renormalization of the axial-vector current, which still lacks satisfactory explanation. Study of spin-isospin or Gamow-Teller (GT) response may provide valuable information on both the quenching of the axial-vector coupling constant as well as on nuclear structure and nuclear astrophysics. Purpose: We have performed a seminal calculation of the GT response by using the no-core configuration-interaction approach rooted in multireference density functional theory (DFT-NCCI). The model treats properly isospin and rotational symmetries and can be applied to calculate both the nuclear spectra and transition rates in atomic nuclei, irrespectively of their mass and particle-number parity. Methods: The DFT-NCCI calculation proceeds as follows: First, one builds a configuration space by computing relevant, for a given physical problem, (multi)particle-(multi)hole Slater determinants. Next, one applies the isospin and angular-momentum projections and performs the isospin and K mixing in order to construct a model space composed of linearly dependent states of good angular momentum. Eventually, one mixes the projected states by solving the Hill-Wheeler-Griffin equation. Results: The method is applied to compute the GT strength distribution in selected N ≈Z nuclei including the p -shell 8Li and 8Be nuclei and the s d -shell well-deformed nucleus 24Mg. In order to demonstrate a flexibility of the approach we present also a calculation of the superallowed GT β decay in doubly-magic spherical 100Sn and the low-spin spectrum in 100In. Conclusions: It is demonstrated that the DFT-NCCI model is capable of capturing the GT response satisfactorily well by using a relatively small configuration space, exhausting simultaneously the GT sum rule. The model, due to its flexibility and broad range of applicability, may

  9. Pseudo Jahn–Teller effect in distortion and restoration of planar configurations of tetra-heterocyclic 1,2-diazetes C{sub 2}N{sub 2}E{sub 4}, E = H, F, Cl, Br

    Energy Technology Data Exchange (ETDEWEB)

    Ilkhani, Ali R. [Institute for Theoretical Chemistry, University of Texas at Austin, Austin, TX 78712 (United States); Department of Chemistry, Yazd Branch, Islamic Azad University, Yazd (Iran, Islamic Republic of); Gorinchoy, Natalia N. [Institute of Chemistry, Academy of Sciences of Moldova, Chisinau, Republic of Moldova (Moldova, Republic of); Bersuker, Isaac B., E-mail: bersuker@cm.utexas.edu [Institute for Theoretical Chemistry, University of Texas at Austin, Austin, TX 78712 (United States); Institute of Chemistry, Academy of Sciences of Moldova, Chisinau, Republic of Moldova (Moldova, Republic of)

    2015-10-16

    Highlights: • The pseudo Jahn–Teller mechanism of puckering of tetracyclic 1,2-diazetes is revealed. • Vibronic constants are extracted from ab initio calculations versus PJTE equations. • Methods of restoring the planar configuration by external perturbations are suggested. - Abstract: The pseudo Jahn–Teller effect (PJTE) is employed to explain the origin of the puckered structures of tetra-heterocyclic 1,2-diazetes, C{sub 2}N{sub 2}E{sub 4}, E = H, F, Cl, Br, and to reveal the conditions of restoration of their planar configuration. The high-symmetry C{sub 2v} planar configuration of all these compounds is unstable with respect to puckering, a{sub 2}-type distortions produced by the PJT coupling between their ground {sup 1}A{sub 1} and excited {sup 1}A{sub 2} electronic states. The PJTE coupling constants are estimated by fitting ab initio calculated energy profiles to the formulas of the vibronic coupling problem (A{sub 1} + A{sub 2}) ⊗ a{sub 2}. The conditions for the restoration of the planar configurations of the C{sub 2}N{sub 2}E{sub 4} cycles were revealed: the PJTE can be quenched by removing the outer two electrons, e.g. by producing a “triple-decker sandwich” structure with two electron acceptors on both sides of the neutral cycle.

  10. High-lying Gamow-Teller excited states in the deformed nuclei,76Ge,82Se and N = 20 nuclei in the island of inversion by the Deformed QRPA (DQRPA)

    Science.gov (United States)

    Cheoun, Myung-Ki; Ha, Eunja

    2013-07-01

    With the advent of high analysis technology in detecting the Gamow-Teller (GT) excited states beyond one nucleon emission threshold, the quenching of the GT strength to the Ikeda sum rule (ISR) seems to be recovered by the high-lying (HL) GT states. We address that these HL GT excited states result from the smearing of the Fermi surface by the increase of the chemical potential owing to the deformation within a framework of the deformed quasi-particle random phase approximation (DQRPA). Detailed mechanism leading to the smearing is discussed, and comparisons to the available experimental data on 76Ge,82Se and N = 20 nuclei are shown to explain the strong peaks on the HL GT excited states.

  11. High-lying Gamow-Teller excited states in the deformed nuclei,76Ge,82Se and N = 20 nuclei in the island of inversion by the Deformed QRPA (DQRPA)

    International Nuclear Information System (INIS)

    Cheoun, Myung-Ki; Ha, Eunja

    2013-01-01

    With the advent of high analysis technology in detecting the Gamow-Teller (GT) excited states beyond one nucleon emission threshold, the quenching of the GT strength to the Ikeda sum rule (ISR) seems to be recovered by the high-lying (HL) GT states. We address that these HL GT excited states result from the smearing of the Fermi surface by the increase of the chemical potential owing to the deformation within a framework of the deformed quasi-particle random phase approximation (DQRPA). Detailed mechanism leading to the smearing is discussed, and comparisons to the available experimental data on 76 Ge, 82 Se and N = 20 nuclei are shown to explain the strong peaks on the HL GT excited states

  12. Approximate analytical solution of the Dirac equation for pseudospin symmetry with modified Po schl-Teller potential and trigonometric Scarf II non-central potential using asymptotic iteration method

    International Nuclear Information System (INIS)

    Pratiwi, B N; Suparmi, A; Cari, C; Yunianto, M; Husein, A S

    2016-01-01

    We apllied asymptotic iteration method (AIM) to obtain the analytical solution of the Dirac equation in case exact pseudospin symmetry in the presence of modified Pcischl- Teller potential and trigonometric Scarf II non-central potential. The Dirac equation was solved by variables separation into one dimensional Dirac equation, the radial part and angular part equation. The radial and angular part equation can be reduced into hypergeometric type equation by variable substitution and wavefunction substitution and then transform it into AIM type equation to obtain relativistic energy eigenvalue and wavefunctions. Relativistic energy was calculated numerically by Matlab software. And then relativistic energy spectrum and wavefunctions were visualized by Matlab software. The results show that the increase in the radial quantum number n_r causes decrease in the relativistic energy spectrum. The negative value of energy is taken due to the pseudospin symmetry limit. Several quantum wavefunctions were presented in terms of the hypergeometric functions. (paper)

  13. Field performance of three real-time moisture sensors in sandy loam and clay loam soils

    Science.gov (United States)

    The study was conducted to evaluate HydraProbe (HyP), Campbell Time Domain Reflectometry (TDR) and Watermarks (WM) moisture sensors for their ability to estimate water content based on calibrated neutron probe measurements. The three sensors were in-situ tested under natural weather conditions over ...

  14. High-resolution study of the Gamow-Teller strength distribution in the light nuclei 9B and 13N using the (3He,t) charge-exchange reaction at 420 MeV beam energy

    International Nuclear Information System (INIS)

    Scholl, Clemens

    2010-01-01

    Excited states in the light nuclei 9 B and 13 C were studied using the ( 3 He,t) charge-exchange reaction on 9 Be and 13 C targets. The measurements were performed at the research center for nuclear physics (RCNP) in Osaka, Japan, using the magnetic spectrometer Grand Raiden and the dispersive WS course. The 3 He beam with an energy of 420 MeV was accelerated by the RCNP Ring Cyclotron. The Grand Raiden spectrometer and the WS course allow to study the ( 3 He,t) charge-exchange reaction with an energy resolution of around 30 keV, which is one order of magnitude better than measurements with the (p,n) charge-exchange reaction. The high resolution allows to better separate individual states and to determine weak excitation strengths because of low background in the spectra. A total of 19 states in 13 N were studied, and a total of 20 states were observed in 9 B. Of these, 9 states in 13 C and 10 states in 9 B were identified as being excited by a Gamow-Teller transition. Charge-exchange reactions are related to beta-decay, and at zero momentum transfer a simple proportionality exists between the cross-section of the charge-exchange experiment and the Fermi (F) or Gamow-Teller (GT) beta-decay strength. While the Fermi strength B(F) is concentrated in the transition to the isobaric analog state, the Gamow-Teller strength B(GT) is scattered among the excited states. The main aim of the present study is to determine the B(GT) strengths in the nuclei 9 B and 13 N. The only charge-exchange study of 9 B was made 30 years ago with the (p,n) reaction and a resolution of around 300-400 keV. Many states, especially at high excitation energy, could not be resolved by that study. The present work was able to separate many weakly excited states with small decay width at high excitation energies (12-19 MeV) in 9 B and determine the B(GT) strength distribution by using recent high-precision beta-decay data. The results point to a strong difference in spatial structure between the

  15. High-resolution study of the Gamow-Teller strength distribution in the light nuclei {sup 9}B and {sup 13}N using the ({sup 3}He,t) charge-exchange reaction at 420 MeV beam energy

    Energy Technology Data Exchange (ETDEWEB)

    Scholl, Clemens

    2010-07-07

    Excited states in the light nuclei {sup 9}B and {sup 13}C were studied using the ({sup 3}He,t) charge-exchange reaction on {sup 9}Be and {sup 13}C targets. The measurements were performed at the research center for nuclear physics (RCNP) in Osaka, Japan, using the magnetic spectrometer Grand Raiden and the dispersive WS course. The {sup 3}He beam with an energy of 420 MeV was accelerated by the RCNP Ring Cyclotron. The Grand Raiden spectrometer and the WS course allow to study the ({sup 3}He,t) charge-exchange reaction with an energy resolution of around 30 keV, which is one order of magnitude better than measurements with the (p,n) charge-exchange reaction. The high resolution allows to better separate individual states and to determine weak excitation strengths because of low background in the spectra. A total of 19 states in {sup 13}N were studied, and a total of 20 states were observed in {sup 9}B. Of these, 9 states in {sup 13}C and 10 states in {sup 9}B were identified as being excited by a Gamow-Teller transition. Charge-exchange reactions are related to beta-decay, and at zero momentum transfer a simple proportionality exists between the cross-section of the charge-exchange experiment and the Fermi (F) or Gamow-Teller (GT) beta-decay strength. While the Fermi strength B(F) is concentrated in the transition to the isobaric analog state, the Gamow-Teller strength B(GT) is scattered among the excited states. The main aim of the present study is to determine the B(GT) strengths in the nuclei {sup 9}B and {sup 13}N. The only charge-exchange study of {sup 9}B was made 30 years ago with the (p,n) reaction and a resolution of around 300-400 keV. Many states, especially at high excitation energy, could not be resolved by that study. The present work was able to separate many weakly excited states with small decay width at high excitation energies (12-19 MeV) in {sup 9}B and determine the B(GT) strength distribution by using recent high-precision beta-decay data. The

  16. THE SYMMETRY BREAKING PHENOMENON IN 1,2,3-TRIOXOLENE AND C2Y3Z2 (Z= O, S, Se, Te, Z= H, F COMPOUNDS: A PSEUDO JAHN-TELLER ORIGIN STUDY

    Directory of Open Access Journals (Sweden)

    Ali Reza Ilkhani

    Full Text Available 1,2,3-Trioxolene (C2O3H2 is an intermediate in the acetylene ozonolysis reaction which is called primary ozonide intermediate. The symmetry breaking phenomenon were studied in C2O3H2 and six its derivatives then oxygen atoms of the molecule are substituted by sulphur, selenium, tellurium (C2Y3H2 and hydrogen ligands are replaced with fluorine atoms (C2Y3F2. Based on calculation results, all seven C2Y3Z2 considered in the series were puckered from unstable planar configuration with C2v symmetry to a Cs symmetry stable geometry. The vibronic coupling interaction between the 1A1 ground state and the first excited state 1B1 via the (1A1+1B1 ⊗b1 pseudo Jahn-Teller effect problem is the reason of the breaking symmetry phenomenon and un-planarity of the C2Y3 ring in the C2Y3Z2 series.

  17. Ba 3 (Cr 0.97(1) Te 0.03(1) ) 2 TeO 9 : in Search of Jahn–Teller Distorted Cr(II) Oxide

    Energy Technology Data Exchange (ETDEWEB)

    Li, Man-Rong; Deng, Zheng; Lapidus, Saul H.; Stephens, Peter W.; Segre, Carlo U.; Croft, Mark; Paria Sena, Robert; Hadermann, Joke; Walker, David; Greenblatt, Martha

    2016-10-17

    A novel 6H - type hexagonal perovskite Ba 3 (Cr 0.97(1) Te 0.03 (1 ) ) 2 TeO 9 was prepared at high pressure (6 GPa) and temperature ( 1 773 K). Both transmission electron microscopy and synchrotron powder x - ray diffraction data demonstrate that Ba 3 (Cr 0.97(1) Te 0.03(1) ) 2 TeO 9 crystallize s in P6 3 / mmc with face - shared (Cr 0.97(1) Te 0.03(1) )O 6 octahedral pairs interconnected with TeO 6 octahedra via corner - sharing. Structure analysis shows a mixed Cr 2+ /Cr 3+ valence state with ~ 10% Cr 2+ . The existence of Cr 2+ in Ba 3 (Cr 2+ 0.10(1) Cr 3+ 0.87(1) Te 6+ 0.03 ) 2 TeO 9 is further evidenced by x - ray absorption near edge spectr oscopy . Magnetic properties measurements show a paramagnetic response down to 4 K and a small glassy - state curvature at low temperature. In this work, the o ctahedral Cr 2+ O 6 component is stabilized in an oxide material for the first time ; the expected Jahn - Teller distortion of high - spin ( d 4 ) Cr 2+ is not found , which is attributed to the small proportion of Cr 2+ (~ 10%) and the face - sharing arrangement of CrO 6 octahedral pairs, that structu rally dis favor axial distortion.

  18. A classic case of Jahn–Teller effect theory revisited: Ab initio simulation of hyperfine coupling and pseudorotational tunneling in the 1"2E′ state of Na_3

    International Nuclear Information System (INIS)

    Hauser, Andreas W.; Pototschnig, Johann V.; Ernst, Wolfgang E.

    2015-01-01

    Highlights: • Multireference and Coupled Cluster methods are applied to Na_3. • The PES is characterized by an analytical function fitted to ab initio data. • An effective rovibrational Hamiltonian is set up, with all parameters derived ab initio. • The coupling of pseudorotational tunneling and hyperfine interactions is investigated. • The theoretical predictions are compared to microwave spectra. - Abstract: The predictive capabilities of current ab initio approaches are tested in a benchmark study on the well known case of the Na_3 ground state. This molecule is small enough to be treated with computationally demanding methods, but also shows an interesting interplay between Jahn–Teller-, spin-orbit-, rovibrational- and hyperfine-interactions. The necessary parameters for the effective Hamiltonian are derived from the potential energy surface of the 1"2E′ ground state and from spin density evaluations at selected geometries, without any fitting adjustments to experimental data. We compare our results to highly resolved microwave spectra, with the aim to improve previous assignment attempts, where some parameters had to be estimated from fits to measured spectra.

  19. α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8: new quaternary mixed metal oxides composed of only second-order Jahn-Teller distortive cations.

    Science.gov (United States)

    Kim, Yeong Hun; Lee, Dong Woo; Ok, Kang Min

    2013-10-07

    Three new quaternary scandium vanadium selenium/tellurium oxides, α-ScVSe2O8, β-ScVSe2O8, and ScVTe2O8 have been synthesized through hydrothermal and standard solid-state reactions. Although all three reported materials are stoichiometrically similar, they exhibit different crystal structures: α-ScVSe2O8 has a three-dimensional framework structure consisting of ScO6, VO6, and SeO3 groups. β-ScVSe2O8 reveals another three-dimensional framework composed of ScO7, VO5, and SeO3 polyhedra. ScVTe2O8 shows a layered structure with ScO6, VO4, and TeO4 polyhedra. Interestingly, the constituent cations, that is, Sc(3+), V(5+), Se(4+), and Te(4+) are all in a distorted coordination environment attributable to second-order Jahn-Teller (SOJT) effects. Complete characterizations including infrared spectroscopy, elemental analyses, thermal analyses, dipole moment calculation, and the magnitudes of out-of-center distortions for the compounds are reported. Transformation reactions suggest that α-ScVSe2O8 may change to β-ScVSe2O8, and then to Sc2(SeO3)3·H2O under hydrothermal conditions.

  20. Pseudo Jahn–Teller distortion for a tricyclic carbon sulfide (C{sub 6}S{sub 8}) and its suppression in S-oxygenated dithiine (C{sub 4}H{sub 4}(SO{sub 2}){sub 2})

    Energy Technology Data Exchange (ETDEWEB)

    Pratik, Saied Md.; Chowdhury, Chandra; Bhattacharjee, Rameswar; Jahiruddin, Sk.; Datta, Ayan, E-mail: spad@iacs.res.in

    2015-10-16

    Highlights: • DFT calculations show that sulfur rich cyclic molecules are generally distorted. • Such distortions are shown to arise from Pseudo Jahn–Teller (PJT) effects. • Low OMO–UMO gaps leads to strong vibronic instability for these systems. • Increasing the OMO–UMO gaps by substituting electronegative groups on the cyclic rings decreases PJT effects. • Suppressed PJT instability lead to planar sulfur rich cyclic molecules. - Abstract: The tricyclic carbon-sulfide, C{sub 6}S{sub 8} molecule containing two S-atoms in the 1,4-position of the central six-membered ring and one disulfide (S−S) and one thione (C=S) bond on the five membered rings on its either side (1) possesses a “butterfly flapping” type distorted ground state in the gas-phase and also in β-phase of the crystal. For the isolated molecule, better consideration of the S…S non-bonding interactions in the dithiine ring in the bent form at the M06-2X/6-31+G(d,p) level leads to a significant barrier for inversion of 2.4 kcal/mol which is 2–3 times more than that previously obtained by Weber and Dolg at the B3LYP/cc-pVTZ level due to underestimation of dispersion interactions at the B3LYP level. The origin of the distortion leading to lowering of symmetry for 1 (C{sub 2h} → C{sub 2}) is traced to vibronic mixing between the ground state (Ag) and the low lying excited states of A{sub u} symmetry through the a{sub u} normal mode, a (1A{sub g} + 1A{sub u} + 2A{sub u} + 3A{sub u}) × a{sub u} pseudo Jahn–Teller effect (PJTE) problem. Based on fitting of the ground state APES to the lowest root of the 4 × 4 secular determinant, we calculate the linear vibronic coupling constants (F{sub 0i}) between the relevant states. Similar in class to 1, the S-oxygenated derivative of dithiine, C{sub 4}H{sub 4}(SO{sub 2}){sub 2} (2) unlike most other dithiines, remains planar. The absence of the butterfly-type puckered structure in 2 is traced to the enhanced gap (Δ{sub 0}) and very small

  1. Photodissociation dynamics in the first absorption band of pyrrole. I. Molecular Hamiltonian and the Herzberg-Teller absorption spectrum for the A12(π σ* ) ←X˜ 1 A1(π π ) transition

    Science.gov (United States)

    Picconi, David; Grebenshchikov, Sergy Yu.

    2018-03-01

    This paper opens a series in which the photochemistry of the two lowest πσ* states of pyrrole and their interaction with each other and with the ground electronic state X ˜ are studied using ab initio quantum mechanics. New 24-dimensional potential energy surfaces for the photodissociation of the N-H bond and the formation of the pyrrolyl radical are calculated using the multiconfigurational perturbation theory (CASPT2) for the electronic states X ˜ (π π ) , 11A2(πσ*), and 11B1(πσ*) and locally diabatized. In this paper, the ab initio calculations are described and the photodissociation in the state 11A2(πσ*) is analyzed. The excitation 11 A2←X ˜ is mediated by the coordinate dependent transition dipole moment functions constructed using the Herzberg-Teller expansion. Nuclear dynamics, including 6, 11, and 15 active degrees of freedom, are studied using the multi-configurational time-dependent Hartree method. The focus is on the frequency resolved absorption spectrum as well as on the dissociation time scales and the resonance lifetimes. Calculations are compared with available experimental data. An approximate convolution method is developed and validated, with which absorption spectra can be calculated and assigned in terms of vibrational quantum numbers. The method represents the total absorption spectrum as a convolution of the diffuse spectrum of the detaching H-atom and the Franck-Condon spectrum of the heteroaromatic ring. Convolution calculation requires a minimal quantum chemical input and is a promising tool for studying the πσ* photodissociation in model biochromophores.

  2. Aggregate frequency width, nuclear hyperfine coupling and Jahn-Teller effect of Cu2+ impurity ion ESR in SrLaAlO4 dielectric resonator at 20 millikelvin

    Science.gov (United States)

    Hosain, M. A.; Le Floch, J.-M.; Krupka, J.; Tobar, M. E.

    2018-01-01

    The impurity paramagnetic ion, Cu2+ substitutes Al in the SrLaAlO4 single crystal lattice, this results in a CuO6 elongated octahedron, and the resulting measured g-factors satisfy four-fold axes variation condition. The aggregate frequency width of the electron spin resonance with the required minimum level of impurity concentration has been evaluated in this single crystal SrLaAlO4 at 20 millikelvin. Measured parallel hyperfine constants, A\\Vert Cu , were determined to be -155.7×10-4~cm-1, ~ -163.0×10-4~cm-1, ~ -178.3×10-4~cm-1 and -211.1×10-4~cm-1 at 9.072~GHz~(WGH4, 1, 1) for the nuclear magnetic quantum number M_I=+\\frac{3}{2}, +\\frac{1}{2}, -\\frac{1}{2} , and -\\frac{3}{2} respectively. The anisotropy of the hyperfine structure reveals the characteristics of the static Jahn-Teller effect. The second-order-anisotropy term, ˜ (\\fracspin{-orbit~coupling}{10D_q}){\\hspace{0pt}}2 , is significant and cannot be disregarded, with the local strain dominating over the observed Zeeman-anisotropy-energy difference. The Bohr electron magneton, β=9.23× 10-24 JT-1 , (within -0.43% so-called experimental error) has been found using the measured spin-Hamiltonian parameters. Measured nuclear dipolar hyperfine structure parameter P\\Vert=12.3×10-4~cm-1 shows that the mean inverse third power of the electron distance from the nucleus is ≃ 5.23 a.u. for Cu2+ ion in the substituted Al3+ ion site assuming nuclear electric quadruple moment Q=-0.211 barn.

  3. Effects of hydrostatic pressure and temperature on the electron paramagnetic resonance spectrum of off-centre Jahn-Teller [CuF sub 4 F sub 4] sup 6 sup - complexes in SrF sub 2 crystal

    CERN Document Server

    Ulanov, V A; Hoffmann, S K; Zaripov, M M

    2003-01-01

    Pressure and temperature variations of the spin-Hamiltonian parameters and electron paramagnetic resonance (EPR) linewidths of non-central Jahn-Teller [CuF sub 4 F sub 4] sup 6 sup - complexes in SrF sub 2 crystal were studied by continuous-wave EPR. It was found that the static spin-Hamiltonian parameters, found at T = 85 K and at normal pressure (g sub | sub | = 2.491, g sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 2.083, a sub p sub a sub r sub a sub l sub l sub e sub l = 360, a sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 26, A sub x sub ' sub ' = 96, A sub y sub ' sub ' = 99, A sub z sub ' sub ' = 403 and beta sub e sub x sub p = 17 diameter), are slightly changed with hydrostatic pressure and, at T = 85 K and P = 550 MPa, become equal to g sub | sub | = 2.489, g sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 2.083, a sub | sub | 348, a sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l s...

  4. Dicty_cDB: SSL830 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfdll kkk Translated Ami...sscvwnssvpncprlplvtaplvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfd

  5. Dicty_cDB: SSL464 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 59525.1 Graphium sarpedon mitochondrial ND5 gene for NADH dehydrogenase 5, partial cds, sample:Cameron Highland, Malaysia...ial ND5 gene for NADH dehydrogenase 5, partial cds, sample:Cameron Highland, Malaysia2,@101. 48 0.072 1 AB05...ND5 gene for NADH dehydrogenase 5, partial cds, sample:Cameron Highland, Malaysia1,@86. 48 0.072 1 AB059521

  6. Dicty_cDB: SSL385 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C37A2, complete sequence. 38 0.049 3 BZ347525 |BZ347525.1 hm84h07.b1 WGS-SbicolorF (JM107 adapted methyl filter...-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ho57b09 ..._Ba0020C03 5', genomic survey sequence. 42 0.33 2 BZ366117 |BZ366117.1 ic94g05.g1 WGS-SbicolorF (JM107 adapted methyl filter...in ordered pieces. 44 0.88 1 BZ626058 |BZ626058.1 ih42h02.b1 WGS-SbicolorF (DH5a methyl filter...07.g1 WGS-SbicolorF (DH5a methyl filtered) Sorghum bicolor genomic clone ii21a07, DNA sequence. 38 3.0 2 dna

  7. Dicty_cDB: SSL552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 28 0.36 3 BZ330174 |BZ330174.1 hv90e08.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor gen...S-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone hv90e08 5', DNA sequence. 36 0.63 ...2 BZ335743 |BZ335743.1 hz26f02.g1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clon...e hz26f02 5', DNA sequence. 36 0.68 2 BZ628823 |BZ628823.1 ih62d12.g1 WGS-SbicolorF (DH5a methyl filtered) S...06.1 ic39h07.b1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ic39h07 5', DNA

  8. GATEWAY Report Brief: SSL Evaluation: Philadelphia International Airport Apron Lighting

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2015-10-30

    Summary of report that documents a trial installation of LED apron lighting that replaced the existing high-pressure sodium luminaires at Philadelphia International Airport. Such high-mast applications remain challenging for LED technology, and the lessons learned from this project may help facility managers and LED product manufacturers better meet those challenges.

  9. Dicty_cDB: SSL638 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ckh*kvw*dfrvfrsst*tssrsfnyghc *rdslskmvpw*frhh*ssftfkwstnwlifnsfqfnqcrlfhhfssgrwwln*tskslk trr*i*lpkcnlqqsh*...wimlslmpisli*mvetleesfltgqevpweafidalcnwskaparnqm **nfnrlfkyqmfessfgriski*rywc*nr

  10. Dicty_cDB: SSL103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, c...ctyostelium discoideum Wiscott-A... 306 4e-82 FN392319_1421( FN392319 |pid:none) Pichia pastoris GS115 chrom

  11. Energy Savings Potential of SSL in Horticultural Applications

    Energy Technology Data Exchange (ETDEWEB)

    Stober, Kelsey [Navigant Consulting, Inc., Washington DC (United States); Lee, Kyung [Navigant Consulting, Inc., Washington DC (United States); Yamada, Mary [Navigant Consulting, Inc., Washington DC (United States); Pattison, Morgan [Solid State Lighting Services, Inc. (SSLS), Phoenix, AZ (United States)

    2017-12-29

    Report that presents the findings for horticultural lighting applications where light-emitting diode (LED) products are now competing with traditional light sources. The three main categories of indoor horticulture were investigated: supplemented greenhouses, which use electric lighting to extend the hours of daylight, supplement low levels of sunlight on cloudy days, or disrupt periods of darkness to alter plant growth; non-stacked indoor farms, where plants are grown in a single layer on the floor under ceiling-mounted lighting; and vertical farms, where plants are stacked along vertical shelving to maximize grow space, and the lighting is typically mounted within the shelving units.

  12. Dicty_cDB: SSL481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1442.1 UCRCS01_02dg03_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinens...is cDNA clone UCRCS01_02dg03, mRNA sequence. 42 5.2 1 CB293485 |CB293485.1 UCRCS01_06ag01_g1 Washington Navel orange cold acclimate... UCRCS01_06ag01, mRNA sequence. 42 5.2 1 CB293416 |CB293416.1 UCRCS01_06ac11_b1 Washington Navel orange cold acclimate... CB291577 |CB291577.1 UCRCS01_03af02_g1 Washington Navel orange cold acclimated f

  13. Dicty_cDB: SSL851 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --- ---fpgsnsqdplpmslpssdpmvlkaswivagn*wkivhireihlaqitpipwyesngl ycftwvedanisqliahhpilcsvgkcinqtgscefspvvcpk...hsnpcmkslgcnstigg kcqyqsidctstdpcsigkcnnqtgscefspvvcpthsnpcmksigcnssigkcqyqstn ctstdlcsvgkc

  14. Dicty_cDB: SSL190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C

  15. Dicty_cDB: SSL359 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 2e-54 2 X85122 |X85122.1 Artificial sequences cloning...4 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 2e-54 2... X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 2e-54 2 AF269236 |AF269236.1 Cloning ...vector pDXA-FLAG, complete sequence. 216 2e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pD

  16. Dicty_cDB: SSL782 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sc*xg*hpegtryptppr*apftgilfpllhg pyh*wglsgfansgpgiifpylgfitfv*cilflfgkffnilintraflti*pinsylgm lyfqqt*lvktevf...pmxithsc*xg*hpegtryptppr*apftgilfpllhg pyh*wglsgfansgpgiifpylgfitfv*cilflfgkffnilintraflti*pinsylgm lyfqqt*l

  17. Dicty_cDB: SSL661 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s*ryvtrtn*sngktn*rettri*n*kkc*kifrs*t*s**rkrnc*i*rtn*iie nhinavytrssr*gpakvfansmfedvdsdddrinfrfknclsfiw*yfnw...yvtrtn*sngktn*rettri*n*kkc*kifrs*t*s**rkrnc*i*rtn*iie nhinavytrssr*gpakvfansmfedvdsdddrinfrfknclsfiw*yfnwfil

  18. Whom do we trust - Booters and SSL/TLS certificates

    NARCIS (Netherlands)

    Steinberger, Jessica; Kuhnert, B.; Alavi, S.; Cardoso de Santanna, José Jair; Sperotto, Anna; Baier, H.; Pras, Aiko

    SPRING 2016, 11th edition of the SPRING series, is a single-track event that was sponsored by the special interest group Security – Intrusion Detection and Response (SIDAR) of the German Informatics Society (GI). The purpose of SPRING is to provide young researchers the opportunity to discuss their

  19. Power Systems Modeling for the ONR SSL-TM Program

    Science.gov (United States)

    2015-10-01

    3.4 (R2013b) MATLAB Coder Version 2.5 (R2013b) MATLAB Compiler Version 5.0 (R2013b) Neural Network Toolbox Version 8.1 (R2013b) Optimization...synchronous machine that works both as a generator and a rotor, and a bidirectional power converter that interfaces it to the ship’s power system...0-3- <Si^ * ■ ** ** T Synchronous motor drive J L ! Synchronous generator and bidirectional power converter Figure 20: FESS block

  20. Dicty_cDB: SSL363 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ichosuri cDNA 5' similar to SW:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE...W:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE ;, mRNA sequence. 44 1.4 1 dna update 2003. 9.10 Homolo

  1. Software and Critical Technology Protection Against Side-Channel Analysis Through Dynamic Hardware Obfuscation

    Science.gov (United States)

    2011-03-01

    processors in smart cards, decryption keys for pay TV, lottery ticket vending machines , and mobile-phone systems. For all these crypto-processors...and multiplier leaks SCA information, the proposed methods removed a correlation of the JOP emissions by using two separate adders and two separate...Automated Teller Machines . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 SSL Secure Socket Layer

  2. Effect of Tractor Forward Speed on Sandy Loam Soil Physical ...

    African Journals Online (AJOL)

    Results indicate significant differences in soil physical conditions arising from different levels of tractor forward speed. A forward speed of approximately 7km/h resulted in appreciable amelioration of soil structure as reflected in improvements in the soil strength properties and maximum reduction in clod mean weight ...

  3. Advance of Wetting Front in Silt Loam Soil

    Directory of Open Access Journals (Sweden)

    Mohamed Mahmood

    2013-04-01

    Full Text Available Under drip irrigation , the plant's root is concentrated inside the wetted bulb (region. Thus, the development of these roots and the plant production are greatly affected by the wetting pattern. Therefore, the wetting pattern of soil under drip irrigation must be taken into consideration in the design of drip irrigation system for both single dripping source or multi-overlapping wetting patterns of dripping water sources.2The aim of this study is to evaluate the effect of initial water content of the soil and spacing between two adjacent dripping sources with different flow rate on the movement of the wetting front.This study included 16 tests for monitoring the advancement of the wetting front with time during and after the water application phase. The water advance and water distribution measurement are carried out for two cases of the soil profile: for the first case with initial volumetric water content of 4.08% and for the second case with initial volumetric water content of 12.24%. Two spacing between the emitter were tested 25cm and 50 cm using application flow rates of 0.606, 1.212, 1.818, and 2.424 cm3 /min/cm to show the combined effect of spacing and flow rate on the performance of two adjacent emitter.The study proposed a method for determining the spacing between the two emitting sources , the water application rate and watering time. The proposed method depends on a wetted zone whose depth is equal to the root zone depth with a values equals to the maximum vertical advance of the wetting front underneath the drip line at time when this depth is equal to the depth of wetting at mid­point between the drip line. the study revealed that both the vertical water advance in soil underneath the emitter and the horizontal advance of the wetting front is larger than those in the case of single emitter.Furthermore, the vertical water advance increases with the decrease spacing between the two drip lines. Also, the horizontal advance of the wetting front is not affected by varying this spacing for both studied cases of initial water content.

  4. Enhanced isoproturon mineralisation in a clay silt loam agricultural soil

    OpenAIRE

    El-Sebai , T.; Lagacherie , B.; Cooper , J.F.; Soulas , G.; Martin-Laurent , F.

    2005-01-01

    International audience; 14C-ring-labelled isoproturon mineralisation was investigated in a French agricultural soil previously exposed to isoproturon. 50 different soil samples collected every 2 m along a transect of 100 m in length were treated one or two times with isoproturon under laboratory conditions and analysed by radiorespirometry. 94% of the soil samples showed a high ability to mineralise isoproturon with a relatively low variability in the cumulative percentage of mineralisation r...

  5. Distribución de la porosidad de un suelo franco arcilloso (alfisol en condiciones semiáridas después de 15 años bajo siembra directa Soil porosity distribution of a clay loam soil (alfisol in semi-arid conditions after 15 years under direct drilling

    Directory of Open Access Journals (Sweden)

    Cecilia Isabel Cerisola

    2005-12-01

    Full Text Available A partir de un estudio más amplio sobre evolución de las propiedades físicas de un suelo sometido a tres sistemas de labranza, se realizó, en dos campañas consecutivas, un seguimiento de la distribución de la porosidad del suelo según su origen, en parcelas cultivadas bajo siembra directa continua durante 15 años. En el ensayo se consideró un trayecto de 2 metros de longitud, perpendicular a la dirección de las labores, donde se realizaron mediciones de densidad aparente seca y contenido de humedad. El cultivo extensivo de secano (cereal, en cada una de las dos campañas, fue cebada de ciclo corto y de ciclo largo. El calendario de la toma de datos de las variables medidas se fijó en 5 fechas por campaña. La porosidad estructural del suelo, debida principalmente a la alternancia de ciclos de humectación - desecación, fue calculada cada 5 cm y hasta 35 cm de profundidad. Este proceso de fisuración natural resulta suficiente para asegurar un buen drenaje y facilitar el desarrollo radicular de las plantas, siempre y cuando el contenido de humedad se mantenga dentro de la capacidad de retención de agua.On a long-term essay under direct drilling, the evolution of the physical properties of a clay loam soil, such as distribution by origin of soil porosity, has been assessed during two growing seasons. The cereal crops in each growing seasons were spring barley and winter barley, respectively. Soil physical properties were measured on a 2 m length transect located in a perpendicular line to the direction of vehicular traffic for field operations. Five sampling opportunities, within crop cycle, were used to measure the variables. Structural soil porosity, due principally to shrinkage and swelling cycles, was assessed in the 0 to 35 cm depth soil profile. This natural process seemed to be sufficient to guarantee good drainage and normal crop development, unless in the moisture content range included in field capacity.

  6. New quaternary oxides with both families of second-order Jahn–Teller (SOJT) distortive cations: Solid-state synthesis, structure determination, and characterization of YNbTe{sub 2}O{sub 8} and YNbSe{sub 2}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yeong Hun [Department of Chemistry, Chung-Ang University, 84 Heukseok-ro, Dongjak-gu, Seoul 156-756 (Korea, Republic of); Jeon, Beom-Yong; You, Tae-Soo [Department of Chemistry, Chungbuk National University, Cheongju, Chungbuk 361-763 (Korea, Republic of); Ok, Kang Min, E-mail: kmok@cau.ac.kr [Department of Chemistry, Chung-Ang University, 84 Heukseok-ro, Dongjak-gu, Seoul 156-756 (Korea, Republic of)

    2015-07-15

    Graphical abstract: Ball-and-stick representation of YNbTe{sub 2}O{sub 8} composed of polyhedra of SOJT distortive cations, i.e., NbO{sub 6} and TeO{sub 3}, in the ac-plane. - Highlights: • Two novel tellurite and selenite (YNbQ{sub 2}O{sub 8}; Q = Te and Se) are synthesized. • YNbQ{sub 2}O{sub 8} possess both families of second-order Jahn–Teller distortive cations. • The distortive environments and bonding nature are supported by electronic structure calculations. - Abstract: Two novel quaternary mixed metal tellurite and selenite, YNbTe{sub 2}O{sub 8} and YNbSe{sub 2}O{sub 8}, respectively, have been synthesized through standard solid-state reactions using Y{sub 2}O{sub 3}, Nb{sub 2}O{sub 5}, TeO{sub 2} or SeO{sub 2} as reagents. Single crystal X-ray and powder neutron diffraction analyses have been utilized to determine the structures of the reported materials. YNbTe{sub 2}O{sub 8} and YNbSe{sub 2}O{sub 8} are isostructural to each other and crystallize in the monoclinic centrosymmetric space group, C2/m (No. 12). Due to the two families of constituent second-order Jahn–Teller (SOJT) distortive cations, i.e., Nb{sup 5+} and Te{sup 4+}/Se{sup 4+}, local asymmetric environments occur from the three-dimensional frameworks. Intra-octahedral distortions along the local C{sub 4} direction and asymmetric trigonal pyramidal coordination moieties generated by stereoactive lone pairs are observed from the NbO{sub 6} octahedra and TeO{sub 3} (or SeO{sub 3}) polyhedra, respectively. Thermogravimetric analysis, infrared and UV–vis diffuse reflectance spectroscopies, elemental analysis, out-of-center distortions, dipole moment calculations, and electronic structure calculations for the reported materials are presented.

  7. Escarificação mecânica e biológica para a redução da compactação em argissolo franco-arenoso sob plantio direto Mechanical and biological chiseling to reduce compaction of a sandy loam alfisol under no-tillage

    Directory of Open Access Journals (Sweden)

    S. L. Abreu

    2004-06-01

    saturado, em médio prazo, a "escarificação biológica" (CM-crot mostrou-se mais eficaz na ruptura da camada compactada e estabelecimento de poros condutores de água do que a escarificação mecânica (Esc-soja do solo. Em contrapartida, se o indicador for a RP, o resultado é inverso. Assim, a propriedade hídrica ou mecânica do solo a ser usada como indicadora para a avaliação da eficácia da ruptura da camada compactada do solo depende do processo físico priorizado: a infiltração e redistribuição de água ou a penetração e crescimento de raízes.Soil management alters the physical soil properties and changes the soil air, water, and solute dynamics. Physical soil properties as affected by conservationist soil management systems were studied in a sandy loam Typic Hapludalf. The treatments were established on a soil that has been under no-tillage for 10 years, and consisted of: no-tillage soybeans, chisel tillage soybeans, reduced tillage Crotalaria, and bare soil without tillage. The evaluated soil properties were soil penetration resistance, bulk density, porosity, pore size distribution, saturated and unsaturated hydraulic conductivity, water infiltration using concentric rings or natural rainfall, variation of the volumetric soil moisture throughout the cropping cycle, and water retention curve. Soil penetration resistance (PR was highest at 0.075 m and 0.175 m depth in no-tillage and chiseled soil, respectively. Soil subsurface mobilization with chiseling and surface mobilization due to disking and sowing did not influence the bulk density (BD after the crop harvest. No-till soil under soybean crop had greater macroporosity than reduced tillage crotalaria and bare soil at 0.02 to 0.05 m depth, resulting in a greater saturated hydraulic conductivity and lower water retention during periods of low water availability. Among the analyzed soil physical-mechanical properties, PR seemed to be more sensitive to detect soil compaction than BD or porosities

  8. Effect of Injecting Hydrogen Peroxide into Heavy Clay Loam Soil on Plant Water Status, NET CO2 Assimilation, Biomass, and Vascular Anatomy of Avocado Trees Efecto de la Inyección de Peróxido de Hidrógeno en Suelo Franco Arcilloso Pesado, sobre el Estado Hídrico, Asimilación Neta de CO2, Biomasa y Anatomía Vascular de Paltos

    Directory of Open Access Journals (Sweden)

    Pilar M Gil M

    2009-03-01

    Full Text Available In Chile, avocado (Persea americana Mill. orchards are often located in poorly drained, low-oxygen soils, situation which limits fruit production and quality. The objective of this study was to evaluate the effect of injecting soil with hydrogen peroxide (H2O2 as a source of molecular oxygen, on plant water status, net CO2 assimilation, biomass and anatomy of avocado trees set in clay loam soil with water content maintained at field capacity. Three-year-old ‘Hass’ avocado trees were planted outdoors in containers filled with heavy loam clay soil with moisture content sustained at field capacity. Plants were divided into two treatments, (a H2O2 injected into the soil through subsurface drip irrigation and (b soil with no H2O2 added (control. Stem and root vascular anatomical characteristics were determined for plants in each treatment in addition to physical soil characteristics, net CO2 assimilation (A, transpiration (T, stomatal conductance (gs, stem water potential (SWP, shoot and root biomass, water use efficiency (plant biomass per water applied [WUEb]. Injecting H2O2 into the soil significantly increased the biomass of the aerial portions of the plant and WUEb, but had no significant effect on measured A, T, gs, or SWP. Xylem vessel diameter and xylem/phloem ratio tended to be greater for trees in soil injected with H2O2 than for controls. The increased biomass of the aerial portions of plants in treated soil indicates that injecting H2O2 into heavy loam clay soils may be a useful management tool in poorly aerated soil.En Chile, los huertos de palto (Persea americana Mill. se ubican comúnmente en suelos pobremente drenados con bajo contenido de oxígeno, lo que limita producción y calidad de fruta. El objetivo de este estudio fue evaluar el efecto de la inyección de peróxido de hidrógeno (H2O2 al suelo como fuente de O2, sobre el estado hídrico, asimilación de CO2, biomasa y anatomía de paltos en suelo franco arcilloso con

  9. Histories and Horoscopes: The Ethnographer as Fortune-Teller.

    Science.gov (United States)

    Hamilton, Mary

    1998-01-01

    Focuses on different ways participants in a research project may understand the research and use it themselves by describing how 20 adult students and 14 community members, participants in a recent ethnographic study of adult literacy in England, responded to the invitation to collaborate with researchers in interpreting interview data. (SLD)

  10. North Carolina Tales Fly with Fourth Grade Tellers

    Science.gov (United States)

    Westman, Gretchen Daub

    2008-01-01

    In fourth grade, North Carolina students are required to write their own personal narratives. The teachers felt that telling a story would be a great stepping stone toward writing one. Rather than focusing on grammar and the mechanics of writing, students could focus on story development and creativity. In this article, the author describes how…

  11. Gamow-Teller strength functions and neutrino problems

    International Nuclear Information System (INIS)

    Haxton, W.C.

    1982-01-01

    A quantitative understanding of spin strengths in nuclei is of vital importance in studies of nuclear double beta decay and in solar neutrino spectroscopy. The current status of these problems is outlined

  12. Patients as story-tellers of healthcare journeys.

    Science.gov (United States)

    Lamprell, Klay; Braithwaite, Jeffrey

    2016-09-01

    There are gaps in our comprehension of patients' subjective experiences as they engage with and transit through the healthcare environments implicated in their treatment trajectories. Patients' stories, unlike patient experience data gathered in questionnaires and surveys, express the deeply personal, narrative nature of the journeys that patients take, creating opportunities for qualitative healthcare research. Yet narrative capabilities and propensities vary with individuals, and are affected by the stresses of illness and treatment. This article extends the growing interest in narrative competence training for both practitioners and patients with the investigation of a story-telling model that could facilitate patients to narrate their experiences of healthcare systems. This model is derived from the literary arts. In fiction and autobiography, the journey arc of the central character is often one in which he or she is compelled to leave the comfort of everyday life and face a series of extraordinary events involving challenge and change which forces the character towards practical, intellectual, psychological and philosophical adjustments that define, by the end of the story, the character's 'new normal'. This pattern is known as the 'hero journey'. Its parallels with patients' experiences of healthcare and the way people narrate their stories of illness have long been recognised. We present here a new idea for applying this model as a narrative structure by which patients may construct their stories about being in and moving through the healthcare system. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  13. On the path to fusion energy. Teller lecture 2005

    International Nuclear Information System (INIS)

    Tabak, M.

    2007-01-01

    There is a need to develop alternate energy sources in the coming century because fossil fuels will become depleted and their use may lead to global climate change. Inertial fusion can become such an energy source, but significant progress must be made before its promise is realized. The high-density approach to inertial fusion suggested by Nuckolls et al. leads reaction chambers compatible with civilian power production. Methods to achieve the good control of hydrodynamic stability and implosion symmetry required to achieve these high fuel densities will be discussed. Fast Ignition, a technique that achieves fusion ignition by igniting fusion fuel after it is assembled, will be described along with its gain curves. Fusion costs of energy for conventional hotspot ignition will be compared with those of Fast Ignition and their capital costs compared with advanced fission plants. Finally, techniques that may improve possible Fast Ignition gains by an order of magnitude and reduce driver scales by an order of magnitude below conventional ignition requirements are described. (author)

  14. Norris Bradbury and Edward Teller: A Fission-Fusion Reaction

    Energy Technology Data Exchange (ETDEWEB)

    Meade, Roger Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-02-12

    On a bright, sunny day in October 1945, a boisterous and jubilant crowd assembled in front of Fuller Lodge to watch as the Army-Navy “E” Award, a prestigious national honor given for “Excellence in Production” during World War II, was presented to the Los Alamos Laboratory. Major General Leslie Groves, the commanding officer of the Manhattan Project; Navy Commodore William S. (Deak) Parsons, the wartime leader of the Laboratory’s Ordnance Division; Robert Sproul, the President of the University of California; and J. Robert Oppenheimer accepted the award on behalf of the Laboratory.

  15. GATEWAY Report Brief: SSL Demonstration: Long-Term Evaluation of Indoor Field Performance

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2017-02-28

    Report brief summarizing a GATEWAY program evaluation of the long-term performance characteristics (chromaticity change, maintained illuminance, and operations and maintenance) of LED lighting systems in four field installations previously documented in separate DOE GATEWAY reports.

  16. Using SSL-Bypass Concept to Eliminate Cutoff of Labs-Services during its Maintenance Period

    International Nuclear Information System (INIS)

    ElDib, A.A.

    2014-01-01

    This Design Concept of Interior Architecture concerned with Design Flexibility (George Fischer, Valve and Actuator Manual 977, Laboratories For The 21ST Century : Best Practices-2004) is designated for lab areas - specially those using radioactive materials - in need for constant feeding of service supplies without any interruption of the ongoing activities taking place in research laboratories. The paper also will discuss the implementation of sensors attached to the Automation of building Management which form a part of a control system network and surveillance and related to safety purpose measures to be considered for these types of research buildings. (NOTE:- It is important to mention that some types of research activities cannot tolerate the cutoff of services supply for long time, on the other hand some others DO NOT tolerate this cutoff at any time of the 24 hours in a given day/ or a period of days

  17. GATEWAY Demonstrations: Long-Term Evaluation of SSL Field Performance in Select Interior Projects

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Tess E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Davis, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wilkerson, Andrea M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-02-28

    The GATEWAY program evaluated the long-term performance characteristics (chromaticity change, maintained illuminance, and operations and maintenance) of LED lighting systems in four field installations previously documented in separate DOE GATEWAY reports.

  18. Perancangan Replikasi Basis Data Mysql Dengan Mekanisme Pengamanan Menggunakan Ssl Encryption

    OpenAIRE

    Yuliansyah, Herman

    2014-01-01

    Karena faktor pentingnya data dan informasi pada organisasi small medium business (SMB), maka diperlukan suatu replikasi basis data sehingga jika terjadi suatu keadaan force majure, organisasi tersebut tidak akan mengalami kehilangan data. Replikasi basis data ini melibatkan paling sedikit 2 sistem basis data yang terhubung dalam suatu jaringan komputer. Konsep CIA Triad yaitu Confidentiality, Integrity dan Availability, merupakan dasar keamanan untuk mengelola data dan informasi. Keterkaitan...

  19. PERANCANGAN REPLIKASI BASIS DATA MYSQL DENGAN MEKANISME PENGAMANAN MENGGUNAKAN SSL ENCRYPTION

    OpenAIRE

    Herman Yuliansyah

    2014-01-01

    Karena faktor pentingnya data dan informasi pada organisasi small medium business (SMB), maka diperlukan suatu replikasi basis data sehingga jika terjadi suatu keadaan force majure, organisasi tersebut tidak akan mengalami kehilangan data. Replikasi basis data ini melibatkan paling sedikit 2 sistem basis data yang terhubung dalam suatu jaringan komputer. Konsep CIA Triad yaitu Confidentiality, Integrity dan Availability, merupakan dasar keamanan untuk mengelola data dan informasi. Keterkaitan...

  20. Novel Optical Fiber Materials With Engineered Brillouin Gain Coefficients SSL 1: Novel Fiber Lasers

    Science.gov (United States)

    2015-12-29

    strontium aluminosilicate glasses . A zero-p12 composition is calculated to be at a SiO2 content of about 41.5 mol%, SrO content of about 22.5 mol...ternary, glasses that are needed for this program. These include the BaO- SiO2 system as an example binary glass , and the MgO-Al2O3- SiO2 and BaO-Al2O3... SiO2 systems as example ternary glasses (with the addition of a rare earth 16 resulting in a quaternary glass ). Complex ternary compositions were

  1. Microstructure and stability of two sandy loam soils with different soil management

    NARCIS (Netherlands)

    Bouma, J.

    1969-01-01

    A practical problem initiated this study. In the Haarlemmermeer, a former lake reclaimed about 1850, several farmers had difficulties with soil structure. Land, plowed in autumn, was very wet in spring. Free water was sometimes present on the soil surface. Planting and seeding were long delayed in

  2. Clinoptilolite zeolite influence on inorganic nitrogen in silt loam and sandy agricultural soils

    Science.gov (United States)

    Development of best management practices can help improve inorganic nitrogen (N) availability to plants and reduce nitrate-nitrogen (NO3-N) leaching in soils. This study was conducted to determine the influence of the zeolite mineral Clinoptilolite (CL) additions on NO3-N and ammonium-nitrogen (NH4...

  3. Free flow spillways on loam dams; Deversoirs a ecoulement libre sur des digues en terre

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    The free flow spillways technique was developed abroad and has been used and developed in France by two research offices and foremen. Dams of this type can have heights of 8 to 20 m and both dams and spillways must fit with special technical characteristics which are described (drainage, joints, reinforcements, wall surface, embankment etc..). The experience of French foremen with this type of dams and spillways is reported. (J.S.)

  4. Soil resistance and resilience to mechanical stresses for three differently managed sandy loam soils

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Schjønning, Per; Møldrup, Per

    2012-01-01

    carbon (CCCsoils to compaction using air permeability (ka), void ratio (e) and air-filled porosity (ε) as functional indicators and to characterise aggregate stability, strength and friability. Aggregate tensile strength...... the compression index and a proposed functional index,was significantly greater for theMFC soil compared to the other two soils. The change in compression index with initial void ratio was significantly less for the MFC than the other soils. Plastic reorganisation of the soil particles immediately after......To improve our understanding of how clay-organic carbon dynamics affect soil aggregate strength and physical resilience, we selected three nearby soils (MFC,Mixed Forage Cropping; MCC,Mixed Cash Cropping; CCC, Cereal Cash Cropping)with identical clay content and increasing contents of organic...

  5. Predictivity strength of the spatial variability of phenanthrene sorption across two sandy loam fields

    DEFF Research Database (Denmark)

    Soares, Antonio; Paradelo Pérez, Marcos; Møldrup, Per

    2015-01-01

    Sorption is commonly suggested as the major process underlying the transport and fate of polycyclic aromatic hydrocarbons (PAHs) in soils. However, studies focusing in spatial variability at the field scale in particular are still scarce. In order to investigate the sorption of phenanthrene...

  6. Persistence of bifenthrin in sandy loam soil as affected by microbial community.

    Science.gov (United States)

    Sharma, Divya; Singh, Shashi Bala

    2012-06-01

    Soil was fortified with bifenthrin at the level of 10 μg g(-1) soil. Soil samples were drawn at regular intervals of 0, 10, 20, 30 and 40 days. For extraction of bifenthrin, soil was extracted with acetone. Clean up was done by liquid-liquid partitioning with dichloromethane after diluting with brine solution. Quantification of bifenthrin residues was done by GC using mega bore column and ECD detector. Recovery of bifenthrin in soil ranged between 92.6 % and 93.8 % at 0.5 and 1.0 μg g(-1). The instrumental limit of detection of bifenthrin was 0.005 μg mL(-1) and LOQ for soil by this method was found to be 0.05 μg g(-1). The calibration curve was found to be linear within range the range of 0.01 and 0.10 μg mL(-1) concentration. The DT(50) (disappearance time for 50 % loss) of bifenthrin at the level of 10 μg g(-1) in sterile and non sterile soil were found to be 330 and 147 days, respectively. A vast difference in the half life of sterile and non sterile soil indicated the presence of potential microbes for bifenthrin degradation.

  7. Carbon dioxide emissions after application of different tillage systems for loam in northern China

    Science.gov (United States)

    Hongwen, Li; Lifeng, Hu; Fub, Chen; Xuemin, Zhang

    2010-05-01

    Tillage operations influence soil physical properties and crop growth, and thus both directly and indirectly the cropland CO2 exchange with the atmosphere. In this study, the results of CO2 flux measurements on cropland, under different tillage practices in northern China, are presented. CO2 flux on croplands with a winter wheat (Triticum aestivum L.) and maize (Zea may L.) rotation was monitored on plots with conventional tillage (CT), rotary tillage (RT) and no tillage (NT). Soil CO2 flux was generally greater in CT than in NT, and the RT CO2 flux was only slightly smaller than the CT. Daily soil CO2 emissions for CT, RT, and NT averaged 11.30g m-2, 9.63 g m-2 and 7.99 g m-2, respectively, during the growing period. Analysis of variance shows that these differences are significant for the three tillage treatments. Peak CO2 emissions were recorded on the CT and RT croplands after tillage operations. At the same time, no obviously increased emission of CO2 occurred on the NT plot. These differences demonstrate that tillage results in a rapid physical release of CO2.

  8. Improving the Bearing Strength of Sandy Loam Soil Compressed Earth Block Bricks Using Sugercane Bagasse Ash

    Directory of Open Access Journals (Sweden)

    Ramadhan W. Salim

    2014-06-01

    Full Text Available The need for affordable and sustainable alternative construction materials to cement in developing countries cannot be underemphasized. Compressed Earth Bricks have gained acceptability as an affordable and sustainable construction material. There is however a need to boost its bearing capacity. Previous research show that Sugarcane Bagasse Ash as a soil stabilizer has yielded positive results. However, there is limited research on its effect on the mechanical property of Compressed Earth Brick. This current research investigated the effect of adding 3%, 5%, 8% and 10% Sugarcane Bagasse Ash on the compressive strength of compressed earth brick. The result showed improvement in its compressive strength by 65% with the addition of 10% Sugarcane Bagasse Ash.

  9. Estimating Infiltration Rates for a Loessal Silt Loam Using Soil Properties

    Science.gov (United States)

    M. Dean Knighton

    1978-01-01

    Soil properties were related to infiltration rates as measured by single-ringsteady-head infiltometers. The properties showing strong simple correlations were identified. Regression models were developed to estimate infiltration rate from several soil properties. The best model gave fair agreement to measured rates at another location.

  10. Effect of industrial, municipal and agricultural wastes on peanut in lateritic sandy loam soil

    International Nuclear Information System (INIS)

    Sarkar, S.; Khan, A.R.

    2002-06-01

    Modern agriculture, worldwide, depends upon the external application of plant nutrients supplied mostly through chemical fertilizer to meet the crop needs. The natural recycling cannot provide the very large amount of nutrients needed year after year in an intensive cropping system and nutrients being a major constraint harvesting the nutrient energy from biological and industrial waste are of prime importance for maximizing the food grain production in the world. A number of industrial wastes like fly ash from thermal power plants, paper factory sludge from paper factory, sewage sludge from municipal source and farmyard manure from livestock farming are the important waste resources, having potentiality in recycling in agricultural land. When these wastes are recycled through soil for crop production, due to the degradative and assimilative capacity of soil, the pollution hazards of these wastes can be minimized to a greater extent as compared to direct disposing of at the site. Fly ash is a waste product residue resulting from the combustion of pulverised coal in coal-fired power generating station. Physico - chemical analysis of fly ash has revealed the presence of both macro-micro nutrients, which can sustain plant growth. Its application in the agricultural land acts as a liming material and improves crop growth by neutralizing the soil acidity, increasing the water availability for the plants and supplement of nutrients (Adriano et al, 1980, Molliner and Street, 1982, Schnappinger et al, 1975). Application of paper factory sludge has been reported to increase the organic carbon content in soil and nutrient content like P, K, Ca, Mg and micronutrients (Guerini et al, 1994, Muse and Mitchell, 1995). Sludge application also improves the organic carbon content of the soil and availability of nutrients like Ca, K and Mg besides improvement of physical properties (Pitchel and Hayes, 1990). Much is known regarding crop performance and changes in physical and chemical properties of soil due to the application of such organic wastes. However, little is explored regarding the influence of various wastes on soil microbiology and its impact on nodulation and yield of leguminous crop like peanut. Soil biology is a significant component of soil quality and is the catalytic agent responsible for many transformations occurring in soil, most notably the reactions involved in nutrient cycling (Karlen et al, 1997). Thus it is meaningful to evaluate the physical, chemical and biological aspects of soil quality by addition of such organic wastes. The aim of the study was to evaluate the influence of industrial, municipal and agricultural waste on the performance of a leguminous crop like peanut and on the total microbial and Rhizobium population in soil rhizosphere

  11. Interrill sediment enrichment of P and C from organically and conventionally farmed silty loams

    Science.gov (United States)

    Kuhn, N. J.

    2012-04-01

    Globally, between 0.57 and 1.33 Pg of soil organic carbon (SOC) may be affected by interrill processes. Also, a significant amount of phosphorus (P) is contained in the surface soil layer transformed by raindrop impact, runoff and crust formation. In the EU, the P content of a crusted (2 mm) surface layer corresponds to 4 to 40 kg ha-1 of P on arable land (1.094 mil km2). Therefore, the role of interrill processes for nutrient cycling and the global carbon cycle requires close attention. Interrill erosion is a complex phenomen on involving the detachment, transport and deposition of soil particles by raindrop impacted flow. Resistance to interrill erosion varies between soils depending on their physical, chemical and mineralogical properties. In addition, significant changes in soil resistance to interrill erosion occur during storms as a result of changes in surface roughness, cohesion and particle size. As a consequence, erosion on interrill areas is selective, moving the most easily detached small and/or light soil particles. This leads to the enrichment of clay, phosphorous (P)and carbon (C). Such enrichment in interrill sediment is well documented, however, the role of interrill erosion processes on the enrichment remains unclear. Enrichment of P and C in interrill sediment is attributed to the preferential erosion of the smaller, lighter soil particles. In this study, the P and organic C content of sediment generated from two Devon silts under conventional (CS) and organic (OS) soil management were examined. Artificial rainfall was applied to the soils using two rainfall scenarios of differing intensity and kinetic energy to determine the effects on the P and C enrichment in interrill sediment. Interrill soil erodibility was lower on the OS, irrespective of rainfall intensity. Sediment from both soils showed a significant enrichment in P and C compared to the bulk soil. However, sediment from the OS displayed a much greater degree of P enrichment. This shows that the net P export from organically farmed soils is not reduced by a similar degree than soil erosion compared to conventional soil management. The enrichment of P and C in the interrill sediment was not directly related to SOC, P content of the soil and soil interrill erodibility. A comparison of soil and sediment properties indicates that crusting, P and C content as well as density and size of eroded aggregate fragments control P and C enrichment. Due to complex and dynamic interactions between P, SOC and interrill erosional processes, the nutrient and C status of sediments cannot be predicted based on soil P content, SOC or interrill erodibility alone. Clearly, further research on crust formation and the composition of fragments generated by aggregate breakdown and their transport in raindrop impacted flow under different rainfall conditions is required. Attaining this critical missing knowledge would enable a comprehensive assessment of the benefits of organic farming on nutrient budgets, off-site effects of interrill erosion and its role in the global C cycle.

  12. Effects of biochar and manure amendments on water vapor sorption in a sandy loam soil

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Tuller, Markus; Moldrup, Per

    2015-01-01

    Over the last few years, the application of biochar (BC) as a soil amendment to sequester carbon and mitigate global climate change has received considerable attention. While positive effects of biochar on plant nutrition are well documented, little is known about potential impacts on the physical....... Hysteresis of the water vapor sorption isotherms increased with increasing BC application rates. Biochar age did not significantly affect vapor sorption and SSA....

  13. Seasonal dynamics in wheel load-carrying capacity of a loam soil in the Swiss Plateau

    DEFF Research Database (Denmark)

    Gut, S.; Chervet, A.; Stettler, Matthias

    2015-01-01

    on in situ measurements of h, measurements of precompression stress at various h and simulations of soil stress. In this work, we concentrated on prevention of subsoil compaction. Calculations were made for different tyres (standard and low-pressure top tyres) and for soil under different tillage......Subsoil compaction is a major problem in modern agriculture caused by the intensification of agricultural production and the increase in weight of agricultural machinery. Compaction in the subsoil is highly persistent and leads to deterioration of soil functions. Wheel load-carrying capacity (WLCC......) is defined as the maximum wheel load for a specific tyre and inflation pressure that does not result in soil stress in excess of soil strength. The soil strength and hence WLCC is strongly influenced by soil matric potential (h). The aim of this study was to estimate the seasonal dynamics in WLCC based...

  14. Overall assessment of soil quality on humid sandy loams: Effects of location, rotation and tillage

    DEFF Research Database (Denmark)

    Abdollahi, Lotfollah; Hansen, Elly Møller; Rickson, J.M.

    2015-01-01

    .e. visual evaluation of soil structure (VESS), overall visual structure (OVS) and overall soil structure (OSS)) were employed to differentiate the effects of these alternative management practices on soil structural quality and relative crop yield (RY). A Pearson correlation was also employed to find...... the correlation between the soil quality indices and relative crop yield. Relevant soil properties for calculating the soil quality indices were measured or obtained from previous publications. Crop rotation affected the soil structure and RY. The winter-dominated crop rotation (R2) resulted in the poorest soil...... correlations were found in most cases between soil quality indices (including M-SQR) and RY. This highlights the influence of soil quality (as measured by the selected indicators) – and soil structure in particular – on crop yield potential....

  15. Anisotropy of the porosity in a silty loam soil under continuous no tillage management

    OpenAIRE

    Soracco, Carlos Germán; Lozano, Luis A.; Gelati, Pablo R.; Sarli, Guillermo O.; Filgueira, Roberto R.

    2008-01-01

    La superficie bajo siembra directa (SD) se incrementa continuamente en la Republica Argentina. Existen trabajos que muestran una orientación preferencial de los poros en sentido horizontal cerca de la superficie de suelos bajo SD. El objetivo específico de este trabajo fue evaluar la conductividad hidráulica saturada del horizonte superficial en sentido vertical y horizontal en SD continua con descompactación (SDCD) respecto de un testigo de SD sin descompactacion (SDSD) para determinar la ex...

  16. Crop residues as driver for N2O emissions from a sandy loam soil

    DEFF Research Database (Denmark)

    Pugesgaard, Siri; Petersen, Søren O.; Chirinda, Ngonidzashe

    2017-01-01

    -term experiment on a loamy sand soil at Foulum in Denmark. All cropping systems included winter wheat, a leguminous crop (faba bean or grass-clover), potato and spring barley grown in different 4-crop rotations varying in strategies for N supply (fertilizer/manure type and rate, use of catch crops and green......-N leaching losses ranged from 39 to 56 kg N ha−1 y−1 and were lowest in rotations with catch crops; leaching was not correlated with N surplus or N input in fertilizer or manure. Crop yields of the organic rotations were 25 to 37% lower than in identical conventional rotations. As a consequence, yield...

  17. Soil structure and earthworm activity in an marine silt loam under pasture versus arable land

    NARCIS (Netherlands)

    Jongmans, A.G.; Pulleman, M.M.; Marinissen, J.C.Y.

    2001-01-01

    Agricultural management influences soil organic matter (SOM) and earthworm activity which interact with soil structure. We aimed to describe the change in earthworm activity and related soil (micro)structure and SOM in a loamy Eutrodept as affected by permanent pasture (PP) and conventional arable

  18. Energetic contaminants inhibit plant litter decomposition in soil.

    Science.gov (United States)

    Kuperman, Roman G; Checkai, Ronald T; Simini, Michael; Sunahara, Geoffrey I; Hawari, Jalal

    2018-05-30

    Individual effects of nitrogen-based energetic materials (EMs) 2,4-dinitrotoluene (2,4-DNT), 2-amino-4,6-dinitrotoluene (2-ADNT), 4-amino-2,6-dinitrotoluene (4-ADNT), nitroglycerin (NG), and 2,4,6,8,10,12-hexanitrohexaazaisowurtzitane (CL-20) on litter decomposition, an essential biologically-mediated soil process, were assessed using Orchard grass (Dactylis glomerata) straw in Sassafras sandy loam (SSL) soil, which has physicochemical characteristics that support "very high" qualitative relative bioavailability for organic chemicals. Batches of SSL soil were separately amended with individual EMs or acetone carrier control. To quantify the decomposition rates, one straw cluster was harvested from a set of randomly selected replicate containers from within each treatment, after 1, 2, 3, 4, 6, and 8 months of exposure. Results showed that soil amended with 2,4-DNT or NG inhibited litter decomposition rates based on the median effective concentration (EC50) values of 1122 mg/kg and 860 mg/kg, respectively. Exposure to 2-ADNT, 4-ADNT or CL-20 amended soil did not significantly affect litter decomposition in SSL soil at ≥ 10,000 mg/kg. These ecotoxicological data will be helpful in identifying concentrations of EMs in soil that present an acceptable ecological risk for biologically-mediated soil processes. Published by Elsevier Inc.

  19. The Effects of Linguistic Context on Word Recognition in Noise by Elderly Listeners Using Spanish Sentence Lists (SSL)

    Science.gov (United States)

    Cervera, Teresa; Rosell, Vicente

    2015-01-01

    This study evaluated the effects of the linguistic context on the recognition of words in noise in older listeners using the Spanish Sentence Lists. These sentences were developed based on the approach of the SPIN test for the English language, which contains high and low predictability (HP and LP) sentences. In addition, the relative contribution…

  20. Final Report DOE SSL Grant (No. DE-EE0006673) Advanced Light Extraction Structure for OLED Lighting

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, Gregory [Pixelligent Technologies LLC, Baltimore, MD (United States); Monickam, Selina [Pixelligent Technologies LLC, Baltimore, MD (United States)

    2017-08-29

    The innovation proposed in this grant is to demonstrate a novel internal light extraction (ILE) design that can maximize the energy efficiency of Organic Light Emitting Diode (OLED) lighting devices without negatively impacting the device voltage, efficacy or angular color dependences. Even though, OLEDs have unique features compared to its inorganic counterparts, LEDs, in terms of technology development and market readiness levels, it still lags LEDs by several years. The main challenges as identified in the National Research Council’s 2013 Assessment on Solid State Lighting, are the cost of the materials and the low light extraction efficacy [1]. Improving the light extraction will improve both the $/Klm and lm/W, two important metrics DOE uses to measure the cost effectiveness of a light source.

  1. Approach to Low-Cost High-Efficiency OLED Lighting. Building Technologies Solid State Lighting (SSL) Program Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Pei, Qibing [Univ. of California, Los Angeles, CA (United States). Dept. of Materials Science and Engineering

    2017-10-06

    This project developed an integrated substrate which organic light emitting diode (OLED) panel developers could employ the integrated substrate to fabricate OLED devices with performance and projected cost meeting the MYPP targets of the Solid State Lighting Program of the Department of Energy. The project optimized the composition and processing conditions of the integrated substrate for OLED light extraction efficiency and overall performance. The process was further developed for scale up to a low-cost process and fabrication of prototype samples. The encapsulation of flexible OLEDs based on this integrated substrate was also investigated using commercial flexible barrier films.

  2. Comparing Beerkan infiltration tests with rainfall simulation experiments for hydraulic characterization of a sandy-loam soil

    NARCIS (Netherlands)

    Prima, Di Simone; Bagarello, Vincenzo; Lassabatere, Laurent; Angulo-Jaramillo, Rafael; Bautista, Inmaculada; Burguet, Maria; Cerda Bolinches, Artemio; Iovino, Massimo; Prosdocimi, Massimo

    2017-01-01

    Saturated soil hydraulic conductivity, Ks, data collected by ponding infiltrometer methods and usual experimental procedures could be unusable for interpreting field hydrological processes and particularly rainfall infiltration. The Ks values determined by an infiltrometer

  3. Nitrate leaching from sandy loam soils under a double-cropping forage system estimated from suction-probe measurements.

    NARCIS (Netherlands)

    Trindade, H.; Coutinho, J.; Beusichem, van M.L.; Scholefield, D.; Moreira, N.

    1997-01-01

    Nitrate leaching from a double-cropping forage system was measured over a 2-year period (June 1994–May 1996) in the Northwest region of Portugal using ceramic cup samplers. The crops were grown for silage making and include maize (from May to September) and a winter crop (rest of the year)

  4. Impact of macropores and gravel outcrops on phosphorus leaching at the plot scale in silt loam soils

    Science.gov (United States)

    In response to increased nutrient loads in surface waters, scientists and engineers need to identify critical nutrient source areas and transport mechanisms within a catchment to protect beneficial uses of aquatic systems in a cost effective manner. It was hypothesized that hydrologic heterogeneitie...

  5. Soil precompression stress, penetration resistance and crop yields in relation to differently-trafficked, temperate-region sandy loam soils

    DEFF Research Database (Denmark)

    Schjønning, Per; Lamandé, Mathieu; Munkholm, Lars Juhl

    2016-01-01

    . Undisturbed soil cores were used for quantifying the precompression stress (spc) of non-compacted soil. Tractor-trailer combinations for slurry application with wheel loads of 3, 6 and 8 Mg (treatments M3, M6, M8) were used for the experimental traffic in the spring at field-capacity. For one additional...

  6. Toxicity of Nitro-Heterocyclic and Nitroaromatic Energetic Materials to Folsomia candida in a Natural Sandy Loam Soil

    Science.gov (United States)

    2015-04-01

    these tests. Acetone (CAS: 67-64-1; high-performance liquid chromatography [HPLC] grade) was used for preparing EM solutions during the soil amendments... chromatography grade, purity: 99.9%) was used in the HPLC determinations. Certified standards of the energetics (AccuStandard, Inc., New Haven, CT) were used...H.; Van Gestel, C.A.M. Handbook of Soil Invertebrate Toxicity Tests; John Wiley & Sons: Hoboken, NJ, 1998. McLellan, W.L.; Hartley, W.R.; Brower

  7. Impact of industrial effluent on growth and yield of rice (Oryza sativa L.) in silty clay loam soil.

    Science.gov (United States)

    Anwar Hossain, Mohammad; Rahman, Golum Kibria Muhammad Mustafizur; Rahman, Mohammad Mizanur; Molla, Abul Hossain; Mostafizur Rahman, Mohammad; Khabir Uddin, Mohammad

    2015-04-01

    Degradation of soil and water from discharge of untreated industrial effluent is alarming in Bangladesh. Therefore, buildup of heavy metals in soil from contaminated effluent, their entry into the food chain and effects on rice yield were quantified in a pot experiment. The treatments were comprised of 0, 25%, 50%, 75% and 100% industrial effluents applied as irrigation water. Effluents, initial soil, different parts of rice plants and post-harvest pot soil were analyzed for various elements, including heavy metals. Application of elevated levels of effluent contributed to increased heavy metals in pot soils and rice roots due to translocation effects, which were transferred to rice straw and grain. The results indicated that heavy metal toxicity may develop in soil because of contaminated effluent application. Heavy metals are not biodegradable, rather they accumulate in soils, and transfer of these metals from effluent to soil and plant cells was found to reduce the growth and development of rice plants and thereby contributed to lower yield. Moreover, a higher concentration of effluent caused heavy metal toxicity as well as reduction of growth and yield of rice, and in the long run a more aggravated situation may threaten human lives, which emphasizes the obligatory adoption of effluent treatment before its release to the environment, and regular monitoring by government agencies needs to be ensured. Copyright © 2015. Published by Elsevier B.V.

  8. Study and Estimation of the Ratio of 137CS and 40K Specific Activities in Sandy and Loam Soils

    Directory of Open Access Journals (Sweden)

    Renata Mikalauskienė

    2011-12-01

    Full Text Available The present article describes changes in specific activities and fluctuations in the ratio of natural 40K and artificial 137Cs radionuclides in soil samples taken from different places of Lithuanian territory. The samples of soil have been selected from the districts polluted after the accident in Chernobyl nuclear plant performing nuclear testing operations. The study has established the main physical and chemical properties of soil samples and their impact on the concentration of 40K activities. 137Cs/40K specific activities in soil have been observed under the dry weight of the sample that varied from 0.0034 to 0.0240. The results of the study could be used for establishing and estimating 137Cs and 40K transfer in the system “soil-plant”.Article in Lithuanian

  9. Soil, crop and emission responses to seasonal-controlled traffic in organic vegetable farming on loam soil

    NARCIS (Netherlands)

    Vermeulen, G.D.; Mosquera Losada, J.

    2009-01-01

    Some organic arable and vegetable farms in the Netherlands use cm-precise guidance of machinery to restrict wheel traffic to fixed traffic lanes and to achieve non-trafficked cropping zones with optimized soil structure in between the lanes. Contrary to controlled traffic farming (CTF) the traffic

  10. Eleven years' effect of conservation practices for temperate sandy loams: I. Soil physical properties and topsoil carbon content

    DEFF Research Database (Denmark)

    Abdollahi, Lotfallah; Getahun, Gizachew Tarekegn; Munkholm, Lars Juhl

    2017-01-01

    (D) and harrowing to a depth of 8 to 10 cm (H). Soil sampling and in-field measurements were performed in autumn 2013 and spring 2014. In the field, soil structure was visually evaluated and penetration resistance (PR) measured. Soil C, wet stability (clay dispersion and wet aggregate stability....... However, H and D in combination with residue retention gave the best structural stability. Residue retention alleviated negative effects of reduced tillage on PR and improved wet stability in the MP treatment at the Foulum site. Clay and SOC correlated well with soil physical parameters, confirming...... their important role in soil structure formation and stabilization. Our study showed benefits of combining key CA elements, although longer-term studies are most likely needed to reveal the full potential....

  11. Dynamics study of a three-fold pseudo-Jahn–Teller system using the ...

    Indian Academy of Sciences (India)

    The theory shows unprecedented simplicity while depicting all features. ... Herzberg and Longuet–Higgins3 have shown in their pioneer- ing work that a real-valued electronic wave function changes sign when ... rected this deficiency with a complex phase factor in ... (the list can be numerous and hence only two references.

  12. Allowed Gamow-Teller excitations from the ground state of N-14

    Czech Academy of Sciences Publication Activity Database

    Aroua, S.; Navrátil, Petr; Zamick, L.; Fayche, M. S.; Barret, B. R.; Vary, J. P.; Heyde, K.

    2003-01-01

    Roč. 720, 1/2 (2003), s. 71-83 ISSN 0375-9474 Institutional research plan: CEZ:AV0Z1048901 Keywords : core shell-model * tensor interactions * light-nuclei Subject RIV: BE - Theoretical Physics Impact factor: 1.761, year: 2003

  13. PAULINA CHIZIANE: A STORY TELLER IN THE RYTHM OF (COUNTER- DANCE

    Directory of Open Access Journals (Sweden)

    Jorge Valentim

    2008-08-01

    Full Text Available The present work proposes a way of reading  Niketche, the most recent novel of the Mozambican writer Paulina Chiziane,  pointing at the musical resources as elements which participate in spoken practice. In the rhythm of dance, the characters' path is intertwined, as well as the construction of the text itself. Within a feminine vision of the world, a universe marked by musicality is created, by means of  rescaling the Portuguese language and the musical construction in the fictional text.

  14. In Search of Prototypes and Feminist Bank-Tellers: Exploring the Representativeness Heuristic

    OpenAIRE

    Nilsson, Håkan

    2008-01-01

    According to the heuristics and biases approach, the representativeness heuristic (RH) is one of the heuristics available for assessing subjective probabilities (A. Tversky & D. Kahneman, 1974). A subjective probability assessed by the RH is determined by how representative the target object is of the target category. Several aspects of the RH are argued to cause systematic biases, for example: (i) When the RH is used, the category is represented by one single prototypical exemplar. This ...

  15. Asymptotic iteration method for the modified Pöschl–Teller potential ...

    Indian Academy of Sciences (India)

    2017-01-04

    Jan 4, 2017 ... Relativistic energy equation is calculated numerically by the Matlab soft- ware. The increase in the radial quantum number nr causes a decrease in the energy value, and the wave functions of the radial and the angular parts are expressed in terms of hypergeometric functions. Some thermodynamical.

  16. Tants pühib linnaruumilt ajalootolmu / Madli Teller ; intervjueerinud Evelin Lagle

    Index Scriptorium Estoniae

    Teller, Madli

    2010-01-01

    2011. aasta Euroopa kultuuripealinna programmi raames eesti ja soome noorte tantsukunstnike koostööprojektist "Old Spaces Living Art" ("Eakade paikade elav kunst"), kus ühendatakse nüüdistants ja Tallinna ajalooline linnaruum

  17. Inelastic electron scattering, fine structure of M1 giant resonances and Gamow-Teller states

    International Nuclear Information System (INIS)

    Richter, A.

    1983-01-01

    Recent progress in obtaining detailed fine structure distributions of magnetic giant resonances in nuclei using high resolution inelastic electron scattering at low energy is discussed. Specific examples chosen are the medium heavy nuclei 40 42 44 48 Ca in which M1 excitations are due to neutron spin-flip transitions and the N=28 isotones 50 Ti, 52 Cr and 54 Fe where in addition also proton excitations contribute to the measured M1 strength. It is found that the M1 strength is very fragmented and considerably quenched in comparison to predictions of shell model calculations in a model space that includes up to 2p-2h excitations. Finally, the old problem of M1 strength in 208 Pb is revisited and the results of a form factor measurement of a recently discovered low lying Jsup(π)=1 + state by nuclear resonance fluorescence are presented. (Auth.)

  18. Investigating the relationship between psychosocial work stressors, organizational structure and job satisfaction among bank tellers

    Directory of Open Access Journals (Sweden)

    S. Chahardoli

    2015-12-01

      Conclusion: Considering the effect of organizational structure and work-related psychosocial stressors on job satisfaction, it can be stated that organizational restructuring to achieve organic structures and paying more attention to psychosocial stressors in the workplace, can play an effective role in the efficiency and productivity of the organization.

  19. Gamow–Teller 1+ states in 112−124Sb isotopes

    Indian Academy of Sciences (India)

    section is dominated by GT transitions with ∆L = 0, ∆S = 1 and ∆Jπ = 1+. The cross-section, extrapolated to zero-momentum transfer, is proportional to the GT strength between the same states. Out of these reactions, the (p, n) reaction is the most common, and for several years, this was used successfully in the investigation.

  20. E x circle epsilon Jahn-Teller anharmonic coupling for an octahedral system

    CERN Document Server

    Avram, N M; Kibler, M R

    2001-01-01

    The coupling between doubly degenerate electronic states and doubly degenerate vibrations is analyzed for an octahedral system on the basis of the introduction of an anharmonic Morse potential for the vibronic part. The vibrations are described by anharmonic coherent states and their linear coupling with the electronic states is considered. The matrix elements of the vibronic interaction are built and the energy levels corresponding to the interaction Hamiltonian are derived.

  1. Renner-Teller modelling of recent experimental spectra of H{sub 2}S{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Duxbury, Geoffrey [Department of Physics, SUPA, University of Strathclyde, John Anderson Building, 107 Rottenrow, Glagow G4 0NG, Scotland (United Kingdom)

    2015-01-22

    Recently there has been a renewal of interest in the spectroscopy and dynamics of the formation and fragmentation of the hydrogen sulphide ion, including. rotationally resolved spectra of higher vibrational states of the ∼A{sup 2}A{sub 1}−∼X{sup 2}B{sub 1} system than were obtained previously, and a comprehensive imaging study of the photo-fragmentation routes of highly excited H{sub 2}S{sup +}. In collaboration with Ch. Jungen and A. Alijah I have extended our previous l basis approach to the calculation of the effects of orbital angular momentum in H{sub 2}S{sup +} to include the stretch - bender extensions, with the options of using either the K- or l basis. This new code is being used to calculate the complicated orbital angular momentum and spin-orbit coupling effects responsible for the ro-vibronic pattern measured in some of the new experimental results.

  2. Asymptotic iteration method for the modified Pöschl–Teller potential ...

    Indian Academy of Sciences (India)

    Relativistic energy equation is calculated numerically by the Matlab software. The increase in the radial quantum number nr causes a decrease in the energy value, and the wave functions of the radial and the angular parts are expressed in terms of hypergeometric functions. Some thermodynamical properties of the system ...

  3. Sex differences on a measure of conformity in automated teller machine lines.

    Science.gov (United States)

    Reysen, Stephen; Reysen, Matthew B

    2004-10-01

    Sex differences in conformity were examined as participants approached two ATMs, one of which was occupied by three confederates and the other immediately available. The number of men and women in the line in front of one of the ATMs was manipulated (3 men or 3 women), and an unobtrusive observer recorded the sex of each participant. The results indicated that women were more likely than men to wait in line to use the ATM regardless of the makeup of the line. Thus, the present study provides evidence in favor of the idea that sex differences in conformity are evident on a common task performed in a natural setting.

  4. Analisis Tingkat Kepentingan Dan Kinerja Layanan Automated Teller Machine (Atm) Bank Mandiri

    OpenAIRE

    Setiawati, Lenny; Sugiharto, Toto

    2008-01-01

    Penelitian ini ditujukan untuk menganalisis tingkat kepentingan dan kinerja layananATM Bank Mandiri. Analisis Servqual yang terdiri atas dimensi tangible, realibility,responsiveness, assurance,dan empathy digunakan untuk menganalisis kinerjalayanan ATM. Sementara itu, Customer Satisfaction Index dan ImportancePerformance Analysis yang terdiri atas analisis kuadran dan analisis kesenjangandigunakan untuk menginvestigasi kepuasan pelanggan dan untuk mengidentifikasikandimensi layanan yang kiner...

  5. EVALUACIÓN DE LOS PROTOCOLOS IPSEC Y SSL EN LA TRANSMISIÓN SEGURA DE IMÁGENES DIAGNOSTICAS EN TELERADIOLOGIA UTILIZANDO EL ESTÁNDAR DICOM

    Directory of Open Access Journals (Sweden)

    Jorge Luis Lugo Rosero

    2011-08-01

    Full Text Available Las imágenes diagnosticas digitales constituyen hoy día un paradigma de requerimientos para cualquier sistema informático; se debe garantizar la confidencialidad de la información médica de los pacientes mediante sistemas de comunicación seguros, cumpliendo de esta manera con las políticas de control de calidad en técnicas de Teleradiologia. En este articulo primero se describe un escenario típico de comunicación entre los dispositivos de captura de placas y los elementos de visualizacion y almacenamiento de las mismas, asi como la forma en la que se transmiten dichas tomas diagnosticas de un sitio a otro, posteriormente se realiza la comparación entre  los protocolos más utilizados en esta tarea y finalmente se analizan los resultados obtenidos al transmitir varios estudios medicos por una red LAN garantizando la seguridad y confidencialidad de los datos de trabajo.

  6. RAD25(SSL2), a yeast homolog of the human xeroderma pigmentosum group B DNA repair gene, is essential for viability.

    NARCIS (Netherlands)

    E. Park (Robert); S.N. Guzder; M.H.M. Koken (Marcel); I. Jaspers-Dekker (Iris); G. Weeda (Geert); J.H.J. Hoeijmakers (Jan); S. Prakash; L. Prakash

    1992-01-01

    textabstractXeroderma pigmentosum (XP) patients are extremely sensitive to ultraviolet (UV) light and suffer from a high incidence of skin cancers, due to a defect in nucleotide excision repair. The disease is genetically heterogeneous, and seven complementation groups, A-G, have been identified.

  7. 基于OpenSSL的VNC安全性研究及实现%Study and Implementation of VNC Security Based on OpenSSL

    Institute of Scientific and Technical Information of China (English)

    李建设; 吴庆波

    2005-01-01

    VNC以其真正的瘦客户技术和平台独立性,在网络计算领域得到了广泛的应用,但它在网络安全性方面存在缺陷,使其难以应用于企业应用服务系统中.在分析VNC安全机制的基础上,提出了解决方案,并利用Openssl中提供的密码算法库,实现其安全解决方案.

  8. p44 and p34 subunits of the BTF2/TFIIH transcription factor have homologies with SSL1, a yeast protein involved in DNA repair.

    NARCIS (Netherlands)

    S. Humbert; H. van Vuuren; Y. Lutz; J.H.J. Hoeijmakers (Jan); J-M. Egly (Jean-Marc); V. Moncollin

    1994-01-01

    textabstractThe human BTF2 (TFIIH) transcription factor is a multisubunit protein involved in transcription initiation by RNA polymerase II (B) as well as in DNA repair. In addition to the previously characterized p62 and p89/ERCC3 subunits, we have cloned two other subunits of BTF2, p44 and p34.

  9. Toxicity Assessments of Antimony, Barium, Beryllium, and Manganese for Development of Ecological Soil Screening Levels (ECO-SSL) Using Earthworm (Eisenia Fetida) Benchmark Values

    National Research Council Canada - National Science Library

    Simini, Michael

    2002-01-01

    ... soil that supports relatively high bioavailability of barium (Ba), beryllium (Be), manganese (Mn), and antimony (Sb). For the metals tested, cocoon production was a more sensitive endpoint than was survival...

  10. Jahn-Teller and Non-Jahn-Teller Systems Involving CuF64- Units: Role of the Internal Electric Field in Ba2ZnF6:Cu2+ and Other Insulating Systems

    DEFF Research Database (Denmark)

    Aramburu, J. A.; Garcia-Fernandez, P.; García Lastra, Juan Maria

    2017-01-01

    transitions for CuF64- units formed in Cu2+-doped the tetragonal Ba2ZnF6 host lattice. While the experimental d-d transitions cannot be reproduced through the isolated CuF64- unit at the equilibrium geometry, a reasonable agreement is reached adding in the calculation the internal electric field, ER...... it is pointed out that a quasi-JT situation can however happen for a d9 ion in a cubic lattice under a strain of ∼10-3 in agreement with experimental data. The present results stress the key role played by the internal electric fields for a quantitative understanding of compounds with transition metal cations...

  11. Negative plate macropore surfaces in lead-acid batteries: Porosity, Brunauer-Emmett-Teller area, and capacity

    Energy Technology Data Exchange (ETDEWEB)

    D' Alkaine, C.V.; de O. Brito, G.A. [Group of Electrochemistry and Polymers, DQ-UFSCar, Rodovia Washington Luis, Km 235, CP 676, 13565-905 Sao Carlos (SP) (Brazil)

    2009-06-01

    We propose an explanation for the production of an electrochemically active area during the electrochemical formation of lead-acid battery negative plates based on solid-state reactions. Our proposal is supported by experimental data. This study includes a critical review of the literature on charge/discharge mechanisms, porosity, and BET area. The critical review, through the latter two parameters, indicates the existence of both macro and micropores in positive plates, but only macropores in negative plates, with characteristic surface roughness. In the present paper the surface sulfation of the precursor is controlled using various acidic, neutral and alkaline solutions during an electrochemical formation process that does not include soaking. Our results confirm that variable roughness can be produced at the negative plate macropore surfaces. The morphological changes produced by different formation conditions are assessed by measuring the macroporosity, BET area, and capacity of single negative plates. Based on these concepts, a method was developed and applied to measure independently the contributions of geometrical surface macroporosity and roughness to the negative plate capacity. (author)

  12. Band Jahn-Teller effect on the density of states of the magnetic high-Tc superconductors: A model study

    International Nuclear Information System (INIS)

    Pradhan, B.; Mohanta, K.L.; Rout, G.C.

    2012-01-01

    We report here a mean-field study of competing antiferromagnetism, superconductivity and lattice strain phases and their effect on the local density of states of the cuprate system. Our model Hamiltonian incorporating these interactions is reported earlier [G.C. Rout et al., Physica C, 2007]. The analytic expression for superconducting, antiferromagnetism and lattice strain order parameters are calculated and solved self-consistently. The interplay of these order parameters is investigated considering the calculated density of states (DOSs) of the conduction electrons. The DOS displays multiple gap structures with multiple peaks. It is suggested that the tunneling conductance data obtained from the scanning tunneling microscopy (STM) measurements could be interpreted by using the quasi-particle bands calculated from our model Hamiltonian. We have discussed the mechanism to calculate the order parameters from the conductance data.

  13. Beta-decay of {sup 103}In: evidence for the Gamow-Teller resonance near {sup 100}Sn

    Energy Technology Data Exchange (ETDEWEB)

    Karny, M. [Warsaw Univ. (Poland). Inst. of Experimental Physics; Batist, L.; Brown, B.A. [and others

    1998-04-01

    The {beta} decay of the neutron-deficient isotope {sup 103}In was investigated by using total absorption {gamma}-ray spectrometry on mass-separated sources. The measurement reveals a high-lying resonance of the {beta}-decay strength in striking disagreement with high-resolution {gamma}-ray data. The result is discussed in comparison with shell-model predictions. (orig.)

  14. The Edward Teller medal lecture: The evolution toward Indirect Drive and two decades of progress toward ICF ignition and burn

    International Nuclear Information System (INIS)

    Lindl, J.D.

    1993-12-01

    In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program. I have had the good fortune of working with an outstanding team of scientists who have established LLNL as the premier ICF laboratory in the world. John Emmett and the LLNL Laser Science team were responsible for developing a series of lasers from Janus to Nova which have given LLNL unequaled facilities. George Zimmerman and the LASNEX group developed the numerical models essential for projecting future performance and requirements as well as for designing and analyzing the experiments. Bill Kruer, Bruce Langdon and others in the plasma theory group developed the fundamental understanding of laser plasma interactions which have played such an important role in ICF. And a series of experiment program leaders including Mike Campbell and Joe Kilkenny and their laser experimental teams developed the experimental techniques and diagnostic capabilities which have allowed us to c increasingly complex and sophisticated experiments

  15. Surface Area Analysis Using the Brunauer-Emmett-Teller (BET) Method: Standard Operating Procedure Series: SOP-C

    Science.gov (United States)

    2016-09-01

    provide a foundational understanding of the steps involved, how to per- form them in a repeatable and reliable manner , and to provide the theory behind...how to perform them in a repeatable and reliable manner , and to provide the theory behind the analysis. 15. SUBJECT TERMS Surface area, BET

  16. The Edward Teller Medal Lecture: the Evolution Toward Indirect Drive and Two Decades of Progress Toward Icf Ignition and Burn

    Science.gov (United States)

    Lindl, John D.

    In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program.

  17. Does the delta quench Gamow-Teller strength in (p,n)- and (p vector,p vector')-reactions

    International Nuclear Information System (INIS)

    Osterfeld, F.; Schulte, A.; Udagawa, T.; Yabe, M.

    1986-01-01

    Microscopic analyses of complete forward angle intermediate energy (p,n)-, ( 3 He,t)- and (p vector,p vector')-spin-flip spectra are presented for the reactions 90 Zr(p,n), 90 Zr( 3 He,t) and 90 Zr(p vector,p vector'). It is shown that the whole spectra up to high excitation energies (E X ∝50 MeV) are the result of correlated one-particle-one-hole (1p1h) spin-isospin transitions only. The spectra reflect, therefore, the linear spin-isospin response of the target nucleus to the probing external hadronic fields. Our results suggest that the measured (p,n)-, ( 3 He,t)- and (p vector,p vector')-cross sections are compatible with the transition strength predictions as obtained from random phase approximation (RPA) calculations. This means that the Δ isobar quenching mechanism is likely to be rather small. (orig.)

  18. The Edward Teller medal lecture: The evolution toward Indirect Drive and two decades of progress toward ICF ignition and burn

    Energy Technology Data Exchange (ETDEWEB)

    Lindl, J.D.

    1993-12-01

    In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John`s seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program. I have had the good fortune of working with an outstanding team of scientists who have established LLNL as the premier ICF laboratory in the world. John Emmett and the LLNL Laser Science team were responsible for developing a series of lasers from Janus to Nova which have given LLNL unequaled facilities. George Zimmerman and the LASNEX group developed the numerical models essential for projecting future performance and requirements as well as for designing and analyzing the experiments. Bill Kruer, Bruce Langdon and others in the plasma theory group developed the fundamental understanding of laser plasma interactions which have played such an important role in ICF. And a series of experiment program leaders including Mike Campbell and Joe Kilkenny and their laser experimental teams developed the experimental techniques and diagnostic capabilities which have allowed us to c increasingly complex and sophisticated experiments.

  19. Uranium favorability of tertiary rocks in the Badger Flats, Elkhorn Thrust Area, Park and Teller Counties, Colorado

    International Nuclear Information System (INIS)

    Young, P.; Mickle, D.G.

    1976-10-01

    Uranium potential of Tertiary rocks in the Badger Flats--Elkhorn Thrust area of central Colorado is closely related to a widespread late Eocene erosion surface. Most uranium deposits in the area are in the Eocene Echo Park Alluvium and Oligocene Tallahassee Creek Conglomerate, which were deposited in paleodrainage channels on or above this surface. Arkosic detritus within the channels and overlying tuffaceous sedimentary rocks of the Antero and Florissant Formations of Oligocene age and silicic tuffs within the volcanic units provide abundant sources of uranium that could be concentrated in the channels where carbonaceous debris facilitates a reducing environment. Anomalous soil, water, and stream-sediment samples near the Elkhorn Thrust and in Antero basin overlie buried channels or are offset from them along structural trends; therefore, uranium-bearing ground water may have moved upward from buried uranium deposits along faults. The area covered by rocks younger than the late Eocene erosion surface, specifically the trends of mapped or inferred paleochannels filled with Echo Park Alluvium and Tallahassee Creek Conglomerate, and the Antero Formation are favorable for the occurrence of uranium deposits

  20. Uranium favorability of precambrian rocks in the Badger Flats - Elkhorn Thrust Area, Park and Teller Counties, Colorado

    International Nuclear Information System (INIS)

    Gallagher, G.L.

    1976-10-01

    The area is approximately 1,800 square miles and extends from Cripple Creek northward to Fairplay and Bailey. The Precambrian rocks include the metamorphic sequences of the Idaho Springs Formation and the Boulder Creek Granodiorite, Silver Plume Granite, Pikes Peak Granite, and Redskin Granite. The known uranium deposits in the area include six vein deposits, three pegmatite occurrences, and one zone of probable secondary enrichment; they have not yielded any significant production. The vein deposits are probably the result of downward percolation of ground water. The zone of secondary uranium enrichment may have formed above a volcanic pipe, vein, or tuffaceous lake bed. Favorability in the area is considered good for both vein and large, disseminated, low-grade uranium deposits. On the bases of known uranium occurrences, favorable structures and host rocks, and a water-sampling program, recommendations are given for exploration. The occurrences in the area have substantial similarities with the Rossing deposit in South-West Africa and the Wheeler Basin uranium occurrence in Grand County, Colorado. 6 figures, 9 tables

  1. Hibiscus sabdariffa L

    African Journals Online (AJOL)

    TEKWA IJASINI JOHN

    P application increased K and Mg, but reduced Ca contents of shoots. Application of P did ... of natural coloring and flavoring agent in food and fruit processing industries (Mc Clintock, 2004). The seeds .... loam. Loam. Sandy loam Clay loam.

  2. Analysis of some parameters related to the hydraulic infiltration of a silty-loam soil subjected to organic and mineral fertilizer systems in Southern Italy

    Directory of Open Access Journals (Sweden)

    Antonietta Napolitano

    2011-05-01

    Full Text Available This experiment was carried out to detect the most linear process to calculate the hydraulic conductivity, with the aim to classify the soil of experimental station of the Unit for Research in Cultivations Alternative to Tobacco (CAT, locate in South Italy (Scafati, Province of Salerno, subject to different types of manure: compost and mineral fertilizer. The field tests were made by a system measuring infiltration by double, inner and outer ring, inserted into the ground. Each ring was supplied with a constant level of water from external bottle (3 cm, and hydraulic conductivity is determined when the water flow rate in the inner ring is constant. Four areas, two fertilized by mineral fertilizer (areas I and III and two amended with compost (areas II and IV at two depths, 5 and 10 cm (H1-H2, were analysed. The parameters were recorded at the following dates: on 18th and 19th September 2009, respectively, at 5 and 10 cm of depth (H1-H2 in area I; on 7th and 8th October 2009 in area II; on 13th and 14th October 2009 in area III; on 16th and 17th October 2009 in area IV. The effect of compost, used one time only, is present in all parameters, even if with a low statistical significance (P<0.01-0.05. This biomass stores a better water reserve [g (100 g–1-Δθ] and causes a lower avidity for water (bibacity and a better speed of percolation (Ks of exceeding water. The organic matter decreased the variability of soil along field. The studied soil showed to be almost permeable and not having any serious problem concerning rain intensity.

  3. Toxicity of RDX, HMX, TNB, 2,4-DNT, and 2,6-DNT to the Earthworm, Eisenia Fetida, in a Sandy Loam Soil

    National Research Council Canada - National Science Library

    Simini, Michael; Checkai, Ronald T; Kuperman, Roman G; Phillips, Carlton T; Kolakowski, Jan E; Kurnas, Carl W; Sunahara, Geoffrey I

    2006-01-01

    ...), and 1,3,5-trinitrobenzene (TNB) to fill the data gaps. Tests were conducted in freshly amended and in amended soils subjected to a weathering/aging process to better reflect exposure conditions in field soils...

  4. Effects of cropping system and rates of nitrogen in animal slurry and mineral fertilizer on nitrate leaching from a sandy loam

    DEFF Research Database (Denmark)

    Thomsen, Ingrid Kaag; Hansen, Jørgen Frederik; Kjellerup, Viggo K.

    1993-01-01

    ammonium nitrate (CAN) or animal slurry according to recommended rates (1N) or 50% above recommended rates (1.5N). Compared with unfertilized crops, leaching of nitrate increased only slightly when 1N (CAN) was added. Successive annual additions of 1.5N (CAN) or IN and 1.5N (animal slurry) caused...

  5. Ridge sowing of sunflower (Helianthus annuus L.) in a minimum till system improves the productivity, oil quality, and profitability on a sandy loam soil under an arid climate.

    Science.gov (United States)

    Sher, Ahmad; Suleman, Muhammad; Qayyum, Abdul; Sattar, Abdul; Wasaya, Allah; Ijaz, Muhammad; Nawaz, Ahmad

    2018-04-01

    Sunflower (Helianthus annuus L.) is a major oilseed crop grown for its edible oil across the globe including Pakistan. In Pakistan, the production of edible oil is less than the required quantity; the situation is being worsened with the increasing population. Thus, there is dire need to grow those sunflower genotypes which perform better under a given set of agronomic practices. In this 2-year study, we compared four sunflower genotypes, viz., Armoni, Kundi, Sinji, and S-278 for their yield potential, oil contents, fatty acid composition, and profitability under three sowing methods, viz., bed sowing, line sowing, and ridge sowing and two tillage system, viz., plow till and minimum till. Among the sunflower genotypes, the genotype Armoni produced the highest plant height, number of leaves, head diameter, 1000-achene weight, and achene yield; the oil contents and oleic acid were the highest in genotype Sinji. Among the sowing methods, the highest number of leaves per plant, head diameter, number of achenes per head, achene yield, and oil contents were recorded in ridge sowing. Among the tillage systems, the highest head diameter 16. 2 cm, 1000-achene weight (57.2 g), achene yield (1.8 t ha -1 ), oil contents (35.2%), and oleic acid (15.2%) were recorded in minimum till sunflower. The highest net benefits and benefit to cost ratio were recorded in minimum till ridge sown Armoni genotype. In conclusion, the genotype Armoni should be grown on ridges to achieve the highest achene yield, oil contents, and net profitability.

  6. Toxicity of RDX, HMX, TNB, 2,4-DNT, and 2,6-DNT to the Earthworm, Eisenia Fetida, in a Sandy Loam Soil

    National Research Council Canada - National Science Library

    Simini, Michael; Checkai, Ronald T; Kuperman, Roman G; Phillips, Carlton T; Kolakowski, Jan E; Kurnas, Carl W; Sunahara, Geoffrey I

    2006-01-01

    ...) for ecological risk assessment of soil contaminants at Superfund sites. Insufficient information existed to generate Eco-SSLs for explosives and related materials in soil. The earthworm (Eisenia fetida...

  7. Defying the Definition of Insanity: Assessing the Robust Nature of University Outreach in the Community Using Carnegie Community Engagement Classification and Lynch Outreach Assessment Model (LOAM)

    Science.gov (United States)

    Lynch-Alexander, Erin

    2017-01-01

    Duplicating processes and procedure with anticipation of deviating outcomes is the defining trait of insanity as attributed to a quote by Albert Einstein. It is the antithesis to innovation, which is what is needed in higher education to create impactful changes in the outreach we should be providing to the community. What is important for those…

  8. Enhancement of physical and hydrological properties of a sandy loam soil via application of different biochar particle sizes during incubation period

    Directory of Open Access Journals (Sweden)

    Leila Esmaeelnejad

    2016-06-01

    Full Text Available In spite of many studies that have been carried out, there is a knowledge-gap as to how different sizes of biochars alter soil properties. Therefore, the main objective of this study was to investigate the effects of different sizes of biochars on soil properties. The biochars were produced at two pyrolysis temperatures (350 and 550°C from two feedstocks (rice husk and apple wood chips. Produced biochars were prepared at two diameters (1-2 mm and <1 mm and mixed with soil at a rate of 2% (w/w. Multiple effects of type, temperature and size of biochars were significant, so as the mixture of soil and finer woodchip biochars produced at 550°C had significant effects on all soil properties. Soil aggregation and stabilization of macro-aggregates, values of mean weight diameter and water stable aggregates were improved due to increased soil organic matter as binding agents and microbial biomass. In addition, plant available water capacity, air capacity, S-index, meso-pores and water retention content were significantly increased compared to control. But, saturated hydraulic conductivity (Ks was reduced due to blockage of pores by biochar particles, reduction of pore throat size and available space for flow and also, high field capacity of biochars. So, application of biochar to soil, especially the finest particles of high-tempered woody biochars, can improve physical and hydrological properties of coarse-textured soils and reduce their water drainage by modification of Ks.

  9. Enhancement of physical and hydrological properties of a sandy loam soil via application of different biochar particle sizes during incubation period

    Energy Technology Data Exchange (ETDEWEB)

    Esmaeelnejad, L.; Shorafa, M.; Gorji, M.; Hosseini, S.M.

    2016-11-01

    In spite of many studies that have been carried out, there is a knowledge-gap as to how different sizes of biochars alter soil properties. Therefore, the main objective of this study was to investigate the effects of different sizes of biochars on soil properties. The biochars were produced at two pyrolysis temperatures (350 and 550°C) from two feedstocks (rice husk and apple wood chips). Produced biochars were prepared at two diameters (1-2 mm and <1 mm) and mixed with soil at a rate of 2% (w/w). Multiple effects of type, temperature and size of biochars were significant, so as the mixture of soil and finer woodchip biochars produced at 550°C had significant effects on all soil properties. Soil aggregation and stabilization of macro-aggregates, values of mean weight diameter and water stable aggregates were improved due to increased soil organic matter as binding agents and microbial biomass. In addition, plant available water capacity, air capacity, S-index, meso-pores and water retention content were significantly increased compared to control. But, saturated hydraulic conductivity (Ks) was reduced due to blockage of pores by biochar particles, reduction of pore throat size and available space for flow and also, high field capacity of biochars. So, application of biochar to soil, especially the finest particles of high-tempered woody biochars, can improve physical and hydrological properties of coarse-textured soils and reduce their water drainage by modification of Ks. (Author)

  10. Study of material stability surrounding with loess-clay-loam rocks on an example of 'Olviya' monument of Ukrainian Northern Prichernomor'ya

    International Nuclear Information System (INIS)

    Zlobenko, B.; Kadoshnikov, V.; Manichev, V.; Demchenko, L.; Golovko, T.; Krapivina, V.

    2000-01-01

    In this work we have examined the archaeological material exhumed from the archaeology monument Olviya. The ancient State Olviya is situated on the territory of Ukraine (Nikolaev region) and it is considered to be an integral part of the world historical legacy. The samples of glasses were collected from P-25 excavation. The collected glasses and metals dated by I-II centuries of our era. They are situated in the south-east part of the Upper State on the territory of the Rome times. Study with the facilitation of physical-chemical and physical methods of research of chemical structure and surface layers of materials. The various physical methods of samples investigation were the following: investigation with half-quantitative spectral analysis performed on spectrograph (CTE-1); X-ray powder diffraction with DRON-UM-1 diffractometers use, X-ray fluorescent analysis (spectrometer VPA-30) and the x-ray microanalysis (JXA-5). Carried out microscopic researches have revealed the specific forms of metals and glasses; corrosion and dissolution of the surface that character is determined by structure and physic-chemical conditions of its burial place. (authors)

  11. Growth and yield response of hybrid maize (Zea mays L. to phosphorus levels in sandy loam soil of Chitwan Valley, Nepal

    Directory of Open Access Journals (Sweden)

    Bandhu Raj Baral

    2015-06-01

    Full Text Available To evaluate the phosphorus response on winter hybrid maize, a field experiment was conducted at farm land of National Maize Research Program, Rampur, Chitwan, Nepal on 2012 and 2013. Seven levels of Phosphorus i.e. 0, 20, 40, 60, 80, 100 and 120 kg P2O5 ha-1 were applied along with 160:40 kg N:K2O ha-1. The experiment was laid out in randomized complete block design with three replications. Hybrid maize RML 32 × RML 17 was used for this study. Analysis of variance showed that plant height (cm, dry matter accumulation (g, number of kernels per row, 1000 grain weight (g and grain yield (ton ha-1 were significantly affected with Phosphorus level. The results showed that the trend of increment was positive for grain yield with increased P level from 0 to 80 kg P2O5 ha-1. The highest grain yield (10.77 ton ha-1 was measured when 120 kg P2O5 ha-1 is applied. It is concluded that 80 kg P2O5 ha-1 can be applied in winter season for hybrid maize RML-32 × RML-17 in Chitwan valley low land irrigated condition. Further studies are necessary on different soil types, seasons, management system and varieties to get more information about the most proper addition of P on maize. DOI: http://dx.doi.org/10.3126/ije.v4i2.12634 International Journal of Environment Vol.4(2 2015: 147-156

  12. Common bean growth, N uptake and seed production in sandy loam soil as affected by application of plant residues, nitrogen and irrigation level

    International Nuclear Information System (INIS)

    Abdallah, A.A.G.

    2002-01-01

    Field experiment was conducted at the experimental farm, Inshas, atomic energy authority, egypt. Common bean seeds e.v. Nebrasks were cultivated in sandy loan soil using drip irrigation system prepared for this purpose. Two water regimes, i.e., 100% (793.0 m 3 /fed.) and 65% (513.0 m 3 /fed.) of maximum available water were used in main plots. Where in sub plots two fertilizers types were applied i.e., soybean plant residues which contains N 15 labelled as an organic matter without any addition of any fertilizer and nitrogen as chemical fertilizer without using organic matter. The obtained results indicated that, application of plant residues was superior for total seed yield comparing to nitrogen fertilization treatments. This N source with irrigation level of 793.33 m 3 /fed. had a slight increase in total seed yield comparing with (513.0 m 3 /fed.). Irrigation level of 513.0 m 3 /fed. (65% MAW) as well as application of soybean plant residues showed the highest value of water use efficiency. The highest value of N seed percentage was obtained irrigation level with (513.0 m 3 /fed.). Soybean plant residues improved and increased seeds N content, and total seeds protein content. Both N chemical and irrigation level (65% Maw) recorded highest values with N 15 % atom excess. This result has been obtained at two growth stages and seed yield. The same trend of N 15 % atom excess reflected N utilized with both growth stages and seed yield

  13. Effects of organic versus conventional arable farming on soil structure and organic matter dynamics in a marine loam in the Netherlands

    NARCIS (Netherlands)

    Pulleman, M.M.; Jongmans, A.G.; Marinissen, J.C.Y.; Bouma, J.

    2003-01-01

    We compared the effects of conventional and organic arable farming on soil organic matter (SOM) content, soil structure, aggregate stability and C and N mineralization, which are considered important factors in defining sustainable land management. Within one soil series, three different farming

  14. The influence of clay-to-carbon ratio on soil physical properties in a humid sandy loam soil with contrasting tillage and residue management

    DEFF Research Database (Denmark)

    Getahun, Gizachew Tarekegn; Munkholm, Lars Juhl; Schjønning, Per

    2016-01-01

    × SOC according to Dexter et al. (2008). NCC was a better predictor of dispersible clay than total clay and SOC at all depths in natural aggregates, while tensile strength and derived parameters were generally better explained by the total amount of clay in remoulded aggregates. Remoulded aggregates had...

  15. Field Performance of the Disk Harrow, Power Harrow and Rotary Tiller at Different Soil Moisture Contents on a Clay Loam Soil in Mazandaran

    Directory of Open Access Journals (Sweden)

    M Rajabi Vandechali

    2015-03-01

    Full Text Available About 60% of the mechanical energy consumed in mechanized agriculture is used for tillage operations and seedbed preparation. On the other hand, unsuitable tillage system resulted in soil degradation, affecting soil physical properties and destroying soil structure. The objective of this research was to compare the effects of three types of secondary tillage machines on soil physical properties and their field performances. An experiment was conducted in a wheat farm in Jouybar area of Mazandaran as split plots based on randomized complete block design with three replications. The main independent variable (plot was soil moisture with three levels (23.6-25, 22.2-23.6 and 20.8-22.2 percent based on dry weight and the subplot was three types of machine (two-disk perpendicular passing harrow, Power harrow and Rotary tiller. The measured parameters included: clod mean weight diameter, soil bulk density, specific fuel consumption, machine efficiency and machine capacity. The effects of treatments and their interactions on the specific fuel consumption, machine efficiency and machine capacity and also the effects of treatments on bulk density were significant (P

  16. Solid-State Lighting R&D Plan - 2016

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2016-06-30

    The SSL R&D Plan provides analysis and direction for ongoing R&D activities to advance SSL technology and increase energy savings. The R&D Plan also reviews SSL technology status and trends for both LEDs and OLEDs and offers an overview of the current DOE SSL R&D project portfolio.

  17. Toxicity and uptake of cyclic nitramine explosives in ryegrass Lolium perenne

    International Nuclear Information System (INIS)

    Rocheleau, Sylvie; Lachance, Bernard; Kuperman, Roman G.; Hawari, Jalal; Thiboutot, Sonia; Ampleman, Guy; Sunahara, Geoffrey I.

    2008-01-01

    Hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX), octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX), and 2,4,6,8,10,12-hexanitro-2,4,6,8,10,12-hexaazaisowurtzitane (CL-20) are cyclic nitramines used as explosives. Their ecotoxicities have been characterized incompletely and little is known about their accumulation potential in soil organisms. We assessed the toxicity and uptake of these explosives in perennial ryegrass Lolium perenne L. exposed in a Sassafras sandy loam (SSL) or in a sandy soil (DRDC, CL-20 only) containing contrasting clay contents (11% and 0.3%, respectively). A 21-d exposure to RDX, HMX or CL-20 in either soil had no adverse effects on ryegrass growth. RDX and HMX were translocated to ryegrass shoots, with bioconcentration factors (BCF) of up to 15 and 11, respectively. In contrast, CL-20 was taken up by the roots (BCF up to 19) with no translocation to the shoots. These studies showed that RDX, HMX, and CL-20 can accumulate in plants and may potentially pose a risk of biomagnification across the food chain. - Cyclic nitramine explosives accumulate in perennial ryegrass and exhibit distinct uptake patterns

  18. Toxicity and uptake of cyclic nitramine explosives in ryegrass Lolium perenne

    Energy Technology Data Exchange (ETDEWEB)

    Rocheleau, Sylvie; Lachance, Bernard [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada); Kuperman, Roman G. [Edgewood Chemical Biological Center, 5183 Blackhawk Road, Aberdeen Proving Ground, MD 21010-5424 (United States); Hawari, Jalal [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada); Thiboutot, Sonia; Ampleman, Guy [Defense Research and Development Canada, 2459 Pie IX Boulevard, Val Belair, Quebec G3J 1X5 (Canada); Sunahara, Geoffrey I. [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada)], E-mail: geoffrey.sunahara@cnrc-nrc.gc.ca

    2008-11-15

    Hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX), octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine (HMX), and 2,4,6,8,10,12-hexanitro-2,4,6,8,10,12-hexaazaisowurtzitane (CL-20) are cyclic nitramines used as explosives. Their ecotoxicities have been characterized incompletely and little is known about their accumulation potential in soil organisms. We assessed the toxicity and uptake of these explosives in perennial ryegrass Lolium perenne L. exposed in a Sassafras sandy loam (SSL) or in a sandy soil (DRDC, CL-20 only) containing contrasting clay contents (11% and 0.3%, respectively). A 21-d exposure to RDX, HMX or CL-20 in either soil had no adverse effects on ryegrass growth. RDX and HMX were translocated to ryegrass shoots, with bioconcentration factors (BCF) of up to 15 and 11, respectively. In contrast, CL-20 was taken up by the roots (BCF up to 19) with no translocation to the shoots. These studies showed that RDX, HMX, and CL-20 can accumulate in plants and may potentially pose a risk of biomagnification across the food chain. - Cyclic nitramine explosives accumulate in perennial ryegrass and exhibit distinct uptake patterns.

  19. The TLR2 Antagonist Staphylococcal Superantigen-Like Protein 3 Acts as a Virulence Factor to Promote Bacterial Pathogenicity in vivo.

    Science.gov (United States)

    Koymans, Kirsten J; Goldmann, Oliver; Karlsson, Christofer A Q; Sital, Wiedjai; Thänert, Robert; Bisschop, Adinda; Vrieling, Manouk; Malmström, Johan; van Kessel, Kok P M; de Haas, Carla J C; van Strijp, Jos A G; Medina, Eva

    2017-01-01

    Toll-like receptor (TLR) signaling is important in the initiation of immune responses and subsequent instigation of adaptive immunity. TLR2 recognizes bacterial lipoproteins and plays a central role in the host defense against bacterial infections, including those caused by Staphylococcus aureus. Many studies have demonstrated the importance of TLR2 in murine S. aureus infection. S. aureus evades TLR2 activation by secreting two proteins, staphylococcal superantigen-like protein 3 (SSL3) and 4 (SSL4). In this study, we demonstrate that antibodies against SSL3 and SSL4 are found in healthy individuals, indicating that humans are exposed to these proteins during S. aureus colonization or infection. To investigate the TLR2-antagonistic properties of SSL3 and SSL4, we compared the infection with wild-type and SSL3/4 knockout S. aureus strains in an intravenous murine infection model. Direct evaluation of the contribution of SSL3/4 to infection pathogenesis was hindered by the fact that the SSLs were not expressed in the murine system. To circumvent this limitation, an SSL3-overproducing strain (pLukM-SSL3) was generated, resulting in constitutive expression of SSL3. pLukM-SSL3 exhibited increased virulence compared to the parental strain in a murine model that was found to be TLR2 dependent. Altogether, these data indicate that SSL3 contributes to S. aureus virulence in vivo. © 2017 S. Karger AG, Basel.

  20. The Use of Attitude Segmentation in Selecting Market Targets and Choosing a New Product Name: Application to an Automated Teller System.

    Science.gov (United States)

    Mauldin, Charles R.; And Others

    Ninety-six subjects were randomly chosen from 386 bank customers who responded to a questionnaire using subjective variables to segment or label respondents. A review of subjective segmentation studies revealed that the studies can be divided into three approaches--benefit segmentation, attitude segmentation, and life style segmentation. Choosing…

  1. Band Jahn-Teller effect on the density of states of the magnetic high-T{sub c} superconductors: A model study

    Energy Technology Data Exchange (ETDEWEB)

    Pradhan, B. [Department of Physics, Govt. Science College, Malkangiri 764 048 (India); Mohanta, K.L. [Department of Physics, ITER, Siksha ' O' Anusandhan University, Bhubaneswar 751 030 (India); Rout, G.C., E-mail: gcr@iopb.res.in [Condensed Matter Physics Group, Dept. of Applied Physics and Ballistics, F.M. University, Balasore 756 019 (India)

    2012-05-15

    We report here a mean-field study of competing antiferromagnetism, superconductivity and lattice strain phases and their effect on the local density of states of the cuprate system. Our model Hamiltonian incorporating these interactions is reported earlier [G.C. Rout et al., Physica C, 2007]. The analytic expression for superconducting, antiferromagnetism and lattice strain order parameters are calculated and solved self-consistently. The interplay of these order parameters is investigated considering the calculated density of states (DOSs) of the conduction electrons. The DOS displays multiple gap structures with multiple peaks. It is suggested that the tunneling conductance data obtained from the scanning tunneling microscopy (STM) measurements could be interpreted by using the quasi-particle bands calculated from our model Hamiltonian. We have discussed the mechanism to calculate the order parameters from the conductance data.

  2. Jahn-Teller effect in van der Waals complexes; Ar-C6H6 + and Ar-C6D6 +.

    NARCIS (Netherlands)

    Avoird, A. van der; Lotrich, VF

    2004-01-01

    The two asymptotically degenerate potential energy surfaces of argon interacting with the X (2)E(1g) ground state benzene(+) cation were calculated ab initio from the interaction energy of the neutral Ar-benzene complex given by Koch et al. [J. Chem. Phys. 111, 198 (1999)] and the difference of the

  3. Jahn-Teller effect and ferromagnetic ordering in La0.875Sr0.125MnO3: A reentrant behaviour

    International Nuclear Information System (INIS)

    Pinsard, L.; Revcolevschi, A.; Anane, A.; Dupas, C.

    1997-01-01

    The compound La 0.875 Sr 0.125 MnO 3 undergoes a series of structural phase transitions in which different physical effects are involved. The compound is rhombohedral above T RO ∝400 K. On cooling, a phase transition to an orthorhombic Pbnm O-phase takes place at T RO , no significant orbital ordering is observed. At T OO' ∝270 K a structural phase transition to another orthorhombic (O') form takes place, and an orbital ordering appears due to a cooperative JT effect. For this temperature range the compound is a paramagnetic semiconductor. Upon cooling it becomes ferromagnetic at T C ∝180 K and the orbital ordering is partially suppressed. Below a temperature T O'O '' ∝150 K at which the average Mn magnetic moment is about 2μ B the orbital ordering is completely suppressed by a first order structural transition to another orthorhombic phase (O '' ) similar to the O-phase. Between T C and T O'O '' the compound is metallic and becomes a ferromagnetic insulator below T O'O '' where a canting of the ferromagnetic order appears. (orig.)

  4. The Edward Teller Medal Lecture: the Evolution Toward Indirect Drive and Two Decades of Progress Toward Icf Ignition and Burn (lirpp Vol. 11)

    Science.gov (United States)

    Lindl, John D.

    2016-10-01

    In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program...

  5. Effect of the laser wavelength: A long story of laser-plasma interaction physics for Inertial Confinement Fusion Teller Medal Lecture

    Science.gov (United States)

    Labaune, Christine

    2016-10-01

    Laser-driven Inertial Confinement Fusion (ICF) relies on the use of high-energy laser beams to compress and ignite a the1monuclear fuel with the ultimate goal of producing energy. Fusion is the holy grail of energy sources-combining abundant fuel with no greenhouse gas emissions, minimal waste products and a scale that can meet mankind's long-term energy demands. The quality and the efficiency of the coupling of the laser beams with the target are an essential step towards the success of laser fusion. A long-te1m program on laser-plasma interaction physics has been pursued to understand the propagation and the coupling of laser pulses in plasmas for a wide range of parameters.

  6. Anomalous multi-order Raman scattering in LaMnO.sub.3./sub. a signature of quantum lattice effects in a Jahn-Teller crystal

    Czech Academy of Sciences Publication Activity Database

    Kovaleva, Natalia; Kusmartseva, O.E.; Kugel, K.I.; Maksimov, A.A.; Nuzhnyy, Dmitry; Balbashov, A.M.; Demikhov, E.I.; Dejneka, Alexandr; Trepakov, Vladimír; Kusmartsev, F.V.; Stoneham, A.M.

    2013-01-01

    Roč. 25, č. 15 (2013), s. 1-8 ISSN 0953-8984 R&D Projects: GA TA ČR TA01010517 Institutional research plan: CEZ:AV0Z10100522 Keywords : quantum lattice effects * LaMnO 3 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.223, year: 2013

  7. Effect of the laser wavelength: A long story of laser-plasma interaction physics for Inertial Confinement Fusion Teller Medal Lecture

    Directory of Open Access Journals (Sweden)

    Labaune Christine

    2013-11-01

    Full Text Available Laser-driven Inertial Confinement Fusion (ICF relies on the use of high-energy laser beams to compress and ignite a thermonuclear fuel with the ultimate goal of producing energy. Fusion is the holy grail of energy sources–combining abundant fuel with no greenhouse gas emissions, minimal waste products and a scale that can meet mankind's long-term energy demands. The quality and the efficiency of the coupling of the laser beams with the target are an essential step towards the success of laser fusion. A long-term program on laser-plasma interaction physics has been pursued to understand the propagation and the coupling of laser pulses in plasmas for a wide range of parameters.

  8. Lattice modes and the Jahn-Teller ferroelectric transition of GaV.sub.4./sub.S.sub.8./sub.

    Czech Academy of Sciences Publication Activity Database

    Hlinka, Jiří; Borodavka, Fedir; Rafalovskyi, Iegor; Dočekalová, Zuzana; Pokorný, Jan; Gregora, Ivan; Tsurkan, V.; Nakamura, H.; Mayr, F.; Kuntscher, C.A.; Loidl, A.; Bordács, S.; Szaller, D.; Lee, H.-J.; Lee, J.H.; Kézsmárki, I.

    2016-01-01

    Roč. 94, č. 6 (2016), 1-4, č. článku 060104. ISSN 2469-9950 R&D Projects: GA ČR GA13-15110S Institutional support: RVO:68378271 Keywords : augmented-wave method * crystals * phase Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.836, year: 2016

  9. Strategi Pemberdayaan Perusahaan Waralaba Lokal Menuju Waralaba Global: Studi Kasus Good Corporate Governance oleh Eksekutif Puncak di J.Co, Es Teller 77, dan Pecel Lele Lela

    Directory of Open Access Journals (Sweden)

    Lelo Yosep Laurentius

    2015-07-01

    Full Text Available This research is mainly intended for reviewing and strengthening leadership, corporate governance good practices and management philosophy in the concepts, systems, and human resources (HR of the company. A new progressive corporate leader should be able to quickly identify the strengths and weaknesses of his/her business, to increase the first and to reduce the pressures or to liquidate the later. Finally, he/she must be able to encourage his/her subordinates to achieve easily identified and highly attractive goals. The target is to build the 21st century company where all employees realize that they can make it different and that they will warmly welcome the managerial motivation. Thus, the chief executive officer assumes the responsibility for constructive managerial skills. Research used qualitative approach to disclose GCG in local franchise companies. Case study was done purposively with chief executive officer of the company. Data were gathered by observation and literature study. Analysis was conducted by data reduction, data presentation, and conclusion. 

  10. Optical spectroscopy of Al2O3:Ti3+ single crystal under hydrostatic pressure : The influence on the Jahn-Teller coupling

    NARCIS (Netherlands)

    García-Revilla, S.; Rodríguez, F.; Valiente, R.; Pollnau, Markus

    2002-01-01

    This work investigates the effect of hydrostatic pressure on the excitation and emission spectra, as well as on the lifetime, of Al2O3:Ti3+ at room temperature. The aim is to establish correlations between the pressure-induced band shifts and the corresponding local structural changes undergone by

  11. Gamow-Teller matrix elements from the C-12(d,He-2) and Mg-24(d,He-2) reactions at 170 MeV

    NARCIS (Netherlands)

    Baumer, C; Frekers, D; Schmidt, R; van den Berg, AM; Hannen, VM; Harakeh, MN; de Huu, MA; Wörtche, HJ; De Frenne, D; Hagemann, M; Heyse, J; Jacobs, E; Fujita, Y

    The Mg-24(d,He-2)Na-24 and the C-12(d,He-2)B-12 charge-exchange reactions have been studied at an incident energy of 170 MeV. The two protons in the S-1(0)(pp) state (indicated as He-2) were both momentum analyzed and detected by the same spectrometer and detector. Background-free He-2 spectra with

  12. Impact of service quality on customer satisfaction of automated teller machine service: case study of a private commercial joint stock bank in Vietnam

    OpenAIRE

    Phan, Chi; Nham, Phong

    2015-01-01

    One of key challenge for Vietnamese commercial banks is how to compete in the market place with commonly undifferentiated services. The aim of this study is to investigate the impact of service quality performance on customer satisfaction on ATM service in a commercial bank in Vietnam. This study applies SERVPERF framework to analyze the data collected from a questionnaire survey and found that ASSURANCE and TANGIBLES factors significantly impact on the customer satisfaction.

  13. Impact of service quality on customer satisfaction of automated teller machine service: case study of a private commercial joint stock bank in Vietnam

    Directory of Open Access Journals (Sweden)

    Chi Phan

    2015-10-01

    Full Text Available One of key challenge for Vietnamese commercial banks is how to compete in the market place with commonly undifferentiated services. The aim of this study is to investigate the impact of service quality performance on customer satisfaction on ATM service in a commercial bank in Vietnam. This study applies SERVPERF framework to analyze the data collected from a questionnaire survey and found that ASSURANCE and TANGIBLES factors significantly impact on the customer satisfaction.

  14. Full tanks - empty plates. The price for agrian fuels. Hunger, expulsion, environmental destruction; Volle Tanks - leere Teller. Der Preis fuer Agrokraftstoffe. Hunger, Vertreibung, Umweltzerstoerung

    Energy Technology Data Exchange (ETDEWEB)

    Hees, W.; Mueller, O.; Schueth, M. (eds.)

    2007-07-01

    With the cereals, which is needed in order to fill a 100-Liter-tank of a jeep, one person can be nourished one year. Whether it ethically is justified to convert food into fuel, is one of the questions, which is discussed in the book under consideration. The agro fuels forced by the European Community and the U.S.A. have given rise to a gold-digger spirit in the agrarian industry. This also is applied to the Third World, where presently plantations of gigantic extent develop. The consequences are disastrous: loss of biodiversity, heating up of the world climate and hunger.

  15. Safe Configuration of TLS Connections

    Science.gov (United States)

    2013-10-16

    comparison with observed flows to flag inconsistencies. Keywords: Transport Layer Security ( TLS ), Secure Socket Layer ( SSL ), configuration, secure...servers. SSL / TLS has evolved over 18 years from SSL 1.0 to TLS 1.2 and has been widely deployed and accepted across Internet servers. This has made...and provides a large-scale view of TLS properties across Internet web sites. The guidance provided in [10] describes best practices for SSL / TLS

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Abstract. The purpose of the present paper is to report a study of tunneling of electrons through semiconductor superlattices (SSL); specially, we have analysed diverse features of transmission coefficient of SSL. The SSL we have considered is Ga0.7Al0.3As–GaAs which has been drawing considerable attention during the ...

  17. Solid-State Lighting R&D Plan - 2015

    Energy Technology Data Exchange (ETDEWEB)

    Bardsley, Norman [Bardsley Consulting, Danville, CA (United States); Bland, Stephen [SB Consulting, Nashville, TN (United States); Hansen, Monica [LED Lighting Advisors, Santa Barbara, CA (United States); Pattison, Lisa [Solid State Lighting Services, Inc., Santa Barbara, CA (United States); Pattison, Morgan [Solid State Lighting Services, Inc., Santa Barbara, CA (United States); Stober, Kelsey [Navigant Consulting, Inc., Chicago, IL (United States); Yamada, Mary [Navigant Consulting, Inc., Chicago, IL (United States)

    2015-05-28

    Provides analysis and direction for ongoing R&D activities to advance SSL technology and increase energy savings, reviewing SSL technology status and trends for both LEDs and OLEDs and offering an overview of the current DOE SSL R&D project portfolio.

  18. Escoamento superficial e desagregação do solo em entressulcos em solo franco-argilo-arenoso com resíduos vegetais Interrill surface runoff and soil detachment on a sandy clay loam soil with residue cover

    Directory of Open Access Journals (Sweden)

    Elemar Antonino Cassol

    2004-07-01

    Full Text Available A presença de resíduos vegetais sobre a superfície do solo altera as características do escoamento superficial gerado pela chuva e a desagregação e transporte de sedimento resultantes do processo erosivo. O objetivo deste trabalho foi avaliar as condições hidráulicas e as relações de desagregação do solo e de resistência ao escoamento com a presença de resíduos vegetais na erosão em entressulcos. O experimento foi realizado no laboratório, com um Argissolo Vermelho distrófico típico, em parcelas com 0,10 m m-1 de declive sob chuva simulada. O solo foi coberto por resíduos vegetais de palha de soja, nas doses de 0, 0,05, 0,1, 0,2, 0,4 e 0,8 kg m-2. O aumento na cobertura do solo (CS com resíduos vegetais elevou a altura da lâmina de escoamento e a rugosidade hidráulica e reduziu a velocidade média do escoamento, provocada pelo aumento das forças viscosas promovida pela interposição física dos resíduos ao escoamento. O resultado é a redução na taxa de desagregação do solo (Di. A Di foi de 5,35x10-4 kg m-2 s-1 para solo descoberto e 1,50x10-5 kg m-2 s-1 em solo com 100% de cobertura na maior dose de palha. Os modelos de Laflen e potencial foram adequados para estimar o coeficiente de cobertura para resíduo em contato direto com a superfície do solo em função da cobertura do solo.Soil surface cover with crop residue modifies surface flow characteristics, generated by excess rainfall, and soil detachment and sediment transport resulting from the erosion process. The objective of this study was to evaluate the hydraulic conditions, detachment and flow resistance on interrill erosion on soil covered with residue. The experiment was conducted in the laboratory, on a Hapludult soil at a slope of 0.10 m m-1, under simulated rainfall and soil surface covered with soybean residue at the rates of 0, 0.05, 0.1, 0.2, 0.4, and 0.8 kg m-2. The increase in soil surface cover (SC with residue, caused an increase in water flow depth and hydraulic roughness, and a decrease in the mean flow velocity, due to an increase in the viscous forces from the physical interference of residue on runoff, thus contributing to a reduction in interrill soil detachment rate (Di. The Di was 5.35x10-4 kg m-2 s-1 for bare soil and was reduced to 1.50x10-5 kg m-2 s-1 for soil with 100% of surface cover. The Laflen's and the potential models were adequate to estimate the coefficient of soil coverage by residue in direct contact with soil as a function of the soil surface cover.

  19. Seismic Response to Sonic Boom-Coupled Rayleigh Waves

    Science.gov (United States)

    1990-06-28

    side slopes and moderately deep well-drained, gently sloping to moderately steep soils on terraces; Ann. Rainfall--10" to 16") Cath-Timpahute- Jarab ...slopes less than 15%, and Alluvial land) Jarab Series (cobbley loam, gravelly loam, gravelly clay loam, pan fragments, hardpan with silica laminae...weakly and strongly cemented with lime, soft, calcareous gravelly loam: al!-aline, calcareous) Jarab cobbley loam, 2 to 15% slopes, (JCD) (moderately

  20. MR Imaging of Supraspinous Ligament Injury in the Thoracolumbar Spine

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ju Hee; Hwang, Ji Young; Lee, Sun Wha; Koh, Young Do [Ewha Womans University, Seoul (Korea, Republic of)

    2009-10-15

    We wanted to evaluate the MRI features and their diagnostic accuracy for SSL injury in the thoracolumbar spine. From December 2003 to June 2006, among 42 surgically treated patients with spinal fracture, the 35 patients who underwent MRI and who were surgically evaluated for SSL injury were included in this study. The sagittal MR images were evaluated for the presence of SSL injury and its level, location and distraction gap, the level and compression ratio of the fractured body, and the presence of ISL or yellow ligament injury and posterior osseous fracture. The sensitivity, specificity and accuracy of MRI were calculated. The distraction gap of the SSL and the compression ratio of the fractured body or posterior osseous fracture were statistically analyzed. Thirty-one among the 33 patients with surgically confirmed SSL injury were diagnosed on MRI. SSL injury was mostly seen at the thoracolumbar junction and near the upper spinous process. The mean distraction gap was 4.3 mm. The level of the fractured body was most commonly in the lower vertebra of the injured SSL level and the mean compression ratio was 21.8%. Combined SSL, ISL and yellow ligament injury were mostly seen. The sensitivity, specificity and accuracy were 93.9%, 50% and 91.4%, respectively. There was a statistically significant difference of the distraction gap of the injured SSL depending on the presence of posterior osseous fracture. MRI is an accurate modality for evaluating SSL injury and the associated findings.

  1. Cross-Domain Semi-Supervised Learning Using Feature Formulation.

    Science.gov (United States)

    Xingquan Zhu

    2011-12-01

    Semi-Supervised Learning (SSL) traditionally makes use of unlabeled samples by including them into the training set through an automated labeling process. Such a primitive Semi-Supervised Learning (pSSL) approach suffers from a number of disadvantages including false labeling and incapable of utilizing out-of-domain samples. In this paper, we propose a formative Semi-Supervised Learning (fSSL) framework which explores hidden features between labeled and unlabeled samples to achieve semi-supervised learning. fSSL regards that both labeled and unlabeled samples are generated from some hidden concepts with labeling information partially observable for some samples. The key of the fSSL is to recover the hidden concepts, and take them as new features to link labeled and unlabeled samples for semi-supervised learning. Because unlabeled samples are only used to generate new features, but not to be explicitly included in the training set like pSSL does, fSSL overcomes the inherent disadvantages of the traditional pSSL methods, especially for samples not within the same domain as the labeled instances. Experimental results and comparisons demonstrate that fSSL significantly outperforms pSSL-based methods for both within-domain and cross-domain semi-supervised learning.

  2. Contaminant exposure and effects in pinnipeds: implications for Steller sea lion declines in Alaska.

    Science.gov (United States)

    Barron, Mace G; Heintz, Ron; Krahn, Margaret M

    2003-07-20

    After nearly 3 decades of decline, the western stock of Steller sea lions (SSL; Eumetopias jubatus) was listed as an endangered species in 1997. While the cause of the decline in the 1970s and 1980s has been attributed to nutritional stress, recent declines are unexplained and may result from other factors including the presence of environmental contaminants. SSL tissues show accumulation of butyltins, mercury, PCBs, DDTs, chlordanes and hexachlorobenzene. SSL habitats and prey are contaminated with additional chemicals including mirex, endrin, dieldrin, hexachlorocyclohexanes, tetrachlorodibenzo-p-dioxin (TCDD) and related compounds, cadmium and lead. In addition, many SSL haulouts and rookeries are located near other hazards including radioactivity, solvents, ordnance and chemical weapon dumps. PCB and DDT concentrations measured in a few SSL during the 1980s were the highest recorded for any Alaskan pinniped. Some contaminant exposures in SSL appear to be elevated in the Gulf of Alaska and Bering Sea compared to southeast Alaska, but there are insufficient data to evaluate geospatial relationships with any certainty. Based on very limited blubber data, current levels of PCBs may not pose a risk to SSL based on comparison to immunotoxicity tissue benchmarks, but SSL may have been at risk from pre-1990 PCB exposures. While exposure to PCBs and DDTs may be declining, SSL are likely exposed to a multitude of other contaminants that have not been monitored. The impacts of these exposures on SSL remain unknown because causal effects have not been established. Field studies with SSL have been limited in scope and have not yet linked contaminant exposures to adverse animal health or population effects. Several biomarkers may prove useful for monitoring exposure and additional research is needed to evaluate their utility in SSL. We conclude that there are insufficient data to reject the hypothesis that contaminants play a role in the continued decline of SSL, and suggest

  3. 12 CFR 740.4 - Requirements for the official sign.

    Science.gov (United States)

    2010-01-01

    ... terms “branch,” “station,” “teller station,” and “window” do not include automated teller machines or... teller station or window where any nonfederally insured credit union also receives account funds. As exceptions to this prohibition: (1) A teller in a branch of a federally insured credit union may accept...

  4. 12 CFR Appendix C to Part 229 - Model Availability Policy Disclosures, Clauses, and Notices; Model Substitute Check Policy...

    Science.gov (United States)

    2010-01-01

    ...-case holds) C-19Notice at automated teller machines C-20Notice at automated teller machines (delayed... would like a list of the routing numbers for these institutions. C-9—Automated Teller Machine Deposits (Extended Hold) Deposits at Automated Teller Machines Funds from any deposits (cash or checks) made at...

  5. Assessing the evidence of Six Sigma and Lean in the health care industry.

    Science.gov (United States)

    DelliFraine, Jami L; Langabeer, James R; Nembhard, Ingrid M

    2010-01-01

    Popular quality improvement tools such as Six Sigma and Lean Systems (SS/L) claim to provide health care managers the opportunity to improve health care quality on the basis of sound methodology and data. However, it is unclear whether these 2 quality improvement tools actually improve health care quality. The authors conducted a comprehensive literature review to assess the empirical evidence relating SS/L to improved clinical outcomes, processes of care, and financial performance of health care organizations. The authors identified 177 articles on SS/L published in the last 10 years. However, only 34 of them reported any outcomes of the SS/L projects studied, and less than one-third of these articles included statistical analyses to test for significant changes in outcomes. This review demonstrates that there are significant gaps in the SS/L health care quality improvement literature and very weak evidence that SS/L improve health care quality.

  6. Solid-state lighting technology perspective.

    Energy Technology Data Exchange (ETDEWEB)

    Tsao, Jeffrey Yeenien; Coltrin, Michael Elliott

    2006-08-01

    Solid-State Lighting (SSL) uses inorganic light-emitting diodes (LEDs) and organic light-emitting diodes (OLEDs) to convert electricity into light for illumination. SSL has the potential for enormous energy savings and accompanying environmental benefits if its promise of 50% (or greater) energy efficiencies can be achieved. This report provides a broad summary of the technologies that underlie SSL. The applications for SSL and potential impact on U.S. and world-wide energy consumption, and impact on the human visual experience are discussed. The properties of visible light and different technical metrics to characterize its properties are summarized. The many factors contributing to the capital and operating costs for SSL and traditional lighting sources (incandescent, fluorescent, and high-intensity discharge lamps) are discussed, with extrapolations for future SSL goals. The technologies underlying LEDs and OLEDs are also described, including current and possible alternative future technologies and some of the present limitations.

  7. Light quality and efficiency of consumer grade solid state lighting products

    DEFF Research Database (Denmark)

    Dam-Hansen, Carsten; Corell, Dennis Dan; Thorseth, Anders

    2013-01-01

    The rapid development in flux and efficiency of Light Emitting Diodes (LED) has resulted in a flooding of the lighting market with Solid State Lighting (SSL) products. Many traditional light sources can advantageously be replaced by SSL products. There are, however, large variations in the quality...... of these products, and some are not better than the ones they are supposed to replace. A lack of quality demands and standards makes it difficult for consumers to get an overview of the SSL products. Here the results of a two year study investigating SSL products on the Danish market are presented. Focus has been...... on SSL products for replacement of incandescent lamps and halogen spotlights. The warm white light and good color rendering properties of these traditional light sources are a must for lighting in Denmark and the Nordic countries. 266 SSL replacement lamps have been tested for efficiency and light...

  8. Semisolid liver infusion tryptose supplemented with human urine allows growth and isolation of Trypanosoma cruzi and Trypanosoma rangeli clonal lineages

    Directory of Open Access Journals (Sweden)

    Emanuella Francisco Fajardo

    2016-06-01

    Full Text Available Abstract: INTRODUCTION This work shows that 3% (v/v human urine (HU in semisolid Liver Infusion Tryptose (SSL medium favors the growth of Trypanosoma cruzi and T. rangeli. METHODS Parasites were plated as individual or mixed strains on SSL medium and on SSL medium with 3% human urine (SSL-HU. Isolate DNA was analyzed using polymerase chain reaction (PCR and pulsed-field gel electrophoresis (PFGE. RESULTS SSL-HU medium improved clone isolation. PCR revealed that T. cruzi strains predominate on mixed-strain plates. PFGE confirmed that isolated parasites share the same molecular karyotype as parental cell lines. CONCLUSIONS SSL-HU medium constitutes a novel tool for obtaining T. cruzi and T. rangeli clonal lineages.

  9. Automating Information Assurance for Cyber Situational Awareness within a Smart Cloud System of Systems

    Science.gov (United States)

    2014-03-01

    monitoring and protection of data such as Transport Layer Security ( TLS ), Secure Sockets Layer ( SSL ), and Internet Protocol Security (IPsec) protocols...and usage of data loss prevention software. Protocols such as TLS , SSL , and IPsec encrypt data packets for secure transportation and decryption by...Representational State Transfer RSS rich site summary SA situational awareness SAF Singapore Armed Forces SoS system of systems SSL secure sockets layer S

  10. Best Practices and Controls for Mitigating Insider Threats

    Science.gov (United States)

    2013-08-08

    Every Organization Should Know Twitter #CERTinsiderthreat © 2013 Carnegie Mellon University MERIT CORP Man-in-the-Middle (MITM) Proxy SSL / TLS ...Handshake SSL / TLS Handshake Managing The Insider Threat: What Every Organization Should Know Twitter #CERTinsiderthreat © 2013 Carnegie Mellon...to upload attachments present an opportunity for sensitive data to leave the organization. •  Communications that are secured with SSL encryption

  11. Training opioid addiction treatment providers to adopt contingency management: A prospective pilot trial of a comprehensive implementation science approach.

    Science.gov (United States)

    Becker, Sara J; Squires, Daniel D; Strong, David R; Barnett, Nancy P; Monti, Peter M; Petry, Nancy M

    2016-01-01

    Few prospective studies have evaluated theory-driven approaches to the implementation of evidence-based opioid treatment. This study compared the effectiveness of an implementation model (Science to Service Laboratory; SSL) to training as usual (TAU) in promoting the adoption of contingency management across a multisite opioid addiction treatment program. We also examined whether the SSL affected putative mediators of contingency management adoption (perceived innovation characteristics and organizational readiness to change). Sixty treatment providers (39 SSL, 21 TAU) from 15 geographically diverse satellite clinics (7 SSL, 8 TAU) participated in the 12-month study. Both conditions received didactic contingency management training and those in the predetermined experimental region received 9 months of SSL-enhanced training. Contingency management adoption was monitored biweekly, whereas putative mediators were measured at baseline, 3 months, and 12 months. Relative to providers in the TAU region, treatment providers in the SSL region had comparable likelihood of contingency management adoption in the first 20 weeks of the study, and then significantly higher likelihood of adoption (odds ratios = 2.4-13.5) for the remainder of the study. SSL providers also reported higher levels of one perceived innovation characteristic (Observability) and one aspect of organizational readiness to change (Adequacy of Training Resources), although there was no evidence that the SSL affected these putative mediators over time. Results of this study indicate that a fully powered randomized trial of the SSL is warranted. Considerations for a future evaluation are discussed.

  12. DOE Solid-State Lighting in Higher Ed Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Naomi J.; Curry, Ku' Uipo J.

    2010-07-20

    The focus of the workshop was on higher education facilities because college and university campuses are an important market for lighting products and they use almost every kind of luminaire on the market. This workshop was seen as a chance for SSL manufacturers large and small to get the inside scoop from a group of people that specify, pay for, install, use, maintain, and dispose of lighting systems for nearly every type of application. Workshop attendees explored the barriers to SSL adoption, the applications where SSL products could work better than existing technologies, and where SSL luminaires are currently falling short. This report summarizes the Workshop activities and presentation highlights.

  13. Solid-State Lighting: Early Lessons Learned on the Way to Market

    Energy Technology Data Exchange (ETDEWEB)

    Sandahl, Linda J.; Cort, Katherine A.; Gordon, Kelly L.

    2013-12-31

    The purpose of this report is to document early challenges and lessons learned in the solid-state lighting (SSL) market development as part of the DOE’s SSL Program efforts to continually evaluate market progress in this area. This report summarizes early actions taken by DOE and others to avoid potential problems anticipated based on lessons learned from the market introduction of compact fluorescent lamps and identifies issues, challenges, and new lessons that have been learned in the early stages of the SSL market introduction. This study identifies and characterizes12 key lessons that have been distilled from DOE SSL program results.

  14. Development and Evaluation of Secure Socket Layer Visualization Tool with Packet Capturing Function

    Directory of Open Access Journals (Sweden)

    Arai Masayuki

    2015-01-01

    Full Text Available Secure Socket Layer (SSL has become a fundamental technology that secures browser-processed personal details sent to the server. As a result, communication and computer engineers are advised to learn the protocol. However, understanding SSL is very difficult because of its intricate communication procedure. To solve this problem, we developed a visualization tool for understanding SSL. This paper describes the design, implementation methods, and evaluation of the tool. The evaluation results show that the visualization tool is effective for learning SSL.

  15. Derin suda dairesel silindir arkasında meydana gelen akış yapısının örgü teller ile kontrol edilmesi

    Directory of Open Access Journals (Sweden)

    Burcu Oğuz

    2016-08-01

    Full Text Available Bu çalışmada amaç derin su içerisine yerleştirilen silindire (bacalar, yüksek binalar vb. ve arkasındaki bir cisme veya cisimlere girdap kopması sonucu etki eden daimi olmayan yüklerin etkisinin ve şiddetinin azaltılması ve optimum değerlerin (tel kalınlığı ve geçirgenlik oranı, β belirlenmesidir. Bu amaçla çapı D=50 mm olan dairesel silindir etrafına sarılan farklı kalınlık ve geçirgenlik oranına sahip örgü tellerin etkisi Re_D=5000 değerinde araştırılmıştır. Geçirgenlik oranları β=0.5-0.8 aralığında 0.1 artımlarla dört farklı değerdedir. Silindir üzerine sarılmış tellerin kalınlıkları b=1 mm, 2 mm, 3mm ve 4mm’dir. Silindir arkasında meydana gelen akış yapısı, silindir etrafına sarılan örgü tellerle kontrol edilmeye çalışılmıştır. Deneyler PIV (parçacık görüntülemeli hız ölçme tekniği kullanılarak yürütülmüştür. Tüm geçirgenlik oranlarında, Türbülans Kinetik Enerji (TKE ve Reynolds kayma gerilmesi değerleri b=1 mm ve 2 mm tel kalınlıklarında, örgüsüz silindirin değeri ile kıyaslandığında artmakta fakat b=3 mm ve 4 mm kalınlıklarında azalmaktadır. Geçirgenlik oranı, β=0.6 değerinde ve tel kalınlığı b=4 mm durumunda TKE ve Reynolds kayma gerilmesi değerleri, örgü tellerinin silindir arkasında meydana gelen akışı kontrol ettiğini göstermektedir. Frekans değerlerinin sonuçları da örgü tellerin, silindir arkasındaki akışı, geçirgenlik oranı β=0.6 ve b=4 mm tel kalınlığında en iyi kontrolü sağladığını net bir şekilde açıklamaktadır

  16. Environmental Assessment, Repair of the Dam at Non-Potable Reservoir #1, United States Air Force Academy, Colorado

    Science.gov (United States)

    2015-08-01

    expected and are not analyzed further in this EA. Utilities. The electrical, natural gas, water, and sanitary sewer requirements of the Proposed...therefore, no increase in utility usage or sanitary and solid waste generation would occur. Utility connections that run alongside the existing dam...for evaluation of the soils suitability for native revegetation. An acceptable topsoil shall have a loam, sandy loam, clay loam, or silt loam texture

  17. Long-term influence of tillage and fertilization on net carbon dioxide exchange rate on two soils with different textures.

    Science.gov (United States)

    Feiziene, Dalia; Feiza, Virginijus; Slepetiene, Alvyra; Liaudanskiene, Inga; Kadziene, Grazina; Deveikyte, Irena; Vaideliene, Asta

    2011-01-01

    The importance of agricultural practices to greenhouse gas mitigation is examined worldwide. However, there is no consensus on soil organic carbon (SOC) content and CO emissions as affected by soil management practices and their relationships with soil texture. No-till (NT) agriculture often results in soil C gain, though, not always. Soil net CO exchange rate (NCER) and environmental factors (SOC, soil temperature [T], and water content [W]), as affected by soil type (loam and sandy loam), tillage (conventional, reduced, and NT), and fertilization, were quantified in long-term field experiments in Lithuania. Soil tillage and fertilization affected total CO flux (heterotrophic and autotrophic) through effect on soil SOC sequestration, water, and temperature regime. After 11 yr of different tillage and fertilization management, SOC content was 23% more in loam than in sandy loam. Long-term NT contributed to 7 to 27% more SOC sequestration on loam and to 29 to 33% more on sandy loam compared with reduced tillage (RT) or conventional tillage (CT). Soil water content in loam was 7% more than in sandy loam. Soil gravimetric water content, averaged across measurement dates and fertilization treatments, was significantly less in NT than CT and RT in both soils. Soil organic carbon content and water storage capacity of the loam and sandy loam soils exerted different influences on NCER. The NCER from the sandy loam soil was 13% greater than that from the loam. In addition, NCER was 4 to 9% less with NT than with CT and RT systems on both loam and sandy loam soils. Application of mineral NPK fertilizers promoted significantly greater NCER from loam but suppressed NCER by 15% from sandy loam. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  18. Reliability of solid-state lighting electrical drivers subjected to WHTOL accelerated aging

    Energy Technology Data Exchange (ETDEWEB)

    Lall, Pradeep; Sakalauku, Peter; Davis, Lynn

    2014-05-27

    An investigation of a solid-state lighting (SSL) luminaire with the focus on the electronic driver which has been exposed to a standard wet hot temperature operating life (WHTOL) of 85% RH and 85°C in order to assess reliability of prolonged exposer to a harsh environment has been conducted. SSL luminaires are beginning introduced as head lamps in some of today's luxury automobiles and may also be fulfilling a variety of important outdoor applications such as overhead street lamps, traffic signals and landscape lighting. SSL luminaires in these environments are almost certain to encounter excessive moisture from humidity and high temperatures for a persistent period of time. The lack of accelerated test methods for LEDs to assess long-term reliability prior to introduction into the marketplace, a need for SSL physics based PHM modeling indicators for assessment and prediction of LED life, as well as the U.S. Department of Energy's R&D roadmap to replace todays lighting with SSL luminaires makes it important to increase the understanding of the reliability of SSL devices, specifically, in harsh environment applications. In this work, a set of SSL electrical drivers were investigated to determine failure mechanisms that occur during prolonged harsh environment applications. Each driver consists of four aluminum electrolytic capacitors (AECs) of three different types and was considered the weakest component inside the SSL electrical driver. The reliability of the electrical driver was assessed by monitoring the change in capacitance and the change in equivalent series resistance for each AEC, as well as monitoring the luminous flux of the SSL luminaire or the output of the electrical driver. The luminous flux of a pristine SSL electrical driver was also monitored in order to detect minute changes in the electrical drivers output and to aid in the investigation of the SSL luminaires reliability. The failure mechanisms of the electrical drivers have been

  19. Field-measured, hourly soil water evaporation stages in relation to reference evapotranspiration rate and soil to air temperature ratio

    Science.gov (United States)

    Soil water evaporation takes critical water supplies away from crops, especially in areas where both rainfall and irrigation water are limited. This study measured bare soil water evaporation from clay loam, silt loam, sandy loam, and fine sand soils. It found that on average almost half of the ir...

  20. Light quality and efficiency of consumer grade solid state lighting products

    Science.gov (United States)

    Dam-Hansen, Carsten; Corell, Dennis Dan; Thorseth, Anders; Poulsen, Peter Behrensdorff

    2013-03-01

    The rapid development in flux and efficiency of Light Emitting Diodes (LED) has resulted in a flooding of the lighting market with Solid State Lighting (SSL) products. Many traditional light sources can advantageously be replaced by SSL products. There are, however, large variations in the quality of these products, and some are not better than the ones they are supposed to replace. A lack of quality demands and standards makes it difficult for consumers to get an overview of the SSL products. Here the results of a two year study investigating SSL products on the Danish market are presented. Focus has been on SSL products for replacement of incandescent lamps and halogen spotlights. The warm white light and good color rendering properties of these traditional light sources are a must for lighting in Denmark and the Nordic countries. 266 SSL replacement lamps have been tested for efficiency and light quality with respect to correlated color temperature and color rendering properties. This shows a trade-off between high color rendering warm white light and energy efficiency. The lumen and color maintenance over time has been investigated and results for products running over 11000 h will be presented. A new internet based SSL product selection tool will be shown. Here the products can be compared on efficiency, light quality parameters, thus providing a better basis for the selection of SSL products for consumers.