Analyste de systèmes intermédiaire (h/f) | CRDI - Centre de ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'analyste de systèmes intermédiaire travaille sous la supervision du ... à la mise en œuvre et à la maintenance d'un large éventail de systèmes tout en assurant ... directement les consultants externes sous contrat afin de faciliter la transition ...

Assessing health care needs and clinical outcome with Urological case complexity : A study using INTERMED

NARCIS (Netherlands)

Herms, AMRD; Pinggera, GM; De Jonge, P; Strasser, H; Sollner, W

2003-01-01

Urinary tract symptoms and, particularly, urinary incontinence are often chronic and complex conditions that cause diagnosis, treatment, and management problems. In many cases, psychosocial factors contribute to the development of a chronic condition. The authors investigated whether INTERMED, an

Interaction of active compounds from Aegle marmelos CORREA with histamine-1 receptor

Science.gov (United States)

Nugroho, Agung Endro; Agistia, Dany Dwi; Tegar, Maulana; Purnomo, Hari

2013-01-01

The aim of this study is to determine the affinity of six active compounds of Aegle Marmelos Correa, they are (E, R)-Marmin, skimmianine, (S)-aegeline, aurapten, zeorin, and dustanin as antihistamines in histamine H1 receptor in comparison to cetirizin, diphenhydramine and chlorpheniramine as ligands comparison. Previously, in the in vitro study marmin obviously antagonized the histamine H1 receptor in a competitive manner. Methods: molecular docking to determine the interaction of ligand binding to its receptor. Lower docking score indicates more stable binding to that protein. Results: Marmin, skimmianine, aegeline, aurapten, zeorin, and dustanin were potential to develop as antihistamine agents, especially as histamine H1 receptor antagonists by interacting with amino acid residues, Asp107, Lys179, Lys191, Asn198, and Trp428 of histamine H1 receptor. Conclusions: Based on molecular docking, Amino acid residues involved in ligand protein interactions were Asp107, Lys179, Lys191, Asn198, and Trp428. PMID:23750086

Simultaneous determination of aegeline and six coumarins from different parts of the plant Aegle marmelos using UHPLC-PDA-MS and chiral separation of aegeline using HPLC-ToF-MS

Science.gov (United States)

A fast UHPLC-PDA method was developed for the simultaneous analysis of one alkaloid, aegeline, and six coumarins namely: umbelliferone; scopoletin; marmesinin; 8-hydroxypsoralen angelicin and marmelosin from leaf, fruit, root and bark of Aegle marmelos (L.) Corrêa (Rutaceae). The method was validate...

Unique occurrence of unusual fatty acid in the seed oil of Aegle marmelos Corre: Screening the rich source of seed oil for bio-energy production

International Nuclear Information System (INIS)

Katagi, Kariyappa S.; Munnolli, Ravindra S.; Hosamani, Kallappa M.

2011-01-01

In this work, an attempt has been made to characterize, isolate and elucidate the structure of unusual fatty acid in the seed oil of Aegle marmelos Corre. Further, this nonedible seed oil is screened for its bio-diesel or industrial feedstock property. The Aegle marmelos Corre seeds yielded 49.0% oil. The seed oil contains 12.5% of 12-hydroxyoctadec-cis-9-enoic acid (ricinoleic acid) along with other normal fatty acids. The identification and characterization was supported by FTIR, 1 H NMR, 13 C NMR, MS, GC analysis and chemical degradation technique. A good agreement is seen between the calculated and experimental results of iodine value (IV) and saponification value (SV). The prominent parameters of bio-diesel such as cetane number (CN), lower heating value (LHV) and higher heating value (HHV) are deployed to envisage the quality of oil for use as bio-diesel. This seed oil is nonedible and is found to be the alternative feed stock for the production of bio-diesel since it convenes the major specifications of bio-diesel. The bio-diesel property of fatty acid methyl esters (FAMEs) of this seed oil is compared with other bio-diesels.

The protective role of Aegle marmelos on aspirin-induced gastro-duodenal ulceration in albino rat model: a possible involvement of antioxidants.

Science.gov (United States)

Das, Shyamal K; Roy, Chandan

2012-01-01

Gastro duodenal ulcer is a common disorder of the gastrointestinal tract. Several Indian medicinal plants have been traditionally and extensively used to prevent different diseases. In the present research studies, Bael fruit (Aegle marmelos (AM), family: Rutaceae) which are also called as Bilva in ancient Sanskrit was used as a herbal drug and its antioxidative role in aspirin- induced gastroduodenal ulceration in albino rat was evaluated using essential biochemical parameters. Mucosal thickness (MT), ulcer index (UI), different biochemical parameters, such as aspartate aminotransferase (AST), alanine aminotransferase (ALT), catalase (CAT), superoxide dismutase (SOD), reduced glutathione (GSH), and lipid peroxidation (LPO) were measured in all the groups, to study the possible involvement of antioxidants with gastroduodenal protection. A significant decrease in MT, SOD and CAT activities and GSH level and a significant increase in UI, AST, ALT, and ALP activities and LPO level were observed in aspirin treated stomach and duodenum of albino rats. Pretreatment with AM fruit pulp extract for 14 consecutive days showed the reverse effects of aspirin suggesting gastro-duodenal protective and anti- ulcerogenic properties of AM through its antioxidant mechanism.

Synthesis, physico-chemical and biomedical applications of sulfated Aegle marmelos gum: Green chemistry approach

Directory of Open Access Journals (Sweden)

Manish Jindal

2017-05-01

Full Text Available The present investigation was aimed at obtaining a sulfated derivative of gum obtained from partially ripe fruits of Aegle marmelos employing the ultrasonication technique. Elemental analysis and FTIR-ATR studies confirmed successful sulfation. The molarity of sulfuric acid exerted maximum influence on the degree of substitution followed by reaction temperature and reaction time. The sulfated derivative showed higher swelling in both acidic and alkaline pH as compared to the unmodified gum. It also possessed higher negative zeta potential, higher viscosity, work of shear, firmness, consistency, cohesiveness and index of viscosity as compared to both unmodified gum as well as sodium alginate. Sulfated derivative was superior to unmodified gum and sodium alginate in terms of antimicrobial and anticoagulant activities. The sulfated sample appears to be a potential substitute over the unmodified gum sample and sodium alginate for modulating the physicochemical properties of food and drug release dosage forms.

A Comparative Study of the Inhibitory Effect of the Extracts of Ocimum sanctum, Aegle marmelos, and Solanum trilobatum on the Corrosion of Mild Steel in Hydrochloric Acid Medium

Directory of Open Access Journals (Sweden)

M. Shyamala

2011-01-01

Full Text Available A comparative study of the inhibitory effect of plant extracts, Ocimum sanctum, Aegle marmelos, and Solanum trilobatum, on the corrosion of mild steel in 1N HCl medium was investigated using weightloss method, electrochemical methods, and hydrogen permeation method. Polarization method indicates plant extracts behave as mixed-type inhibitor. The impedance method reveals that charge-transfer process mainly controls the corrosion of mild steel. On comparison, maximum inhibition efficiency was found in Ocimum sanctum with 99.6% inhibition efficiency at 6.0% v/v concentration of the extract. The plant extracts obey Langmuir adsorption isotherm. The SEM morphology of the adsorbed protective film on the mild steel surface has confirmed the high performance of inhibitive effect of the plant extracts. From hydrogen permeation method, all the plant extracts were able to reduce the permeation current. The reason for the reduced permeation currents in presence of the inhibitors may be attributed to the slow discharge step followed by fast electrolytic desorption step. Results obtained in all three methods were very much in good agreement in the order Ocimum sanctum > Aegle marmelos > Solanum trilobatum.

La filière d’oignon d’été dans le Saïs au Maroc : la place et le rôle des intermédiaires de la commercialisation

Directory of Open Access Journals (Sweden)

Caroline Lejars

2014-11-01

Full Text Available Les agriculteurs dépendent souvent, pour la commercialisation de leur produit, d'un réseau complexe d'intermédiaires privés. Dans les pays en développement, ces intermédiaires de la vente sont souvent accusés de réaliser des profits excessifs et d’être responsables des énormes écarts entre le prix de vente au champ et le prix payé par le consommateur. En s’appuyant sur l’étude de la filière oignon d’été dans le Saïs au Maroc, cet article analyse le rôle de ces réseaux d'intermédiaires, et la répartition des coûts et de la marge bénéficiaire le long de la chaine de production et de commercialisation. On montre ainsi que cette filière crée un grand nombre d'emplois en aval de la production, que ce soit pour la collecte, le stockage, le transport ou la vente. La part de la marge bénéficiaire revenant à l’ensemble des intermédiaires est supérieure à celle revenant aux producteurs, ce qui entraine effectivement une importante différence de prix entre le prix de vente et le prix du marché. Même si les profits et les rôles des intermédiaires sont très variables, certains des acteurs intermédiaires, notamment les détaillants et les revendeurs en gros, récupèrent des marges bien supérieures à celles des agriculteurs. L’organisation des producteurs autour de zones de stockage et d’activités de commercialisation permettrait de limiter le nombre d’intermédiaires, d’accroitre le profit des agriculteurs et de modifier les rapports de négociations souvent asymétriques entre agriculteurs et commerçants.

Green synthesis of NiO nanoparticles using Aegle marmelos leaf extract for the evaluation of in-vitro cytotoxicity, antibacterial and photocatalytic properties.

Science.gov (United States)

Angel Ezhilarasi, A; Judith Vijaya, J; Kaviyarasu, K; John Kennedy, L; Ramalingam, R Jothi; Al-Lohedan, Hamad A

2018-03-01

In the present study, we report the green synthesis of NiO nanoparticles using Aegle marmelos as a fuel and this method is ecofriendly and cost effective. The plant Aegle marmelos is used in the field of pharmaceuticals to cure diseases like chronic diarrhea, peptic ulcers and dysentery in India for nearly 5 centuries. The as-prepared nanoparticles were confirmed as pure face centered cubic phase and single crystalline in nature by XRD. The formation of agglomerated spherical nanoparticles was shown by HR-SEM and HR-TEM images. The particle size calculated from HR-SEM was in the range 8-10 nm and it matches with the average crystallite size calculated from the XRD pattern. NiO shows intense emission peaks at 363 and 412 nm in its PL spectra. The band gap of 3.5 eV is observed from DRS studies and the formation of pure NiO is confirmed by FT-IR spectra. The as-prepared NiO nanoparticles show super paramagnetic behavior, when magnetization studies are carried out. It is then evaluated for cytotoxic activity towards A549 cell culture, antibacterial activity and photocatalytic degradation (PCD) of 4‑chlorophenol (4‑CP), which is known as the endocrine disrupting chemical (EDC). From the results, it is found that the cell viability of A549 cells was effectively reduced and it showed better antibacterial activity towards gram positive bacterial strains. It is also proved to be an efficient and stable photocatalyst towards the degradation of 4‑CP. Copyright © 2018 Elsevier B.V. All rights reserved.

Antigenotoxic Activity of Polyphenolic Rich Extracts from Aegle marmelos (L. Correa in Human Blood Lymphocytes and E.coli PQ 37

Directory of Open Access Journals (Sweden)

Prabhjit Kaur

2009-01-01

Full Text Available The present paper deals with the antigenotoxic activity of Aegle marmelos fruit extracts employing short term assays i.e. the SOS chromotest using Escherichia coli PQ37 and the Comet assay in peripheral human blood lymphocytes. Methanol extract and Acetone extract were quite effective in decreasing the SOS response induced by hydrogen peroxide and aflatoxin B1 in the SOS chromotest. Methanol extract inhibited the genotoxicity of H 2O 2 by 70.48% and that of AFB1 by 84.65%. The extracts showed significant decrease in the tail moment induced by hydrogen peroxide (9 m M in the Single Cell Gel Electrophoresis (SCGE assay. The antigenotoxic activity exhibited by the extracts may be attributed the various polyphenolic constituents present in these extracts.

Hepatoprotective effect of Aegle marmelos augmented with piperine co-administration in paracetamol model

Directory of Open Access Journals (Sweden)

Deepti Rathee

Full Text Available ABSTRACT The current study explored hepatoprotective effect of Aegle marmelos (L. Corrêa, Rutaceae, leaves extract. Potentiation of A. marmelos hepatoprotective effect with piperine co-administration was also explored. Wistar rats were randomly divided into seven groups: (i normal control, (ii paracetamol group, (iii silymarin group, (iv extract-25 group (25 mg/kg body, (v extract-50 group: (50 mg/kg, (vi extract-100 group (100 mg/kg and (vii extract-25 + piperine group. Hepatotoxicity was induced by administering paracetamol orally in a dose of 400 mg/kg for seven days. The drugs were administered 30 min prior to paracetamol administration and continued for seven days. Animals were ‘sacrificed’ at the end of treatment and serum was collected for evaluating alkaline phosphatase, bilirubin, lactate dehydrogenase, alanine aminotransferase, aspartate aminotransferase IL-10 and TNF-α levels. Liver homogenates were used for determination of oxidative stress (malondialdehyde, reduced glutathione, superoxide dismutase, catalase, glutathione reductase, GSH-S-transferase, glutathione peroxidase and glucose-6-phosphate dehydrogenase. Serum biochemical markers were significantly higher in paracetamol group as compared to normal control group. Significant increase in oxidative stress parameters and inflammatory mediators was also observed. Treatment with A. marmelos curtailed the toxic effects of paracetamol in a dose dependent fashion. 100 mg/kg dose of A. marmelos was found to be most hepatoprotective. The results of extract-100 group were comparable to silymarin group. Low dose of A. marmelos i.e., 25 mg/kg was combined with piperine to evaluate potentiation of hepatoprotective effects of A. marmelos. Piperine co-administration potentiated the hepatoprotective effects, because the combination group results were comparable to high dose A. marmelos group. A. marmelos exerts hepatoprotective activity through its antioxidant and anti

Transmedia storytelling in the NGO communication. Sí me importa by Oxfam Intermón

Directory of Open Access Journals (Sweden)

Laura MARTÍNEZ VALERO

2016-12-01

Full Text Available Traditionally, transmedia storytelling has been used for spreading fiction narrative worlds, such as films and TV series. However, it was a matter of time that its ability for explaining the reality was discovered and utilised by social organizations to explain their causes and to reach new audiences. Moreover, the new mobile environment challenges the creativity of the organizations to develop products that make use of this new form of consumption. The Sí me importa campaign, a transmedia project of the Spanish NGO Oxfam Intermón, reclaimed the importance of the in-ternational cooperation through social networks, comic, theatre, contemporary art and cinema.

Lille, place financière intermédiaire sous la Révolution et l’Empire

OpenAIRE

De Oliveira, Matthieu

2011-01-01

Dernière grande place négociante et financière avant la frontière septentrionale, Lille joue pleinement son rôle d’intermédiaire entre les marchés parisiens au Sud et belgo-hollandais au Nord sous la Révolution et l’Empire. La déclaration de guerre en 1792 puis la départementalisation des territoires conquis ne font que renforcer la position nodale des acteurs économiques et financiers de la place. Au premier rang d’entre eux, François Briansiaux mobilise efficacement son important réseau de ...

Indicateurs de mobilité durable : de l'état de l'art à la définition des indicateurs dans le projet Simbad. Rapport intermédiaire n°2

OpenAIRE

Verry , Damien; Nicolas , Jean-Pierre

2005-01-01

Rapport pour le compte de la DRAST (Ministère de l'Équipement) et de l'ADEME dans le cadre du groupe 11 du PREDIT. 96 p.Voir aussi :- le Rapport intermédiaire n°1"Modèles d'interaction entre transport et urbanisme : état de l'art et choix du modèle pour le projet SIMBAD". http://halshs.ccsd.cnrs.fr/halshs-00101342- le Rapport intermédiaire n°4"L'architecture du modèle au sein du projet SIMBAD."http://halshs.ccsd.cnrs.fr/halshs-00101399; Rapport de recherche; Le projet SIMBAD (SImuler les MoBi...

In vitro clonal propagation of bael (Aegle marmelos Corr.) CV. CISH-B1 through enhanced axillary branching.

Science.gov (United States)

Pati, Rajesh; Chandra, Ramesh; Chauhan, Ugam Kumari; Mishra, Maneesh; Srivastava, Navin

2008-10-01

Rapid clonal micropropagation protocol of Aegle marmelos (L.) Corr. cv. CISH-B1 was achieved by nodal stem segment of mature bearing tree. Three centimeter long shoots having one axillary bud excised from 10-15th nodal region of shoots during September gave quick in vitro bud burst (5.33 days) when cultured on MS medium supplemented with BAP, 8.84 μM + IAA 5.7 μM. The maximum number of proliferated shoots (9.0/explant) were obtained on same medium supplemented with BAP 8.84 μM + IAA 5.7 μM. The micro shoots were rooted (100 %) on + IAA 5.7 μM. In vitro rooted plants were acclimatized on autoclaved coconut husk containing plant salt mixture and under shade net house (50 % shade 70-80 % RH). The plants were established in the field after acclimatization. The micropropagated plants were tested for its genetic fidelity using 13 RAPD, 3 ISSR and 2 DAMD primers. Profile obtained by all the three Single Primer Amplification Reaction (SPAR) technique from mother tree and micropropagated plants revealed genetic integrity of micropropagated plants with that of mother tree.

Grammaire progressive du français niveau intermédiaire

CERN Document Server

Grégoire, Maïa

2017-01-01

Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

Assessment of Biopsychosocial Complexity and Health Care Needs: Measurement Properties of the INTERMED Self-Assessment Version.

Science.gov (United States)

van Reedt Dortland, Arianne K B; Peters, Lilian L; Boenink, Annette D; Smit, Jan H; Slaets, Joris P J; Hoogendoorn, Adriaan W; Joos, Andreas; Latour, Corine H M; Stiefel, Friedrich; Burrus, Cyrille; Guitteny-Collas, Marie; Ferrari, Silvia

2017-05-01

The INTERMED Self-Assessment questionnaire (IMSA) was developed as an alternative to the observer-rated INTERMED (IM) to assess biopsychosocial complexity and health care needs. We studied feasibility, reliability, and validity of the IMSA within a large and heterogeneous international sample of adult hospital inpatients and outpatients as well as its predictive value for health care use (HCU) and quality of life (QoL). A total of 850 participants aged 17 to 90 years from five countries completed the IMSA and were evaluated with the IM. The following measurement properties were determined: feasibility by percentages of missing values; reliability by Cronbach α; interrater agreement by intraclass correlation coefficients; convergent validity of IMSA scores with mental health (Short Form 36 emotional well-being subscale and Hospital Anxiety and Depression Scale), medical health (Cumulative Illness Rating Scale) and QoL (Euroqol-5D) by Spearman rank correlations; and predictive validity of IMSA scores with HCU and QoL by (generalized) linear mixed models. Feasibility, face validity, and reliability (Cronbach α = 0.80) were satisfactory. Intraclass correlation coefficient between IMSA and IM total scores was .78 (95% CI = .75-.81). Correlations of the IMSA with the Short Form 36, Hospital Anxiety and Depression Scale, Cumulative Illness Rating Scale, and Euroqol-5D (convergent validity) were -.65, .15, .28, and -.59, respectively. The IMSA significantly predicted QoL and also HCU (emergency department visits, hospitalization, outpatient visits, and diagnostic examinations) after 3- and 6-month follow-up. Results were comparable between hospital sites, inpatients and outpatients, as well as age groups. The IMSA is a generic and time-efficient method to assess biopsychosocial complexity and to provide guidance for multidisciplinary care trajectories in adult patients, with good reliability and validity across different cultures.

Effect of Aegle marmelos and Murraya koenigii in treatment of delayed pubertal buffaloes heifers

Directory of Open Access Journals (Sweden)

Mohan M. Baitule

2016-12-01

Full Text Available Aim: This study aims to study the estrus induction, ovulation, and conception rate of delayed puberty in buffaloes heifers by feeding a herbal plants Aegle marmelos (bael/bili/bhel leaf and Murraya koenigii (Curry leaf. Materials and Methods: Totally, 24 buffalo heifers with delayed puberty were selected for the present study and divided randomly in four equal groups (n=6. Before experiment, all animals were dewormed with albendazole at 10 mg/kg body weight to prevent them from the stress of parasitism. In the present experiment, four group taken and Group I (n=6 treated with A. marmelos, Group II (n=6 treated with M. koenigii, Group III (n=6 treated with mixture of A. marmelos and M. koenigii and fed for 9 days. Group IV (n=6 considered as control and fed with concentrate only. The blood samples were collected from all the animals on day 0 (before treatment, 4, 9 (during treatment, on the day of estrus and day 8 after the onset of estrus. The 10 ml blood was collected from the jugular vein of all the experimental animals for estimation of serum calcium, inorganic phosphorus, and progesterone (P4. The estrus response, ovulation, conception rate along with serum calcium, inorganic phosphorus, and progesterone level were determined by the standard protocol. Results: From Group III 4 heifers, from Group II 3 heifers, and from Group I and IV (Control 2 heifers each, exhibited the estrus. The estrus response was recorded as 33.33%, 50.00%, 75.00%, and 33.33% in Group I, Group II, Group III, and Group IV, respectively. In treatment Group III, serum calcium found significantly more (p<0.05 on day 8 post-estrus as compared to other groups at a similar interval. Inorganic phosphorus and progesterone show no significant difference between groups. The ovulation and conception rates are comparatively better in Group III (75% buffalo heifers than other groups. Conclusion: Herbal supplementation of A. marmelos and M. koenigii in combination, as well as M

Complexity assessed by the intermed in patients with somatic symptom disorder visiting a specialized outpatient mental health care setting: : A cross sectional study complexity of patients with ssd

NARCIS (Netherlands)

van Eck van der Sluijs, J.F.; de Vroege, L.; van Manen, A.S.; Rijnders, C.A.Th.; van der Feltz-Cornelis, C.F.

2017-01-01

Background Somatic symptom disorders (SSD), a new classification in the Diagnostic and Statistical Manual of Mental Disorders, fifth edition is associated with problematic diagnostic procedures and treatment that lead to complex care. In somatic health care, the INTERMED has been used to assess

Les temps de l’archivage de terrain. Les documents intermédiaires, du papier à l’ordinateur

Directory of Open Access Journals (Sweden)

Georges Augustins

2008-08-01

Full Text Available Les temps de l’archivage de terrain. Les documents intermédiaires, du papier à l’ordinateur. La revisite de terrains ethnologiques passés fournit l’occasion de faire le point sur les méthodes employées et leur évolution entre deux moments de la recherche. Elle permet également le passage et la continuité des travaux d’un ethnologue vers un autre. Nous traiterons ces deux angles au travers d’une expérience concrète réalisée sur les travaux ethnologiques des Baronnies de Bigorre. Outre les présentations des deux enquêtes de terrain, la première effectuée de 1974 à 1976 et la seconde fin 2005/début 2006, nous interrogerons les différences dans la pratique ethnographique et les raisons du changement, puis nous nous poserons la question de l’utilisation des documents intermédiaires du premier ethnologue par le second.The times of archiving the fieldwork. Intermediary documents, from paper to computer. Revisiting areas studied by anthropologists in the past provides an opportunity to take stock of the methods used and how they have evolved between two periods of research. It also enables work to continue and be passed from one anthropologist to another. We shall look at both these angles using an actual experiment carried out on the ethnological work in the Baronnies de Bigorre region. As well as presenting both of the field surveys, the first carried out from 1974 to 1976 and the second from the end of 2005 into early 2006, we shall be examining the differences in ethnological practices and the reasons behind these changes, and then looking at how the second anthropologist has made use of the first anthropologist’s intermediary documents.

Aegle marmelos Mediated Green Synthesis of Different Nanostructured Metal Hexacyanoferrates: Activity against Photodegradation of Harmful Organic Dyes

Directory of Open Access Journals (Sweden)

Vidhisha Jassal

2016-01-01

Full Text Available Prussian blue analogue potassium metal hexacyanoferrate (KMHCF nanoparticles Fe4[Fe(CN6]3 (FeHCF, K2Cu3[Fe(CN6]2 (KCuHCF, K2Ni[Fe(CN6]·3H2O (KNiHCF, and K2Co[Fe(CN6] (KCoHCF have been synthesized using plant based biosurfactant Aegle marmelos (Bael and water as a green solvent. It must be emphasized here that no harmful reagent or solvent was used throughout the study. Plant extracts are easily biodegradable and therefore do not cause any harm to the environment. Hence, the proposed method of synthesis of various KMHCF nanoparticles followed a green path. The synthesized nanoparticles were characterized by powder X-ray diffraction (PXRD, Field-Emission Scanning Electron Microscopy (FE-SEM, Transmission Electron Microscopy (TEM, and Fourier Transform Infrared Spectroscopy (FT-IR. MHCF nanoparticles were used for the photocatalytic degradation of toxic dyes like Malachite Green (MG, Eriochrome Black T (EBT, Methyl Orange (MO, and Methylene Blue (MB. Under optimized reaction conditions, maximum photocatalytic degradation was achieved in case of KCuHCF nanoparticles mediated degradation process (MG: 96.06%, EBT: 83.03%, MB: 94.72%, and MO: 63.71% followed by KNiHCF (MG: 95%, EBT: 80.32%, MB: 91.35%, and MO: 59.42%, KCoHCF (MG: 91.45%, EBT: 78.84%, MB: 89.28%, and MO: 58.20%.

Studies on the antidiarrhoeal activity of Aegle marmelos unripe fruit: Validating its traditional usage

Directory of Open Access Journals (Sweden)

Antia Noshir

2009-11-01

Full Text Available Abstract Background Aegle marmelos (L. Correa has been widely used in indigenous systems of Indian medicine due to its various medicinal properties. However, despite its traditional usage as an anti-diarrhoeal there is limited information regarding its mode of action in infectious forms of diarrhoea. Hence, we evaluated the hot aqueous extract (decoction of dried unripe fruit pulp of A. marmelos for its antimicrobial activity and effect on various aspects of pathogenicity of infectious diarrhoea. Methods The decoction was assessed for its antibacterial, antigiardial and antirotaviral activities. The effect of the decoction on adherence of enteropathogenic Escherichia coli and invasion of enteroinvasive E. coli and Shigella flexneri to HEp-2 cells were assessed as a measure of its effect on colonization. The effect of the decoction on production of E. coli heat labile toxin (LT and cholera toxin (CT and their binding to ganglioside monosialic acid receptor (GM1 were assessed by GM1-enzyme linked immuno sorbent assay whereas its effect on production and action of E. coli heat stable toxin (ST was assessed by suckling mouse assay. Results The decoction showed cidal activity against Giardia and rotavirus whereas viability of none of the six bacterial strains tested was affected. It significantly reduced bacterial adherence to and invasion of HEp-2 cells. The extract also affected production of CT and binding of both LT and CT to GM1. However, it had no effect on ST. Conclusion The decoction of the unripe fruit pulp of A. marmelos, despite having limited antimicrobial activity, affected the bacterial colonization to gut epithelium and production and action of certain enterotoxins. These observations suggest the varied possible modes of action of A. marmelos in infectious forms of diarrhoea thereby validating its mention in the ancient Indian texts and continued use by local communities for the treatment of diarrhoeal diseases.

Grammaire progressive du français corrigés : niveau intermédiaire

CERN Document Server

Thiévenaz, Odile

2017-01-01

Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

Caroline Surmann, Cinéma et théâtre chez Jean Cocteau. Intermédialité et esthétique

OpenAIRE

Brangé, Mireille

2016-01-01

Dans une démarche artistique considérée comme essentiellement multimédiale et «déambulant entre les arts» (p. 12), la relation établie entre cinéma et théâtre par Cocteau est un terrain de choix pour envisager sa pratique intermédiale. L’A. précise ce concept travaillé d’abord en Allemagne et au Canada et le plus souvent seulement approché en France, et offre une introduction théorique appréciable (pp. 13-15; 47-67) en l’absence, à notre connaissance, de toute traduction française des textes ...

Timing of psychiatric consultations - The impact of social vulnerability and level of psychiatric dysfunction

NARCIS (Netherlands)

de Jonge, P; Huyse, FJ; Ruinemans, GMF; Stiefel, FC; Lyons, JS; Slaets, JPJ

2000-01-01

The authors examined the timing of patient referrals to a psychiatric consultation-liaison service in relation to the patient's social vulnerability and level of psychiatric dysfunction. One hundred consecutive patients were assessed with the INTERMED, a method to document biopsychosocial and health

In vitro glucose uptake activity of Aegles marmelos and Syzygium cumini by activation of Glut-4, PI3 kinase and PPARgamma in L6 myotubes.

Science.gov (United States)

Anandharajan, R; Jaiganesh, S; Shankernarayanan, N P; Viswakarma, R A; Balakrishnan, A

2006-06-01

The purpose of the present study is to investigate the effect of methanolic extracts of Aegles marmelos and Syzygium cumini on a battery of targets glucose transporter (Glut-4), peroxisome proliferator activator receptor gamma (PPARgamma) and phosphatidylinositol 3' kinase (PI3 kinase) involved in glucose transport. A. marmelos and S. cumini are anti-diabetic medicinal plants being used in Indian traditional medicine. Different solvent extracts extracted sequentially were analysed for glucose uptake activity at each step and methanol extracts were found to be significantly active at 100ng/ml dose comparable with insulin and rosiglitazone. Elevation of Glut-4, PPARgamma and PI3 kinase by A. marmelos and S. cumini in association with glucose transport supported the up-regulation of glucose uptake. The inhibitory effect of cycloheximide on A. marmelos- and S. cumini-mediated glucose uptake suggested that new protein synthesis is required for the elevated glucose transport. Current observation concludes that methanolic extracts of A. marmelos and S. cumini activate glucose transport in a PI3 kinase-dependent fashion.

A novel ether-linked phytol-containing digalactosylglycerolipid in the marine green alga, Ulva pertusa

Energy Technology Data Exchange (ETDEWEB)

Ishibashi, Yohei; Nagamatsu, Yusuke [Department of Bioscience and Biotechnology, Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Miyamoto, Tomofumi [Graduate School of Pharmaceutical Sciences, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582 (Japan); Matsunaga, Naoyuki; Okino, Nozomu; Yamaguchi, Kuniko [Department of Bioscience and Biotechnology, Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Ito, Makoto, E-mail: makotoi@agr.kyushu-u.ac.jp [Department of Bioscience and Biotechnology, Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan)

2014-10-03

Highlights: • Alkaline-resistant galactolipid, AEGL, was found in marine algae. • The sugar moiety of AEGL is identical to that of digalactosyldiacylglycerol. • AEGL is the first identified glycolipid that possesses an ether-linked phytol. • AEGL is ubiquitously distributed in green, red and brown marine algae. - Abstract: Galactosylglycerolipids (GGLs) and chlorophyll are characteristic components of chloroplast in photosynthetic organisms. Although chlorophyll is anchored to the thylakoid membrane by phytol (tetramethylhexadecenol), this isoprenoid alcohol has never been found as a constituent of GGLs. We here described a novel GGL, in which phytol was linked to the glycerol backbone via an ether linkage. This unique GGL was identified as an Alkaline-resistant and Endogalactosylceramidase (EGALC)-sensitive GlycoLipid (AEGL) in the marine green alga, Ulva pertusa. EGALC is an enzyme that is specific to the R-Galα/β1-6Galβ1-structure of galactolipids. The structure of U. pertusa AEGL was determined following its purification to 1-O-phytyl-3-O-Galα1-6Galβ1-sn-glycerol by mass spectrometric and nuclear magnetic resonance analyses. AEGLs were ubiquitously distributed in not only green, but also red and brown marine algae; however, they were rarely detected in terrestrial plants, eukaryotic phytoplankton, or cyanobacteria.

A novel ether-linked phytol-containing digalactosylglycerolipid in the marine green alga, Ulva pertusa

International Nuclear Information System (INIS)

Ishibashi, Yohei; Nagamatsu, Yusuke; Miyamoto, Tomofumi; Matsunaga, Naoyuki; Okino, Nozomu; Yamaguchi, Kuniko; Ito, Makoto

2014-01-01

Highlights: • Alkaline-resistant galactolipid, AEGL, was found in marine algae. • The sugar moiety of AEGL is identical to that of digalactosyldiacylglycerol. • AEGL is the first identified glycolipid that possesses an ether-linked phytol. • AEGL is ubiquitously distributed in green, red and brown marine algae. - Abstract: Galactosylglycerolipids (GGLs) and chlorophyll are characteristic components of chloroplast in photosynthetic organisms. Although chlorophyll is anchored to the thylakoid membrane by phytol (tetramethylhexadecenol), this isoprenoid alcohol has never been found as a constituent of GGLs. We here described a novel GGL, in which phytol was linked to the glycerol backbone via an ether linkage. This unique GGL was identified as an Alkaline-resistant and Endogalactosylceramidase (EGALC)-sensitive GlycoLipid (AEGL) in the marine green alga, Ulva pertusa. EGALC is an enzyme that is specific to the R-Galα/β1-6Galβ1-structure of galactolipids. The structure of U. pertusa AEGL was determined following its purification to 1-O-phytyl-3-O-Galα1-6Galβ1-sn-glycerol by mass spectrometric and nuclear magnetic resonance analyses. AEGLs were ubiquitously distributed in not only green, but also red and brown marine algae; however, they were rarely detected in terrestrial plants, eukaryotic phytoplankton, or cyanobacteria

ESTIMASI KETINGGIAN PLANETARY BOUNDARY LAYER INDONESIA MENGGUNAKAN DATA ECMWF REANALYSIS ERA-INTERM

Directory of Open Access Journals (Sweden)

Vivi Fitriani

2018-03-01

Full Text Available Planetary Boundary Layer (PBL merupakan bagian dari troposfer yang mendapat pengaruh secara langsung dari permukaan bumi, yang memiliki peranan penting dalam iklim, cuaca dan kualitas udara. PBL dikenal sangat sulit untuk diobservasi dari luar angkasa dikarenakan strukturnya yang sangat kompleks dan berubah-ubah. Salah satu properties yang paling relevan dan fundamental untuk diselidiki adalah ketinggian PBL. Ketinggian PBL dihitung menggunakan tujuh metode berbasis gradien dari kelembaban relatif (RH, temperatur virtual (Tv, temperatur potensial ( , temperatur potensial virtual ( , kelembaban spesifik (q, refraktiviti atmosfer (N, dan Kecepatan angin (V yang diperoleh dari data ECMWF Reanalisis Era Interm selama enam bulan di wilayah 100LU–100LS, 900BT –1500BT dengan resolusi spasial 2.50 x 2.50. Beberapa metode menunjukkan hasil yang indentik untuk ketinggian PBL pada waktu dan tempat tertentu. Metode gradien  dan V konsisten memberikan ketinggian PBL yang tinggi, sementara metode q dan N menghasilkan ketinggian PBL terendah signifikan. Tingginya variasi bulanan dan harian umumnya ditemukan diseluruh wilayah daratan, sedangkan wilayah lautan relatif konstan. Beberapa sumber dari kedua parametrik dan struktur ketidakpastian dari nilai ketinggian PBL diestimasi secara statistik menggunakan lima uji statistik, yaitu uji Student’s t, Uji F, Uji Kormogoorv Sminorv, Uji Korelasi Pearson, dan Uji Korelasi NonParametrik Spearman. Ditemukan adanya perbedaan yang signifikan secara statistik antara ketujuh metode. Rata-rata median ketinggian PBL berbeda ratusan hingga ribuan meter untuk kebanyakan metode yang dibandingkan. Estimasi ketinggian PBL di Indonesia menggunakan metode RH berada di ketinggian 2000 m-4000m pada siang hari dan pada malam hari berada di bawah 2500  m.

Appraisal on the wound healing activity of different extracts obtained from Aegle marmelos and Mucuna pruriens by in vivo experimental models.

Science.gov (United States)

Toppo, F A; Pawar, R S

2016-01-01

The use of a simple and reproducible model is inevitable for an objective statement of the effects of external factors on wound healing. Hence, the present study was conducted to evaluate wound healing activities of sequential different extracts of Aegle marmelos leaves (AM) and Mucuna pruriens seeds (MP) by in vivo experimental models. Wistar albino rats were subjected to excision, incision and dead space wounds measuring approximately 250 mm2, 3 cm and implanting sterilized polyvinyl chloride tube on the back of each rat near either side of the vertebral column respectively. The experimental animals were randomized into eight groups (n = 6), control, standard and treatment groups. Hydrogel of different extracts were applied topically once daily. The parameters observed were percentage of wound contraction, epithelization period, tensile strength, hydroxyproline content of the granulation tissue, and histological changes during wound healing. The statistical study revealed that in excision, incision, and dead space wound models all formulations have significant (P < 0.01) wound healing potential. However, methanolic extract formulation was found to be superior to all other treatments as evidenced by rapid wound contraction, lesser number of days required for complete epithelization, increased tensile strength and significant increase in hydroxyproline content. As compared to the reference standard treated group the wound healing process of the experimental groups was decelerated. All extracts obtained from AM and MP facilitated the wound healing process in all experimental models.

Emergency planning and the Control of Major Accident Hazards (COMAH/Seveso II) Directive: An approach to determine the public safety zone for toxic cloud releases

International Nuclear Information System (INIS)

O'Mahony, Mary T.; Doolan, Donal; O'Sullivan, Alice; Hession, Michael

2008-01-01

The EU Control of Major Accidents Hazards Directive (Seveso II) requires an external emergency plan for each top tier site. This paper sets out a method to build the protection of public health into emergency planning for Seveso sites in the EU. The method involves the review of Seveso site details prescribed under the directive. The site safety report sets out the potential accident scenarios. The safety report's worst-case scenario, and chemical involved, is used as the basis for the external emergency plan. A decision was needed on the appropriate threshold value to use as the level of concern to protect public health. The definitions of the regulatory standards (air quality standards and occupational standards) in use were studied, how they are derived and for what purpose. The 10 min acute exposure guideline level (AEGL) for a chemical is recommended as the threshold value to inform decisions taken to protect public health from toxic cloud releases. The area delimited by AEGL 1 defines the population who may be concerned about being exposed. They need information based on comprehensive risk assessment. The area delimited by AEGL 2 defines the population for long-term surveillance when indicated and may include first responders. The area delimited by AEGL 3 defines the population who may present acutely to the medical services. It ensures that the emergency responders site themselves safely. A standard methodology facilitates discussions with plant operators and concerned public. Examples show how the methodology can be adapted to suit explosive risk and response to fire

Grammaire progressive du français corrigés : niveau intermédiaire : avec 680 exercices

CERN Document Server

Thiévenaz, Odile

2013-01-01

Les corrigés de la 3e édition de la Grammaire progressive du français - niveau intermédiaire Ce qui fait le succès de cette grammaire : Une organisation claire : la leçon de grammaire sur la page de gauche ; les exercices d'entraînement sur la page de droite ; 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues ; Un apprentissage progressif : il suit la progression naturelle des méthodes de français ; Un usage souple : pour la classe ou en auto-apprentissage ; Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens ; Une large place faite à l'évaluation : de nombreux exercices de révision et des bilans réguliers. À découvrir dans cette troisième édition tout en couleurs (ISBN 978 209 038 124 5) : Un CD audio avec 14 documents sonores ; 80 nouveaux exercices et activités communicatives ; Des chapitres révisés et des exercices plus variés ; Un test d'�...

OCCUPATIONAL BURNOUT LEVELS OF ACADEMIC STAFF: TURKEY-MALTA STUDY GROUP SAMPLE

OpenAIRE

Demirtas, Cagri; Kapusuzoglu, Saduman

2016-01-01

The study group of this survey comprises of 185academic staff working in the University, Faculty of Education and Faculty ofEconomics and Administrative Sciences, in Turkey, and Malta University, Facultyof Education and Faculty of Economy, Management and Accounting. This study is adescriptive survey model, in which the assessment tool of Maslach BurnoutInventory is used. The burnout levels of academic personnel are investigated interm of gender, age and Faculty variables. As a result, it was ...

Risk Analysis for Environmental Health Triage

International Nuclear Information System (INIS)

Bogen, K T

2005-01-01

The Homeland Security Act mandates development of a national, risk-based system to support planning for, response to and recovery from emergency situations involving large-scale toxic exposures. To prepare for and manage consequences effectively, planners and responders need not only to identify zones of potentially elevated individual risk, but also to predict expected casualties. Emergency response support systems now define ''consequences'' by mapping areas in which toxic chemical concentrations do or may exceed Acute Exposure Guideline Levels (AEGLs) or similar guidelines. However, because AEGLs do not estimate expected risks, current unqualified claims that such maps support consequence management are misleading. Intentionally protective, AEGLs incorporate various safety/uncertainty factors depending on scope and quality of chemical-specific toxicity data. Some of these factors are irrelevant, and others need to be modified, whenever resource constraints or exposure-scenario complexities require responders to make critical trade-off (triage) decisions in order to minimize expected casualties. AEGL-exceedance zones cannot consistently be aggregated, compared, or used to calculate expected casualties, and so may seriously misguide emergency response triage decisions. Methods and tools well established and readily available to support environmental health protection are not yet developed for chemically related environmental health triage. Effective triage decisions involving chemical risks require a new assessment approach that focuses on best estimates of likely casualties, rather than on upper plausible bounds of individual risk. If risk-based consequence management is to become a reality, federal agencies tasked with supporting emergency response must actively coordinate to foster new methods that can support effective environmental health triage

Aproximación multimodal a la imagen de las/os empobrecidas/os: análisis multimodal de las portadas en una muestra de las revistas de Intermón Oxfam

Directory of Open Access Journals (Sweden)

María MARTÍNEZ LIROLA

2014-06-01

Full Text Available Este artículo pretende ofrecer una aproximación al modo en el que las ONG representan a la población en países ricos y pobres así como a su propia representación como ONG de Desarrollo. Nuestro corpus consiste en todos los números de la publicación Revista IO publicados durante el año 2012 por Intermón Oxfam. Se ofrecerá un análisis detallado de las portadas por ser éstas la primera página que ven los lectores y por tratarse de la parte de la revista en las que la ONG se presenta. El análisis crítico del discurso, y específicamente el modelo propuesto por van Leeuwen (2008 así como la gramática visual de Kress y van Leeuwen (2006 serán empleados con el fin de ofrecer un análisis detallado de dichas portadas y con el objetivo de observar las principales características visuales empleadas para representar a personas de países del Sur y del Norte en una muestra de las revistas publicadas por Intermón Oxfam. Tras el análisis llegamos a la conclusión de que esta ONG crea una dicotomía entre las personas que trabajan con materias primas y artesanías, situadas en países pobres, y los consumidores de esos productos, situados en países ricos. De ahí que las relaciones entre ellos aparezcan mediatizadas por el dinero en lugar de por principios universales como la igualdad o la justicia social.

Acute Exposure Guideline Levels (AEGLs) for Time Varying Toxic Plumes

Science.gov (United States)

2014-09-12

loading rates between the density values given as Arho(b-1,k) and Arho(b,k). The line labeled ‘ extrap .’above b = 1 in Table 3 records the derived...exposure times and an inverse quadratic law for densities lower than 8.26 mg/m3. The line labeled ‘ extrap .’ at the bottom of the table gives the...6 (labeled “ extrap .” above) are simply duplicated from the adjacent band b = 5. This exponent is also used to define the lowest density value Brho

Inotropic and chronotropic effects of crude extract and its butanol fraction of dry fruit of aegle marmelos linn. in isolated working rat heart

International Nuclear Information System (INIS)

Rahman, A.U.

2016-01-01

The fruit of Aegle marmelos Linn. is a most edible part of the tree, ripe, unripe and dry fruit is recommended for wide variety of disorders. Lack of pharmacological evaluation limits the use to nutritional value. Dry and ripe fruit of A. marmelos was investigated as crude extract and its butanol fraction in isolated working male Wistar rat heart. Aortic out flow, coronary effluent, cardiac output, dP/dt(max), dP/dt(min), systolic and diastolic pressure, heart rate, and aortic pressure were measured. Preload and after load was kept constant. These parameters are relevant to cardiac physiology and pathological conditions. All the concentrations of crude extract caused concentration-dependent effects. The crude extract decreased coronary effluent at 100.0 and 300.0 mg/mL, increased the dP/dt(max) at 300.0 mg/mL, systolic pressure and aortic pressure were observed maximum at 100.0 mg/mL. Whereas, aortic out flow, dP/dt(min) diastolic pressure and cardiac output and heart rate remained unaffected. The butanol fraction increased the aortic outflow, dP/dt(max), aortic pressure at 10.0 and 30.0 mg/mL maximally. Whereas, dP/dt(min), diastolic pressure and cardiac output remained unaffected. Coronary effluent at 1.0, 10.0, and 30.0 mg/mL and heart rate at 10.0 and 30.0 mg/mL were decreased maximally. It seems that the bioactive compound got concentrated in butanol fraction according to polarity of the solvent. The crude extract and butanol fraction were found to be positive inotropic whereas, butanol fraction showed negative chronotropic effect as well. (author)

Fuir la complétude ou Le métarécit intermédial des Faux-monnayeurs

Directory of Open Access Journals (Sweden)

Antonio Viselli

2014-12-01

Full Text Available Les Faux-monnayeurs d’André Gide est un (anti-roman qui fait appel à un autre médium artistique amimétique – en l’occurrence la musique – afin de mettre en question la représentation de l’authenticité, du réel et de la subjectivité de l’écrivain. Édouard, le protagoniste romancier qui souhaite lui-même rédiger un roman intitulé Les Faux-monnayeurs, se trouve plongé dans une mise-en-abîme où le récit linéaire contrapuntique déjà complexe se colore d’ambiguïté narrative grâce à une polyphonie verticale : et ce, par le biais de l’axe paradigmatique, des récits emboîtés et de l’usage du discours indirect libre. Gide réalise, au moins en partie, le rêve d’Édouard paralysé par la page blanche : terminer l’œuvre de Bach, L’Art de la fugue, en littérature. C’est-à-dire, que d’un point de vue intermédial, Gide emploie une poétique de la fugue – style musical théoriquement interminable – afin de subvertir le genre romanesque. L’intermédialité rejoint l’interdisciplinarité et, en appliquant le théorème mathématique et philosophique de Kurt Gödel – son théorème de l’incomplétude –, la verticalité textuelle, synonyme de métarécit chez Gide, se déploie dans toute son éloquence et renforce davantage la thématique du « faux » et de la « copie » dans un roman contrefait. Fleeing Completeness or The Intermedial Metanarrative of Les Faux-monnayeurs André Gide’s Les Faux-monnayeurs is a (anti-novel that calls upon another amimetic artistic medium – music – in order to question the representation of authenticity, of the real, and of the novelist’s subjectivity. The novel’s protagonist, Édouard, wishes to write a novel entitled Les Faux-monnayeurs, and finds himself at the bottom of a mise-en-abîme where the already complex contrapuntal narrative becomes further ambiguous alongside examples of vertical polyphony: such as the paradigmatic axis, framed

Predição da composição corporal por intermédio de método indireto

Directory of Open Access Journals (Sweden)

Ferreira Marcelo de Andrade

2001-01-01

Full Text Available O objetivo deste trabalho foi desenvolver equações de predição da composição química corporal de bovinos mestiços F1 Simental x Nelore, por intermédio da análise química da amostra representativa da carcaça. Utilizaram-se 29 animais, não- castrados, com idade média de 17 meses e peso vivo inicial de 354 kg. Cinco animais foram abatidos ao início do experimento e os demais, distribuídos, inteiramente ao acaso, nos tratamentos que foram definidos de acordo com o nível de concentrado na ração (25; 37,5; 50; 62,5; e 75%. Os conteúdos corporais de proteína, gordura, energia e minerais foram determinados analisando-se amostras de seção da carcaça incluindo a 9ª, 10ª e 11ª costelas, de acordo com HANKINS E HOWE (1946 (seção HH, e dos demais tecidos corporais. Os teores de proteína, gordura, energia e minerais, com exceção do magnésio, da seção HH, mostraram-se altamente correlacionados com a composição química do corpo vazio.

Papel dos cuidados intermédios num serviço de insuficientes respiratórios

Directory of Open Access Journals (Sweden)

Maria Fernanda Oliveira

2001-11-01

Full Text Available RESUMO: Na década de 60 surgiram na América do Norte as primeiras Unidades de Cuidados Intermédios (UCInts como resposta à pressão na gestão dos internamentos e aos custos crescentes das camas das Unidades de Cuidados Intensivos (UCIs. O novo modelo de organização proposto estabelece uma hierarquização dos diferentes níveis de cuidados – Enfermaria, UCInts e UCIs – com base nos recursos materiais e humanos disponibilizados, tendo como objectivo a continuidade no tratamento hospitalar, sem perda de qualidade nem impacto negativo no resultado final, representando uma alternativa, com uma relação custo/eficácia favorável, para um número significativo de doentes.As UCInts respiratórias são vocacionadas para o tratamento de doentes ventilados mecanicamente, estáveis, para desmame ou tratamento crónico; para os doentes hemodinamicamente estáveis com doença subjacente com potencial para agravamento da insuficiência respiratória, requerendo observação frequente e/ou ventilação por pressão positiva contínua por máscara; para os doentes que requerem monitorização frequente dos sinais vitais ou de fisioterapia respiratória intensiva.O Serviço de Insuficientes Respiratórios (SIR do Departamento de Pneumologia do Hospital de Pulido Valente é constituído por uma Enfermaria com 26 camas, 8 das quais de Cuidados Intermédios (CInts, uma Unidade de Cuidados Intensivos (UCIP e um Hospital de Dia para Insuficientes Respiratórios (HDIR.No sentido de avaliar o trabalho realizado nos CInts, efectuou-se uma revisão do arquivo clínico de todos os doentes aí internados, entre 1 de Janeiro de 1995 e 31 de Dezembro de 2000.Resultados: neste período registaram-se 545 internamentos (167 mulheres e 378 homens, com uma idade média de 64 anos (14-92. Em 34% dos casos os doentes eram provenientes da UCIP, em 19% da Enfermaria e em 4% do

Étude de l’influence des couches de non-tissés intermédiaires dans la réversibilité du doublage thermoplastique au Plextol B500®

Directory of Open Access Journals (Sweden)

Virginie Le Poizat

2012-06-01

Full Text Available Les choix concernant les matériaux et la mise en œuvre d’un doublage du support original d’une peinture par un textile et des adhésifs synthétiques sont souvent pris de manière empirique par les restaurateurs, sans être précédés de tests précis. La réversibilité, qui est un principe de déontologie primordial est encore imprécise pour ce type de doublage. Nous avons étudié par des expérimentations comment celle-ci peut être déterminée par le choix des couches intermédiaires.Choices about materials and the elaboration of synthetic linings are often made by the conservator, without any precise experimentation. Reversibility is an important deontological principal, not well-known concerning synthetic lining. We studied thanks to experimentations, how it can be influenced by the choice of the intermediate layers.

Measurement of the potency of intermatings among five geographic populations of the house mosquito (Culex pipiens fatigans) wied of Indonesia using P-32 as tracer (Diptera culicidae)

International Nuclear Information System (INIS)

Soegiarto, C.

1976-01-01

An experiment to intercross geographic population of Cp fatigans from Medan (M), North Sumatra, Jakarta (J), Municipality of Jakarta, Java, Den Pasar (B), Bali, Menado (Mo), North Sulawesi, and Kupang (K), and South East Indonesia, has been done. The criterium for the determination of the degree of success in the matings is the relative amount of the male semen present in the female body transfered during copulation. The relative amount of the male semen in the females can be measured by counting the activity of the female body that already receives the transfered semen and the accompanying secretion of the accessory glands from the males, as the males are previously treated with the radioisotope P32 when they are still at the fourth instar larval stage. It proves that all population are able to be intercrossed, and that: 1. All population as source of females show no significant differences in their capability of mating, although there are light deviations from complete similarities among them. 2. All population as source of males are able to be intercrossed with some significant differences. Their respective values as males vary which, in descending order, can be arranged as M, J, B, K, and Mo. 3. Even the population in question are intercrossable, yet the result of their mutual intermatings cannot be assured as being proportionally viable. (author)

Regression of extramedullary hematopoiesis with hydroxyurea therapy in ß-thalassemia intermedia Regressão da hematopoese extramedular na talassemia intermédia após terapia com hidroxiuréia

Directory of Open Access Journals (Sweden)

Perla Vicari

2006-03-01

Full Text Available Excessive ineffective erythropoiesis in thalassemia intermedia may cause extramedullary hematopoiesis (EMH, resulting in spleen and liver enlargement or masses in several tissues, mainly paravertebrally. Other less frequent locations of diffuse compensatory EMH are kidneys, adrenal glands, breasts, spinal cord, pleura, pericardium, duramater, adipose tissue and skin, although intrathoracic extramedullary hematopoiesis is a rare condition. Management strategies have included radiation and transfusion therapy. Hydroxyurea with transfusion therapy has been associated with clinical regression of EMH in thalassemia. We report an uncommon case of intrathoracic EMH in a patient with beta-thalassemia intermedia, that showed significant recovery with HU therapy.A excessiva eritropoese ineficaz na talassemia pode causar hemato-poese extramedular (HEM, resultando em hepatomegalia, esplenomegalia e massas de tecido hematopoético em diversos tecidos. Localizações de HEM compensatória menos freqüentes são rins, glândulas adrenais, canal medular, pleura, pericárdio, duramáter, tecido adiposo e pele. Entretanto, HEM intratorácica é condição rara. Estratégias terapêuticas incluem radiação e transfusões sanguíneas. O uso de hidroxiuréia concomitante a terapêutica transfusional foi associado à regressão clínica da HEM na talassemia. Nós descrevemos um caso de HEM intratorácica em paciente portadora de talassemia intermédia, com significante regressão do quadro após terapêutica isolada com hidroxiuréia.

Les effets des hyperliens visibles ou invisibles sur l'acquisition lexicale et sur la compréhension en lecture chez des apprenants intermédiaires et avancés en langue étrangère Effects of Visible and Invisible Hyperlinks on Vocabulary Acquisition and Reading Comprehension for High- and Average-Foreign Language Achievers

Directory of Open Access Journals (Sweden)

Ofelia R. Nikolova

2004-12-01

Full Text Available Cet article est consacré à l'étude des effets des hyperliens visibles et invisibles pour les mots annotés dans un environnement informatique centré sur l'acquisition de vocabulaire et la compréhension en lecture pour deux types d'apprenants, intermédiaires et avancés, en français. Deux cent soixante-quatre étudiants de français de deuxième semestre ont été identifiés comme intermédiaires ou avancés. Les étudiants de chaque type ont été ensuite assignés par tirage au sort en deux groupes ; un groupe utilisant des liens visibles et un autre des liens invisibles. Tous les étudiants ont reçu pour instruction de lire un court passage en français (181 mots dans un but de compréhension générale. Les étudiants ont reçu également la permission de consulter à loisir tous les mots annotés (marqués par des caractères gras pour le groupe avec liens visibles. Les apprenants ont été soumis à un prétest de vocabulaire et à des post-tests, immédiats et différés de deux semaines, de vocabulaire et de compréhension en lecture. Les résultats de l'étude ont démontré que les apprenants intermédiaires bénéficient mieux des liens visibles en ce qui concerne leur acquisition de vocabulaire et leur compréhension en lecture que les apprenants avancés. Ces résultats sont discutés dans le cadre des théories de l'apprentissage des langues secondes et des apprenants doués. Des suggestions de pistes pour des recherches futures sont proposées.This study investigated the effects of visible and invisible links for annotated words in a computer module for learning French on the vocabulary acquisition and reading comprehension of two types of students – high – and average-achievers. Two hundred and sixty four second-semester students of French were identified as high- or average-achievers. Each type of students was then randomly assigned to two groups – with visible or invisible hyperlinks. All students were instructed

The Role Of Changing Diet And Altitude On Goitre Prevalence In ...

African Journals Online (AJOL)

Conclusion: Besides low level of iodine intake, cassava consumption and living in high altitude were responsible for the observed variation and severity in goitre rates. IDD affects several dimensions of human life including school enrolment and marriage. Addressing IDD in-terms of salt iodization and training communities ...

Supramolecular structure of S-(+)-marmesin-a linear ...

Indian Academy of Sciences (India)

The title compound, C14H14O4, a linear dihydrofuranocoumarin, was isolated from the bark of Aegle marmelos, a plant widely used in Ayurvedic system of medicine for the treatment of various ailments. The crystal structure was determined from X-ray diffraction data using direct methods. The compound crystallizes into ...

Prevention of peptic ulcer by aqueous extract of Aegle marmelos leaf in rats

Directory of Open Access Journals (Sweden)

Sharmin Rahman

2018-01-01

Full Text Available Background and objectives: Minimal hepatic encephalopathy (MHE impairs health related quality of life and predicts overt hepatic encephalopathy (HE in cirrhotic patients. Lactulose is effective in the treatment of MHE. But the response to lactulose treatment depends on several factors. This study was aimed to find out the contributing factors to non-response to lactulose therapy. Materials and methods: The study was carried out at the BIRDEM general hospital from September, 2013 to March, 2015. Sixty patients were enrolled to assess the response of lactulose therapy in cirrhotic patients with MHE. MHE was diagnosed based on abnormal psychometric tests namely, number connection test (NCT, digit symbol test (DST and high serum ammonia level. A daily dose of 30-60 ml of lactulose was given to all patients for one month. The response to treatment with regard to MHE was determined after one month using defined criteria. The response was graded as responder and non-responder. Results: The mean age of the study population was 57.0±10.3 years. Out of 60 cases, 46 (77% were male and 39 (65% had diabetes. Out of 60 enrolled MHE cases, 16 (27% had Child-Turcotte-Pugh-A (CTP-A score and 44 (73% belonged to CTP-B & C category. Out of 60 MHE cases, 23 (38.3% showed improvement in their MHE status based on normalization of psychometric tests and reduction of serum ammonia level to ≤32 µmol/L. Age, gender and diabetes were not associated with the response to lactulose therapy. Low baseline arterial pressure was significantly (p=0.003 associated with non-response to lactulose treatment. The mean baseline ammonia level was higher significantly among the non-responders compared to the responders (83.6±21.4 µmol/L vs 58.8±19.8 µmol/L, p<0.001. Compared to responders, low serum sodium and potassium and raised serum bilirubin levels of non-responders at baseline were found significantly (p<0.05 associated with non-response to one month of lactulose treatment

The Welding Effect on Mechanical Strength of Low Level Radioactive Waste Drum Container

International Nuclear Information System (INIS)

Aisyah; Herlan Martono

2007-01-01

The treatment of compactable low level solid waste was started by compaction of 100 liter drum containing the waste using 600 kN hydraulic press in 200 liters drum. The 200 liter drum of waste container containing of compacted waste then immobilized with cement and stored in interm storage. The 200 liter drum of waste container made of carbon steel material to comply with a good mechanical strength request in order to be able to retain the waste content for long period. Welding is a one step in a waste drum container fabrication process that has an opportunity in decreasing these mechanical strength. The research is carried out by welding the waste drum container material sample by electric arc welding. Mechanical strength test carried out by measuring the tensile strength by using the tensile strength machine, hardness test by using Vickers hardness test and microstructure observation by using the optic microscope. The result shows that the welding cause the microstructure changes, its meaning of forming ferro oxide phase on welding area that leads to the brittle material, so that the mechanical strength has a decreasing slightly. Nevertheless the decreasing of mechanical strength is still in the range of safety limit. (author)

Poly herbal formulation with anti-elastase and anti-oxidant properties for skin anti-aging.

Science.gov (United States)

Kalyana Sundaram, Induja; Sarangi, Deepika Deeptirekha; Sundararajan, Vignesh; George, Shinomol; Sheik Mohideen, Sahabudeen

2018-01-29

Skin forms an important part of human innate immune system. Wrinkles, thinning and roughening of skin are some of the symptoms that affect the skin as it ages. Reactive oxygen species induced oxidative stress plays a major role in skin aging by modulating the elastase enzyme level in the skin. Extrinsic factors that affect skin aging such as UV radiation can also cause malignant melanoma. Here we selected four medicinal plant materials, namely, leaves of Nyctanthes arbor-tristis, unripe and ripe Aegle marmelos fruit pulp and the terminal meristem of Musa paradisiaca flower and investigated their anti-aging properties and cytotoxicity in vitro individually as well as in a poly herbal formulation containing the four plant extracts in different ratios. The phytochemical contents of the plant extracts were investigated for radical scavenging activity and total reducing power. Based upon its anti-oxidant properties, a poly herbal formulation containing leaves of Nyctanthes arbor-tristis, unripe and ripe fruit pulp of Aegle marmelos, and the terminal meristem of Musa paradisiaca flower in the ratio 6:2:1:1 (Poly Herbal Formulation 1) and 1:1:1:1 (Poly Herbal Formulation 2), respectively were formulated. It has been observed that the Poly Herbal Formulation 1 was more potent than Poly Herbal Formulation 2 due to better anti-oxidant and anti-elastase activities in NIH3T3 fibroblast cells. In addition Poly Herbal formulation 1 also had better anti-cancer activity in human malignant melanoma cells. Based on these results these beneficial plant extracts were identified for its potential application as an anti-aging agent in skin creams as well as an anti-proliferation compound against cancer cells.

Pre-reading activities in EFL/ESL reading textbooks and Turkish preparatory school teachers' attitudes toward pre-reading activities

OpenAIRE

Jecksembieyva, Nurgaisha

1993-01-01

Ankara : Faculty of Humanities and Letters and the Institute of Economics and Social Sciences of Bilkent University, 1993. Thesis (Master's) -- -Bilkent University, 1993. Includes bibliographical references leaves 35-40. The main focus of this study was to investigate pre-reading activities in EFL/ESL reading textbooks and to determine teachers' attitudes toward pre-reading activities. Fifteen reading textbooks for EFL/ESL students for different proficiency levels (beginning, interm...

Catalyseurs et procédés catalytiques utilisés dans la production des grands intermédiaires pétrochimiques. Situation actuelle et futur Catalysts and Catalytic Processes Used for the Production of the Major Petrochemical Building Blocks. Present Situation and the Future

Directory of Open Access Journals (Sweden)

Boitiaux J. P.

2006-11-01

Full Text Available La pétrochimie représente une part modeste du marché des catalyseurs, mais les dix dernières années ont vu des améliorations substantielles des catalyseurs et des procédés utilisés. Ces améliorations ont permis de mieux répondre à la demande en grands intermédiaires pétrochimiques. Cette évolution est bien illustrée par les hydrogénations, autour du vapocraquage destiné à produire des oléfines, par le reformage catalytique et les procédés satellites destinés à produire des aromatiques et par les nouveaux procédés de déshydrogénation, métathèse, oligomérisation. . . qui permettent de mieux équilibrer le marché des oléfines. Petrochemicals account for a modest share of the market for catalysts, but there have been substantial improvements in the catalysts and processes used in the last ten years. These improvements have brought about a better response to the demand for major petrochemical building blocks. This trend is clearly illustrated by hydrogenations in the field of steam cracking to produce olefins, by catalytic reforming and satellite processes to produce aromatics, and by new processes such as dehydrogenation, metathesis and oligomerization which provide better balance to the market for olefins.

Population Status of Commercially Important Medicinal Plants in Dehradun Forest Division, Uttarakhand (India

Directory of Open Access Journals (Sweden)

Ninad B. RAUT

2013-05-01

Full Text Available The objective of forest management in the tropics, in recent decades, has shifted from timber production to biodiversity conservation and maintenance of life support system. However, past forestry practices have greatly influenced the structure of plant communities, preponderance of foreign invasive species, populations of high value medicinal plants as well as other non-wood forest products. We assessed the abundance and distribution of medicinal plants in managed and undisturbed forests of Dehradun Forest Division (DFD, Uttarakhand (India. A total of 80 transects (each 1 km long were laid in various categories of forest types in DFD. This paper deals with distribution, availability and regeneration status of five commercially important species viz., Justicia adhatoda, Aegle marmelos, Phyllanthus emblica, Terminalia bellirica and Terminalia chebula, across different forest types. The study reveals that open canopy forest patches, Lantana infested patches and Acacia catechu-Dalbergia sissoo (Khair -Shisam woodlands in the eastern part of the DFD have excellent potential for the production and sustainable harvest of Justicia adhatoda. Areas those are less suitable for timber production viz., open hill forests, have greater potential for conservation and development of Aegle marmelos, Phyllanthus emblica and Terminalia bellirica. For the production and management of high value medicinal plants in the DFD these ecological considerations need to be kept in mind.

Vocabulaire en action intermédiaire A2

CERN Document Server

Callet, Stéphanie

2011-01-01

Un parcours d'apprentissage complet : J'observe, J'analyse et j'explique, Je compare, Je pratique, Je passe à l'action, Je consulte le mémento lexical. Une démarche entièrement tournée vers l'action : pour acquérir ou réviser les compétences lexicales, pour maîtriser la communication orale et écrite. En situation de classe ou en autonomie. Avec un CD audio, des évaluations et un livret de corrigés.

System-wide Benefits of Intermeal Fasting by Autophagy

NARCIS (Netherlands)

Martinez-Lopez, Nuria; Tarabra, Elena; Toledo, Miriam; Garcia-Macia, Marina; Sahu, Srabani; Coletto, Luisa; Batista-Gonzalez, Ana; Barzilai, Nir; Pessin, Jeffrey E.; Schwartz, Gary J.; Kersten, Sander; Singh, Rajat

2017-01-01

Autophagy failure is associated with metabolic insufficiency. Although caloric restriction (CR) extends healthspan, its adherence in humans is poor. We established an isocaloric twice-a-day (ITAD) feeding model wherein ITAD-fed mice consume the same food amount as ad libitum controls but at two

Représentations de niveau intermédiaire pour la modélisation d'objets

OpenAIRE

Tsogkas , Stavros

2016-01-01

In this thesis we propose the use of mid-level representations, and in particular i) medial axes, ii) object parts, and iii)convolutional features, for modelling objects.The first part of the thesis deals with detecting medial axes in natural RGB images. We adopt a learning approach, utilizing colour, texture and spectral clustering features, to build a classifier that produces a dense probability map for symmetry. Multiple Instance Learning (MIL) allows us to treat scale and orientation as l...

Dicty_cDB: Contig-U12802-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available cobacter cetorum strain MIT-0... 38 0.23 AF237484_1( AF237484 |pid:none) Dirofilaria immitis intermed...87 ( O97594 ) RecName: Full=Structural maintenance of chromosomes pro... 36 0.87 U00680_1( U00680 |pid:none) Brugia malayi intermed...1305( CP000879 |pid:none) Petrotoga mobilis SJ95, complet... 38 0.30 (Q9BZF9) RecName: Full=Uveal autoantigen with coiled...ns BAC clone RP11-764E7 from 2, complet... 34 0.79 6 ( FK620261 ) 454GmaGlobSeed354893 Soybean Seed...ditis elegans clone Y71H2X, *** SEQUENCI... 38 4.5 7 ( AC146972 ) Medicago truncatula clone mth2-128d9, compl

Dicty_cDB: Contig-U15590-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -20 CT005272_460( CT005272 |pid:none) Leishmania major strain Friedlin... 85 7e-20 S37963( S37963 ;S47957) mitochondrial intermed...D6) RecName: Full=Mitochondrial intermediate peptidase; ... 89 5e-34 CP000964_2806( CP000964 |pid:none) Klebsie... U80034_1( U80034 |pid:none) Homo sapiens mitochondrial intermediat... 93 4e-31 AY075581_1( AY075581 |pid:no...95 2e-17 AK050120_1( AK050120 |pid:none) Mus musculus adult male liver tumo... 91 3e-16 (Q753X4) RecName: Full=Mitochondrial interm... (A7TSL2) RecName: Full=Mitochondrial intermediate peptidase; ... 101 3e-34 (Q6CH

Current knowledge from experimental works with radioprotective drugs from the viewpoint of latest scientific research

International Nuclear Information System (INIS)

Skalka, J.

2008-01-01

The protection of both human and animal population against a radiation impairment proves to be an impulse for continuous intensive searching for plants with radioprotective properties, identification of their radioprotective components and examination of their effects both in vivo an in vitro. I am presenting the results as well as knowledge of a latest scientific research in this field with testing the following plants: Vigna radiata, Mentha piperita, Citrus aurantium var. amara, Syzygium cumini, Tinospora cordifolia, Aegle marmelos, Phyllanthus amarus, Aloe vera, Angelica sinensis, Rosemarinus officinalis, Panax ginseng, Hippophae rhamnoides, Ocimum sanctum, Crataegus microphylla. (authors)

Current knowledge from experimental works with radioprotective drugs from the viewpoint of latest scientific research; Aktualne poznatky z experiment8lnych prac s rastlinami s radioprotektivnym ucinkom vo svetle najnovsich vedeckych vyskumov

Energy Technology Data Exchange (ETDEWEB)

Skalka, J [Ustav vyzivy, dietetiky a krmovinarstva, Univerzita veterinarskeho lekarstva, 04181 Kosice (Slovakia)

2008-06-15

The protection of both human and animal population against a radiation impairment proves to be an impulse for continuous intensive searching for plants with radioprotective properties, identification of their radioprotective components and examination of their effects both in vivo an in vitro. I am presenting the results as well as knowledge of a latest scientific research in this field with testing the following plants: Vigna radiata, Mentha piperita, Citrus aurantium var. amara, Syzygium cumini, Tinospora cordifolia, Aegle marmelos, Phyllanthus amarus, Aloe vera, Angelica sinensis, Rosemarinus officinalis, Panax ginseng, Hippophae rhamnoides, Ocimum sanctum, Crataegus microphylla. (authors)

Uso da geoestatística para avaliar a captação automática dos níveis de pressão sonora em instalações de creche para suínos Geostatistics to evaluate the automatic acquisiton of sound pressure levels in pig nursery facilities

Directory of Open Access Journals (Sweden)

Giselle Borges

2010-06-01

Full Text Available Este trabalho teve o objetivo de estudar a influência da distribuição de decibelímetros na captação automática dos níveis de pressão sonora, em ambiente de produção intensiva de suínos. O experimento foi conduzido em sala do setor de creche de uma granja comercial de suínos situada no município de Monte Mor, Estado de São Paulo. A sala foi dividida em dez quadrantes idênticos, e os decibelímetros foram instalados no centro geométrico de cada quadrante. Utilizou-se a geoestatística para avaliar a dependência espacial entre os decibelímetros e para predizer os níveis de pressão sonora em locais onde estes não foram instalados. Os dados foram analisados pela correlação entre os decibelímetros e por intermédio da geoestatística, que possibilitou afirmar que não houve dependência espacial entre os pontos de registro dos níveis de pressão sonora. Por intermédio da interpolação dos pontos de captura utilizando o processo de krigagem, foi possível predizer os níveis de pressão sonora nos locais onde não havia decibelímetros no interior da instalação. Verificou-se homogeneidade de propagação dos níveis de pressão sonora no interior da instalação, concluindo que, para o ambiente avaliado, o uso de somente um equipamento para o registro automático dos níveis de pressão sonora é suficiente.The objective of this work was to study the influence of decibelimeters distribution in the automatic acquisition of sound pressure levels in pig nursery facilities. The experiment was conducted in a nursering room of a commercial swine's facility situated in the city of Monte Mor, State of São Paulo, Brazil. The room was divided in ten identical quadrants and the geometrical center of each quadrant was installed the decibelimeters. Geostatistics was used to evaluate the spatial dependence among the decibelimeters and to predict sound pressure levels in the places that they were not installed. Data were analyzed by the

Dicty_cDB: Contig-U16049-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 46 0.003 (Q99MI1) RecName: Full=ELKS/RAB6-interacting/CAST family member ... 46 0.003 ( P90901 ) RecName: Full=Intermed...158L3-1, ... 46 0.003 X70834_1( X70834 |pid:none) C.elegans IFA1 gene for intermed...ma OY-M D... 45 0.006 AY154743_1( AY154743 |pid:none) Heterodera glycines intermediate f... 45 0.006 BC01755...e R3-3104H6, **... 44 0.35 5 ( EK361499 ) 1095469021880 Global-Ocean-Sampling_GS-31-01-01-1... 34 0.75 2 ( A...is duranensis genomi... 48 1.0 1 ( EJ349938 ) 1092963576764 Global-Ocean-Sampling_GS-28-01-01-1... 48 1.0 1

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available |1RMQ|B Chain B, Crystal Structure Of ... Apha Class B Acid PhosphatasePHOSPHOTRANSFERASE WITH ... OSMIATE MIMIC...lass B Acid ... PhosphatasePHOSPHOTRANSFERASE WITH OSMIATE MIMICKING THE ... Catalytic Interme

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available |1RMQ|B Chain B, Crystal Structure Of ... Apha Class B Acid PhosphatasePHOSPHOTRANSFERASE WITH ... OSMIATE MIMIC...lass B Acid ... PhosphatasePHOSPHOTRANSFERASE WITH OSMIATE MIMICKING THE ... Catalytic Interme

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available |1RMQ|B Chain B, Crystal Structure Of ... Apha Class B Acid PhosphatasePHOSPHOTRANSFERASE WITH ... OSMIATE MIMIC...lass B Acid ... PhosphatasePHOSPHOTRANSFERASE WITH OSMIATE MIMICKING THE ... Catalytic Interme

Sequence Classification: 890855 [

Lifescience Database Archive (English)

Full Text Available embrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase express...Non-TMB Non-TMH TMB Non-TMB TMB Non-TMB >gi|6321908|ref|NP_011984.1| Mitochondrial interm

Sequence Classification: 890714 [

Lifescience Database Archive (English)

Full Text Available Non-TMB TMH TMB Non-TMB TMB Non-TMB >gi|6321771|ref|NP_011847.1| Plasma membrane urea transporter, express...ion is highly sensitive to nitrogen catabolite repression and induced by allophanate, the last interm

Ag-protein plasmonic architectures for surface plasmon-coupled emission enhancements and Fabry-Perot mode-coupled directional fluorescence emission

Science.gov (United States)

Badiya, Pradeep Kumar; Patnaik, Sai Gourang; Srinivasan, Venkatesh; Reddy, Narendra; Manohar, Chelli Sai; Vedarajan, Raman; Mastumi, Noriyoshi; Belliraj, Siva Kumar; Ramamurthy, Sai Sathish

2017-10-01

We report the use of silver decorated plant proteins as spacer material for augmented surface plasmon-coupled emission (120-fold enhancement) and plasmon-enhanced Raman scattering. We extracted several proteins from different plant sources [Triticum aestivum (TA), Aegle marmelos (AM), Ricinus communis (RC), Jatropha curcas (JC) and Simarouba glauca (SG)] followed by evaluation of their optical properties and simulations to rationalize observed surface plasmon resonance. Since the properties exhibited by protein thin films is currently gaining research interest, we have also carried out simulation studies with Ag-protein biocomposites as spacer materials in metal-dielectric-metal planar microcavity architecture for guided emission of Fabry-Perot mode-coupled fluorescence.

Browse Title Index

African Journals Online (AJOL)

Items 601 - 650 of 3286 ... Vol 21, No 1 (2015), Complication de prothèse intermédiaire, Abstract ... Wakatou Mama, Gamedzi K Akakpo-Numado, Hubert Tekou ... de Mohammedia (Maroc) concernant le dépistage du cancer du sein, Abstract.

Sensitivity of reactor multiplication factor to positions of cross-section ...

Indian Academy of Sciences (India)

V GOPALAKRISHNAN

2017-08-16

Aug 16, 2017 ... an energetically excited system formed as an interme- diate state with the ... The evaluated nuclear data files/libraries are major sources of nuclear ...... reactor case, the net relative deviation is about 330 pcm, which is close to ...

AJER VOLUME II-JULY 2014

African Journals Online (AJOL)

user

Majority are hired and their payment is made in-terms of the share of .... one in which there are basically three commercially important species ... everything as a lot of ecological change has taken place in this lake for the past 4 decades.

The electrical and electrochemical properties of graphene nanoplatelets modified 75V2O5e25P2O5 glass as a promising anode material for lithium ion battery

CSIR Research Space (South Africa)

Kebede, Mesfin A

2018-02-01

Full Text Available A V2O5 anode material significantly challenged on its further development to be used in lithium ion batteries in-terms of its structural degradation, poor cyclability and low conductivity. Thus researchers started to work on composite matrix...

O que muda quando se expande o assalariamento (e em que o debate da Sociologia pode nos ajudar a compreendê-lo?

Directory of Open Access Journals (Sweden)

Nadya Araujo Guimarães

2011-01-01

Full Text Available Depuis la seconde moitié des années 2000, on observe au Brésil une reprise continue de l'emploi formel comprenant la croissance remarquable d'une forme particulière de relation d'emploi, c'est-à-dire le travail par intermédiation. On élargit ainsi non seulement une autre modalitéde gestion de l'embauche et des contrats de travail, mais on renforce un florissant domaine des affaires d'oú émergent de nouvelles formes d'articulation entre sociétés usagères et médiatrices du travail. Des preuves empiriques approfondissent le cas de São Paulo, le plus grand marché brésilien d'emplois formels, ainsi que de postes par intermédiation, selon des données de la RAIS-Migra et de la PAEP/SP.

Greener Alternatives to Expedient Synthesis of Heterocycles and Nanomaterial

Science.gov (United States)

A brief account of reactions involving microwave (MW) exposure of neat reactants or catalyzed by mineral support surfaces, such as alumina, silica, clay, or their ‘doped’ versions, for the rapid one-pot assembly of heterocyclic compounds [1] from in situ generated reactive interm...

Crystallization in diblock copolymer thin films at different degrees of supercooling

DEFF Research Database (Denmark)

Darko, C.; Botiz, I.; Reiter, G.

2009-01-01

The crystalline structures in thin films of polystyrene-b-poly(ethylene oxide) (PS-b-PEO) diblock copolymers were studied in dependence on the degree of supercooling. Atomic force microscopy showed that the crystalline domains (lamellae) consist of grains, which are macroscopic at low and interme...

Inhalation Anthrax (Ames aerosol) in Naive and Vaccinated New Zealand Rabbits: Characterizing the Spread of Bacteria from Lung Deposition to Bacteremia

Science.gov (United States)

2012-06-28

Lond.) 51, 372–385. Henderson, D. W., Peacock , S., and Belton, F. C. (1956). Observations on the prophylaxis of experimental pulmonary anthrax in...terms of the Creative Commons Attribution Non Commercial License, which permits non-commercial use, distribution, and reproduction in other forums

Amélioration de la capacité d'adaptation sociale et écologique aux ...

International Development Research Centre (IDRC) Digital Library (Canada)

... en plus intenses se multiplient en raison des phénomènes météorologiques extrêmes. ... d'établir des cartes de vulnérabilité aux changements climatiques et de ... intermédiaire et fonctionnaires des administrations locales et régionales.

Characterization of Li4Ti5O12 and LiMn2O4 spinel materials treated with aqueous acidic solutions

NARCIS (Netherlands)

Simon, D.R.

2007-01-01

In this thesis an investigation of two spinel materials, Li4Ti5O12 and LiMn2O4 used for Li-ion battery applications is performed interms of formation and reactivity towards acidic solutions. Subsequent characterizations such as structural, magnetic, chemical, and electrochemical characterizations

Study on uncertainty evaluation system for the safety evaluation of interim spent fuel storage facility

Energy Technology Data Exchange (ETDEWEB)

Kim, Myung Hyeon; Shin, Myeong Won; Rhy, Seok Jin; Cho, Dong Keon; Park, Dong Hwan [Kyunghee Univ., Seoul (Korea, Republic of); Cheong, Beom Jin [Minstry of Science and Technology, Gwacheon (Korea, Republic of)

1998-03-15

The main objective os to develop a technical standards for the facility operation of the interm, spent fuel storage facility and to develop a draft for the technical criteria to be legislated. The another objective os to define a uncertainty evaluation system for burn up credit application in criticality analysis and to investigate an applicability of this topic for future regulatory activity. Investigate a status of art for the operational criteria of spent fuel interm wet storage. Collect relevant laws, decree, notices and standards related to the operation of storage facility and study on the legislation system. Develop a draft of technical standards and criteria to be legislated. Define an evaluation system for the uncertainty analysis and study on the status of art in the field of criticality safety analysis. Develop an uncertainty evaluation system in criticality analysis with burnup credit and investigate an applicability as well as its benefits of this policy.

Screening of traditional antidiabetic medicinal plants of Mauritius for possible alpha-amylase inhibitory effects in vitro.

Science.gov (United States)

Kotowaroo, M I; Mahomoodally, M F; Gurib-Fakim, A; Subratty, A H

2006-03-01

In this study, seven exotic/indigenous medicinal plants of Mauritius, namely Coix lacryma-jobi (Poaceae), Aegle marmelos (Rutaceae), Artocarpus heterophyllus (Moraceae), Vangueria madagascariensis (Rubiaceae), Azadirachta indica (Meliaceae), Eriobotrya japonica (Rosaceae) and Syzigium cumini (Myrtaceae) were studied for possible effects on starch breakdown by alpha-amylase in vitro. The results showed that only Artocarpus heterophyllus significantly (p Artocarpus heterophyllus on alpha-amylase activity using rat plasma in vitro. It was found that the aqueous leaf extract significantly (p Artocarpus heterophyllus behaved as a competitive inhibitor. Results from the present study tend to indicate that Artocarpus heterophyllus could act as a 'starch blocker' thereby reducing post-prandial glucose peaks. Copyright 2006 John Wiley & Sons, Ltd.

Mass attenuation coefficients of X-rays in different medicinal plants

Energy Technology Data Exchange (ETDEWEB)

Morabad, R B [Department of Post-Graduate Studies and Research in Physics, Gulbarga University, Gulbarga 585106, Karnataka (India); Kerur, B.R. [Department of Post-Graduate Studies and Research in Physics, Gulbarga University, Gulbarga 585106, Karnataka (India)], E-mail: kerurbrk@yahoo.com

2010-02-15

The mass attenuation coefficients of specific parts of several plants, (fruits, leaves, stem and seeds) often used as medicines in the Indian herbal system, have been measured employing NaI (TI)) detector. The electronic setup used is a NaI (TI) detector, which is coupled to MCA for analysis of the spectrum. A source of {sup 241}Am is used to get X-rays in the energy range 8-32 keV from Cu, Rb, Mo, Ag and Ba targets. In the present study, the measured mass attenuation coefficient of Ocimum sanctum, Catharanthus roseus, Trigonella foenum-graecum, Azadirachta indica, Aegle marmelos, Zingiber officinalis, Emblica officinalis, Anacardium occidentale, Momordica charantia and Syzygium cumini show a linear relation with the energy.

Mass attenuation coefficients of X-rays in different medicinal plants

International Nuclear Information System (INIS)

Morabad, R.B.; Kerur, B.R.

2010-01-01

The mass attenuation coefficients of specific parts of several plants, (fruits, leaves, stem and seeds) often used as medicines in the Indian herbal system, have been measured employing NaI (TI)) detector. The electronic setup used is a NaI (TI) detector, which is coupled to MCA for analysis of the spectrum. A source of 241 Am is used to get X-rays in the energy range 8-32 keV from Cu, Rb, Mo, Ag and Ba targets. In the present study, the measured mass attenuation coefficient of Ocimum sanctum, Catharanthus roseus, Trigonella foenum-graecum, Azadirachta indica, Aegle marmelos, Zingiber officinalis, Emblica officinalis, Anacardium occidentale, Momordica charantia and Syzygium cumini show a linear relation with the energy.

Thermal battery with CO2 compression heat pump: Techno-economic optimization of a high-efficiency Smart Grid option for buildings

DEFF Research Database (Denmark)

Blarke, Morten; Yazawa, Kazuaki; Shakouri, Ali

2012-01-01

Increasing penetration levels of wind and solar power in the energy system call for the development of Smart Grid enabling technologies. As an alternative to expensive electro-chemical and mechanical storage options, the thermal energy demand in buildings offers a cost-effective option for interm......Increasing penetration levels of wind and solar power in the energy system call for the development of Smart Grid enabling technologies. As an alternative to expensive electro-chemical and mechanical storage options, the thermal energy demand in buildings offers a cost-effective option....... In a proof-of-concept case study, the TB replaces an existing electric resistance heater used for hot water production and an electric compressor used for air refrigeration in a central air conditioning system. A mathematical model for least-cost unit dispatch is developed. Heat pump cycle components...

Vers des modèles de services juridiques de base viables et pouvant ...

International Development Research Centre (IDRC) Digital Library (Canada)

fdieudonne

17 mai 2016 ... En fait, historiquement, le financement du secteur de la justice par les bailleurs de ..... sociétaux au niveau macro tel qu'un plus grand respect de la loi. .... Dans les trois pays à faible revenu ou à revenu intermédiaire de la ...

78 FR 2453 - Credit Suisse Opportunity Funds, et al.; Notice of Application

Science.gov (United States)

2013-01-11

... cash management purposes, or (b) engage in interfund borrowing and lending transactions, or invests in...-term cash management purposes. 9. Applicants state that investments by an Underlying Fund in a Cayman... Underlying Fund to: (i) Acquire securities of one or more investment companies for short-term cash management...

Case complexity in outpatients in a centre of excellence for somatic symptom disorder : A cross-sectional study

NARCIS (Netherlands)

van Eck van der Sluijs, J.F.; de Vroege, L.; van Manen, A.S.; van der Thiel, E.; Timmermans, A.; Pouwer, F.; van der Feltz-Cornelis, C.M.

2016-01-01

Background: At the Clinical Centre of Excellence for Body, Mind and Health, integrated care models are used to provide treatment to patients with Somatic Symptom and Related Disorders (SSD). The aim of this study is to describe complexity of SSD patients using the INTERMED. This instrument has been

Rossing

International Nuclear Information System (INIS)

Anon.

1979-01-01

Rossing is a uranium mine in the heart of the Namib desert in South West Africa (Namibia). Interms of the material recovered from the huge open pit, it is the largest uranium mine in the world. This article gives a short history of the development of this mine

IntermIttent PreventIve treatment and Bed nets uPtake among ...

African Journals Online (AJOL)

2015, in the number of pregnant women in Kenya receiving recommended malaria prophylaxis in the ... recommended that at least three IPtp doses be provided to pregnant ..... operational research and training Initiative (sort. It), a global ...

Charlotte Salomon ou l’art de l'intermédialité

NARCIS (Netherlands)

Grijpma, D.

2010-01-01

In exile on the Côte d’Azur Charlotte Salomon (Berlin 1917-Auschwitz 1943) painted Leben?oder Theater? (LT). The work, an impressive life-story, comprises more than a thousand pages: gouaches, painted text and text fragments on transparent paper. Since 1971 LT has been in the collection of the

Acute effects on metabolism and appetite profile of one meal difference in the lower range of meal frequency.

Science.gov (United States)

Smeets, Astrid J; Westerterp-Plantenga, Margriet S

2008-06-01

A gorging pattern of food intake has been shown to enhance lipogenesis and increase body weight, which may be due to large fluctuations in storage and mobilisation of nutrients. In a state of energy balance, increasing meal frequency, and thereby decreasing inter-meal interval, may prevent large metabolic fluctuations. Our aim was to study the effect of the inter-meal interval by dividing energy intake over two or three meals on energy expenditure, substrate oxidation and 24 h satiety, in healthy, normal-weight women in a state of energy balance. The study was a randomised crossover design with two experimental conditions. During the two experimental conditions subjects (fourteen normal-weight women, aged 24.4 (SD 7.1) years, underwent 36 h sessions in energy balance in a respiration chamber for measurements of energy expenditure and substrate oxidation. The subjects were given two (breakfast, dinner) or three (breakfast, lunch, dinner) meals per d. We chose to omit lunch in the two meals condition, because this resulted in a marked difference in inter-meal-interval after breakfast (8.5 h v. 4 h). Eating three meals compared with two meals had no effects on 24 h energy expenditure, diet-induced thermogenesis, activity-induced energy expenditure and sleeping metabolic rate. Eating three meals compared with two meals increased 24 h fat oxidation, but decreased the amount of fat oxidised from the breakfast. The same amount of energy divided over three meals compared with over two meals increased satiety feelings over 24 h. In healthy, normal-weight women, decreasing the inter-meal interval sustains satiety, particularly during the day, and sustains fat oxidation, particularly during the night.

La « faillite » du ciblage monétaire en Tunisie ?

Directory of Open Access Journals (Sweden)

Rima Lajnaf

2014-09-01

Full Text Available Les monétaristes ont montré que l’accélération de la masse monétaire ne ferait qu’attiser l’inflation. Leur idée a gagné en influence auprès des banques centrales, les incitant dans les années soixante-dix à s’efforcer de mieux maîtriser l’inflation en utilisant les agrégats monétaires comme les variables de leurs objectifs intermédiaires. Cependant, même si l’utilisation des cibles monétaires est répandue dans le monde entier, il n’existe pas de consensus sur la causalité entre la monnaie et les prix. Ce problème a fait l’objet d’un débat très animé entre les économistes surtout durant les trois dernières décennies caractérisées par l’innovation financière. La stratégie de ciblage de l’agrégat monétaire n’est efficace que si ce dernier, considéré comme une cible intermédiaire, possède des propriétés satisfaisantes en termes de stabilité, de contrôlabilité et du contenu en information. Dans ce papier, nous allons étudier l’efficacité de la politique d’ancrage monétaire en Tunisie en analysant les propriétés de l’agrégat M3. Les résultats montrent que le choix de cet agrégat comme un objectif intermédiaire ne semble pas être justifié.

Chemical Stability of Telavancin in Elastomeric Pumps

Directory of Open Access Journals (Sweden)

Patrick Sand, MSc

2015-12-01

Conclusions: The results of this study indicate that telavancin remains chemically stable when diluted in the Intermate Infusion System and the Homepump Eclipse elastomeric pumps and stored at 2°C to 8°C for up to 8 days protected from light at the concentration range and dilution schemes evaluated.

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

During the later part of the intermonsoon (InterM) phase, an abrupt decline in salinity led to a surge in phytoplankton biomass (Chlorophyll ∼14 mg m−3), of a population that was dominated by Thalassiosira eccentricus. As the southwest monsoon (SWM) progressed and the estuary freshened salinity and Chlorophyll  ...

Biodiversity loss, emerging infectious diseases and impact on human and crops

International Nuclear Information System (INIS)

Shinwari, Z.K.; Gilani, S.A.; Khan, A.L.

2012-01-01

We are losing biodiversity through several factors ranging from global warming, climatic change, unsustainable use of natural resources, human settlements, demand for food, medicine etc. Consequently, the biodiversity losses are causing emergence of infectious diseases (EIDs) which are making them more virulent than the past. Both biodiversity loss and emergence of diseases significantly impact the human derived benefits in-terms of economy and food. Ecological stability, productivity and food-web interactions are indirectly correlated with biodiversity and any change in these will cause losses in biodiversity that would certainly influence the human derived benefits and crops. The current article reviews the biodiversity losses and emerging infectious diseases at various levels reported by recent literature which will help in current status of EIDs and future recommendations. (author)

Experiment list: SRX977415 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 97.4,25.7,24253 GSM1648666: H3K4me3 ChipSeq day15; Mus musculus; ChIP-Seq source_name=reprogramming intermed...iate after 15days of induction || cell type=reprogramming intermediate || genotype=H3K4me3-GFP/ Rosa26-M2rtT

Experiment list: SRX977423 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ,99.0,6.9,4818 GSM1648674: H3K27me3 ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming intermed...iate after 11days of induction || cell type=reprogramming intermediate || genotype=H3K27me3-GFP/ Rosa26-M2rt

Experiment list: SRX977421 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ,98.5,10.5,6589 GSM1648672: H3K27me3 ChipSeq day5; Mus musculus; ChIP-Seq source_name=reprogramming intermed...iate after 5days of induction || cell type=reprogramming intermediate || genotype=H3K27me3-GFP/ Rosa26-M2rtT

Experiment list: SRX977414 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 98.5,25.1,26501 GSM1648665: H3K4me3 ChipSeq day11; Mus musculus; ChIP-Seq source_name=reprogramming intermed...iate after 11days of induction || cell type=reprogramming intermediate || genotype=H3K4me3-GFP/ Rosa26-M2rtT

Kenya : tous les projets | Page 5 | CRDI - Centre de recherches pour ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le tabagisme est l'un des principaux facteurs de risque associé à la charge de morbidité croissante liée aux maladies non transmissibles (MNT) dans les pays à faible revenu et pays à revenu intermédiaire. Région: Ethiopia, Kenya, Rwanda, Tanzania, Uganda. Programme: Alimentation, environnement et santé.

Development, applications and distribution of DNA markers for genetic information for sorghum and maize improvement

International Nuclear Information System (INIS)

Lee, M.

2001-01-01

This final report summarizes the progress made towards the enhancement and distribution of genetic resources (e.g. genetic stocks, seed and DNA clones) used for basic and applied aspects of the genetic improvement of maize and sorghum. The genetic maps of maize and sorghum were improved through comparative mapping of RFLP loci detected by 124 maize cDNA clones and through the development of a new mapping population of maize. Comparative mapping between maize and sorghum and maize and rice, using the set of 124 maize cDNA clones (and other clones) in each study, substantiated previous observations of extensive conservation of locus order but it also provided strong evidence of numerous large-scale chromosomal rearrangements. The new mapping population for maize (intermated B73xMo17, 'IBM') was created by random intermating during the first segregating generation. Intermating for four generations prior to the derivation of recombinant inbred lines (RILs) increased the frequency of recombinants at many regions of the maize genome and provided better genetic resolution of locus order. Expansion of the maize genetic map was not uniform along the length of a linkage group and was less than the theoretical expectation. The 350 IBM RILs were genotyped at 512 loci detected by DNA clones, including 76 of the 124 supported by this contract. The production of the sorghum mapping population of RILs from the cross CK60xPI229828 has been delayed by weather conditions that were not conducive to plant growth and seed development. Seed of the IBM RILs have been distributed (approximately 5000 RILs in total) to 16 research organizations in the public and private sector. The DNA clones have been distributed (1,206 in total) to nine research labs. Further distribution of the seed and clones will be managed by curators at stock centers in the public domain. (author)

marche et commercialisation du riz local au centre-ouest de la côte ...

African Journals Online (AJOL)

AISA

Pour le choix des producteurs, un échantillonnage à deux ... modes de financement et de règlement de transaction, les contraintes, les ..... réduites, car le stockage suppose des conditions de conservation adéquates, et donc, des investissements. Le termaillage est pratiqué par les intermédiaires commerciaux qui financent ...

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

The amount of loss interms of life and infrastructure has been rising continuously due to significant increase in population andinfrastructure. This study is an attempt to identify seismically susceptible areas in western Himalaya,using pattern recognition technique. An area between latitude 29◦–36◦N and longitude 73◦–80◦E ...

Renforcement des capacités de recherche et de l'élaboration de ...

International Development Research Centre (IDRC) Digital Library (Canada)

... naturelles et aux économies des zones de montagnes; - renforcer les capacités de planification des représentants des gouvernements locaux en matière de développement économique et communautaire, surtout dans les zones rurales, par l'intermédiaire de la School of Professional and Continuing Education (SPCE).

Évaluation d'une intervention intégrée visant à convaincre les ...

International Development Research Centre (IDRC) Digital Library (Canada)

Dans les pays à faible revenu et les pays à revenu intermédiaire où le tabagisme est répandu, la tuberculose constitue un problème majeur. ... ASSIST Pakistan : Action to Stop Smoking In Suspected Tuberculosis in Pakistan; an intervention to stop tobacco use among patients suspected of TB - evaluation of an integrated ...

STUDY OF REACTION SEQUENCES FOR FORMATION OF SOLID ...

African Journals Online (AJOL)

31 déc. 2012 ... phase intermédiaire PbTiO3 et la formation de PZT à 800 °C. ... matériau céramique de type PZT de formule chimique: 0,48PbZrO3-0 .... (ATG) relative au mélange par un changement de perte visible équivalente à 3%.

South Africa : tous les projets | Page 6 | CRDI - Centre de ...

International Development Research Centre (IDRC) Digital Library (Canada)

Programme: Alimentation, environnement et santé. Financement total : CA$ 40,000.00. L'investissement étranger direct (IED) dans les pays à faible revenu et à revenu intermédiaire. Project. Dans le cadre de ce projet, les chercheurs étudieront l'impact de l'investissement étranger direct (IED) sur l'efficience économique, ...

Concilier cantine bio et agriculture locale, les voies possibles

OpenAIRE

Aubry, Christine

2012-01-01

revue en ligne; Les cantines bio peinent souvent à concilier produits bio et circuits courts. Face au risque de « dilution de l’esprit pionnier », des expériences récentes montrent que le recours à des intermédiaires dans la chaîne agroalimentaire peut constituer une voie de diffusion du bio dans les cantines.

Résultats de recherche | Page 24 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'appel à notes conceptuelles sur la dimension économique de la lutte antitabac dans les pays à faible revenu et les pays à revenu intermédiaire (PFR-PRI) offre jusqu'à 1 million de CAD sur un maximum de quatre ans pour appuyer des recherches fond. Region. North and Central America. Deadline. 15 décembre 2017.

Résultats de recherche | Page 27 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

Évaluation d'une intervention intégrée visant à convaincre les patients qu'on pense atteints de tuberculose de cesser de fumer (Pakistan). Dans les pays à faible revenu et les pays à revenu intermédiaire où le tabagisme est répandu, la tuberculose constitue un problème majeur. Projet.

Exploitation du savoir autochtone afin de créer des emplois pour les ...

International Development Research Centre (IDRC) Digital Library (Canada)

La Commission des Nations unies pour la démarginalisation estime que quatre milliards de personnes ne peuvent pas exercer leurs droits juridiques à cause des coûts, du dysfonctionnement, de la corruption ou de l'abus de pouvoir. Il existe un besoin reconnu en institutions intermédiaires, comme les médias, les partis ...

Structure cristalline du composé intermétallique Ni18Ge12

Directory of Open Access Journals (Sweden)

Mohammed Kars

2015-03-01

Full Text Available Single crystals of octadecanickel dodecagermanide were grown by chemical transport reaction. The intermetallic compound crystallizes in a superstructure of the hexagonal NiAs type (B8 type. All atoms in the asymmetric unit lie on special positions except one Ni atom (two Ni atoms have site symmetry -6.. and another one has site symmetry .2. while the Ge atoms have site symmetries 32., m.. and 3... In the structure, the Ni atoms are arranged in 11- or 13-vertex polyhedra (CN = 11–13. The coordination polyhedra of the Ge atoms are bicapped square antiprisms (CN = 10 or 11-vertex polyhedra (CN = 11. The structure exhibits strong Ge...Ni interactions, but no close Ge...Ge contacts are observed. The Ni atoms with CN = 13 form infinite chains along [001] with an Ni—Ni distance of 2.491 (2 Å.

Evaluation of selected Indian traditional folk medicinal plants against Mycobacterium tuberculosis with antioxidant and cytotoxicity study.

Directory of Open Access Journals (Sweden)

Tawde K. V

2012-10-01

Full Text Available Objective: To evaluate different solvent extracts of selected Indian traditional medicinal plant against Mycobacterium tuberculosis, its antioxidant potential and cytotoxicity. Methods: Acacia catechu (L. Willd (Root extract and Ailanthus excelsa Roxb., leaf extracts of Aegle marmelos Corr., Andrographis paniculata Nees. and Datura metel L. were sequentially extracted in water, ethanol, chloroform and hexane and evaluated for their anti-tuberculosis (TB activity against Mycobacterium tuberculosis using agar diffusion assay. The zone of inhibition ( at 20 and 40 mg/ ml was measured and MIC were calculated. The results were compared with Rifampicin as a standard anti TB drug. The extracts were also evaluated for DPPH and OH radical scavenging activities to understand their antioxidant potential. MTT based cytotoxicity assay was used for evaluating cytotoxicity of the selected samples against Chang liver cells. Results: The selected botanicals were sequentially extracted in water, ethanol, chloroform and hexane and tested for growth inhibition of M. tuberculosi. The hexane extract of A. catechu root and ethanol extract of A. paniculata leaf showed promising activity against M. tuberculosis while remaining extracts showed moderate anti TB activity. The samples were found to possess considerable DPPH and OH radical scavenging activities with no demonstrable cytotoxicity against Chang liver cells. Conclusions: Five traditional medicinal plants were selected for the present study. The selection of medicinal plants was based on their traditional usage for the treatment of tuberculosis, asthma and chronic respiratory diseases. Herein we report for the first time, the anti TB activity of root extracts of Acacia catechu and Ailanthus excelsa while leaf extract of Andrographis paniculata, Aegle marmelos and Datura metel. The study holds importance in the midst of multi drug resistance (MDR crisis in the TB management, since it unravels the scientific basis

Development and validation of High-performance Thin-layer Chromatography Method for Simultaneous Determination of Polyphenolic Compounds in Medicinal Plants.

Science.gov (United States)

Jayachandran Nair, C V; Ahamad, Sayeed; Khan, Washim; Anjum, Varisha; Mathur, Rajani

2017-12-01

Quantitative standardization of plant-based products is challenging albeit essential to maintain their quality. This study aims to develop and validate high-performance thin-layer chromatography (HPTLC) method for the simultaneous determination of rutin (Ru), quercetin (Qu), and gallic acid (Ga) from Psidium guajava Linn. (PG) and Aegle marmelos (L.) Correa. (AM) and correlate with antioxidant activity. The stock solution (1 mg/mL) of standard Ru, Qu, and Ga in methanol: Water (1:1) was serially diluted and spotted (5 μL) on slica gel 60 F 254 thin-layer chromatography plates. Toluene: Ethyl acetate: Formic acid: Methanol (3:4:0.8:0.7, v/v/v) was selected as mobile phase for analysis at 254 nm. Hydroalcoholic (1:1) extracts of leaves of PG and AM were fractionated and similarly analyzed. Antioxidant activity was also determined using 2, 2-diphenyl-1-picrylhydrazyl assay. The developed method was robust and resolved Ru, Qu, and Ga at R f 0.08 ± 0.02, 0.76 ± 0.01, and 0.63 ± 0.02, respectively. The intra-day, interday precision, and interanalyst were limit of detection and limit of quantification for Ru, Qu, and Ga were 4.51, 4.2, 5.27, and 13.67, 12.73, 15.98 ng/spot, respectively. Antioxidant activity (Log 50% inhibition) of PG and AM was 4.947 ± 0.322 and 6.498 ± 0.295, respectively. The developed HPTLC method was rapid, accurate, precise, reproducible, and specific for the simultaneous estimation of Ru, Qu, and Ga. HPTLC method for simultaneous determination and quantification of Rutin, Quercetin and Gallic acid, is reported for quality control of herbal drugs. Abbreviations Used: A: Aqueous fraction; AM: Aegle marmelos L. Correa; B: Butanol fraction; C: Chloroform fraction; EA: Ethyl acetate fraction; Ga: Gallic acid; H: Hexane fraction; HA: Hydroalcoholic extract; HPTLC: High-performance thin-layer chromatography; PG: Psidium guajava ; Qu: Quercetin; Ru: Rutin.

Implications of International Financial Reporting Standards of Performance Indicators within a Company

Directory of Open Access Journals (Sweden)

Lucean MIHALCEA

2010-08-01

Full Text Available Romania started a process to reform the accounting system, having the assistance benefit of EU countries (France, Belgian, and UK. Initial path chosen by Romania to harmonize accounting system was marked by the Accounting Law 82/1991 and subsequent amendments and regulations for its implementation reflected the tortuous road to EU accession and accumulation achieved by developing the accountancy profession. Interms of accounting regulatory level, we can say, without fail, that now Romania is perfectly in line with European requirements in financial reporting, as the country recently became a member of the European Union. Thus, Accounting regulations with European directives (approved by MPFO 1752/2005, then modified and supplementedby MPFO 2001/2006 provide reporting framework in strict correlation with the requirements of European directives in the field.

Effect of medicinal plants on the crystallization of cholesterol

Science.gov (United States)

Saraswathi, N. T.; Gnanam, F. D.

1997-08-01

One of the least desirable calcifications in the human body is the mineral deposition in atherosclerosis plaques. These plaques principally consist of lipids such as cholesterol, cholesteryl esters, phospholipids and triglycerides. Chemical analysis of advanced plaques have shown the presence of considerable amounts of free cholesterol identified as cholesterol monohydrate crystals. Cholesterol has been crystallized in vitro. The extracts of some of the Indian medicinal plants detailed below were used as additives to study their effect on the crystallization behaviour of cholesterol. It has been found that many of the herbs have inhibitory effect on the crystallization such as nucleation, crystal size and habit modification. The inhibitory effect of the plants are graded as Commiphora mughul > Aegle marmeleos > Cynoden dactylon > Musa paradisiaca > Polygala javana > Alphinia officinarum > Solanum trilobatum > Enicostemma lyssopifolium.

Biotechnological applications of microalgae

OpenAIRE

Wan-Loy Chu

2012-01-01

Microalgae are important biologicalresources that have a wide range of biotechnologicalapplications. Due to their high nutritional value,microalgae such as Spirulina and Chlorella are beingmass cultured for health food. A variety of high-valueproducts including polyunsaturated fatty acids (PUFA),pigments such as carotenoids and phycobiliproteins, andbioactive compounds are useful as nutraceuticals andpharmaceuticals, as well as for industrial applications. Interms of environmental biotechnolo...

Développer la médecine d'urgence en Éthiopie | IDRC ...

International Development Research Centre (IDRC) Digital Library (Canada)

18 sept. 2014 ... Depuis 2010, l'Université d'Addis-Abeba et l'Université de Toronto s'emploient ensemble à répondre aux besoins du pays en matière de formation et de recherche par l'intermédiaire de la Toronto-Addis Ababa Academic Collaboration in Emergency Medicine (TAAAC‑EM). De 2012 à 2014, le CRDI a ...

pour le trimestre qui a pris fin le 30 septembre 2013

International Development Research Centre (IDRC) Digital Library (Canada)

Sophie Comeau

30 sept. 2013 ... 9. Perspectives. ÉTATS FINANCIERS INTERMÉDIAIRES RÉSUMÉS, NON AUDITÉS. 11 Déclaration de responsabilité de la direction. 13 État intermédiaire résumé de la situation financière ... d'information financière (normes IFRS). Toutes les sommes sont exprimées en dollars canadiens, à moins ...

Engineering Design Handbook. Military Vehicle Power Plant Cooling

Science.gov (United States)

1975-06-01

conductivity of steel and, Indirect cooling is achieved by an interme- therefore, has a much higher heat transfer diary fluid that absorbs heat from...PROBABLZ - -- - - N PERFOEUMACE 0 t0 4 8 21 is s0 24 AIR DELIVEY,. CPU flo 1000-0- U.=rWIM-YEC0*4CAL " AYA OM". 7-6-59 F-igure 8-40. Cooling Fin

: tous les projets | Page 624 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Dans le cadre de ce projet, les chercheurs étudieront l'impact de l'investissement étranger direct (IED) sur l'efficience économique, la pauvreté et les inégalités dans les pays à faible revenu et à revenu intermédiaire. Date de début : 10 mars 2006. End Date: 10 janvier 2009. Sujet: FOREIGN INVESTMENT, DIRECT ...

Programme de leadership sur le climat : Renforcer la résilience de l ...

International Development Research Centre (IDRC) Digital Library (Canada)

S'adressant à trente chercheurs, conseillers en politique et praticiens intermédiaires et supérieurs, le programme permettra de soutenir les personnes ayant des idées sur les changements climatiques qui peuvent être appliquées à grande échelle et possédant la motivation et le potentiel de devenir des chefs de file dans ...

Résultats de recherche | Page 10 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

... physique et du transport actif chez les enfants d'âge scolaire au Kenya, au Nigeria et au Mozambique. Les maladies non transmissibles (MNT) représentent un important problème de santé publique à l'échelle mondiale. Les pays à faible revenu et les pays à revenu intermédiaire (PFR-PRI) sont particulièrement touchés.

Computational Study of Collisions Between O(3P) and NO(2Pi) at Temperatures Relevant to the Hypersonic Flight Regime

Science.gov (United States)

2014-10-29

distances of the NO2 molecule (Figure 1), and V1(x), V2 (x), and V3(x) are the potential energies for the three regions for which the distances r12 (N...Dunker, Res. Chem. Intermed. 20, 463–502 (1994). 7T. Schwartzentruber, L. Scalabrin, and I. Boyd, J. Spacecraft Rockets 45, 1196–1206 (2008). 8S. Mishra

Programme conjoint canado-israélien de recherche en santé | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

La recherche en immunologie peut aussi cibler certains des plus graves problèmes de santé des pays à faible revenu et à revenu intermédiaire, comme le VIH/sida, le cancer, le développement de vaccins et les maladies infectieuses. À cette fin, le Programme conjoint canado-israélien de recherche en santé appuie 6 ...

Fourier Transform Infrared Absorption Spectroscopy for Quantitative Analysis of Gas Mixtures at Low Temperatures for Homeland Security Applications.

Science.gov (United States)

Meier, D C; Benkstein, K D; Hurst, W S; Chu, P M

2017-05-01

Performance standard specifications for point chemical vapor detectors are established in ASTM E 2885-13 and ASTM E 2933-13. The performance evaluation of the detectors requires the accurate delivery of known concentrations of the chemical target to the system under test. Referee methods enable the analyte test concentration and associated uncertainties in the analyte test concentration to be validated by independent analysis, which is especially important for reactive analytes. This work extends the capability of a previously demonstrated method for using Fourier transform infrared (FT-IR) absorption spectroscopy for quantitatively evaluating the composition of vapor streams containing hazardous materials at Acute Exposure Guideline Levels (AEGL) to include test conditions colder than laboratory ambient temperatures. The described method covers the use of primary reference spectra to establish analyte concentrations, the generation of secondary reference spectra suitable for measuring analyte concentrations under specified testing environments, and the use of additional reference spectra and spectral profile strategies to mitigate the uncertainties due to impurities and water condensation within the low-temperature (7 °C, -5 °C) test cell. Important benefits of this approach include verification of the test analyte concentration with characterized uncertainties by in situ measurements co-located with the detector under test, near-real-time feedback, and broad applicability to toxic industrial chemicals.

Biodiversity and Indigenous Uses of Medicinal Plant in the Chandra Prabha Wildlife Sanctuary, Chandauli District, Uttar Pradesh

Directory of Open Access Journals (Sweden)

Maurya Santosh Kumar

2015-01-01

Full Text Available Conventional medicines are very important part of Indian culture. In this study the outcome of two-year study of ethnomedicinal uses of plants in Chandra Prabha Wildlife Sanctuary (CPWLS and nearby area is reported. Information related to different plants which are used by local community in the treatment of many common diseases and well-being in the area was collected. Data on the use of medicinal plants were collected using structured interview of about 122 participants and thorough observations and conversations with local communities. Approximately 100 plants belonging to 43 families used by the local healers were reported in this study. The plant species with the highest fidelity level (Fl were Holarrhena antidysenterica, Lawsonia inermis, Gymnema sylvestre, Dalbergia sissoo, Cassia fistula Linn., Butea monosperma (Lam. Kuntze., Boerhaavia diffusa Linn., Albizia lebbeck Benth., Aegle marmelos Correa., Sphaeranthus indicus Linn., and Solanum surattense Burm. f. The most frequent ailments reported were hepatitis, jaundice, constipation, and skin and urinary problems. The parts of the plants most frequently used were fruit, roots, and whole plants (17% followed by leaves (16% and bark (15%. This study presents new research efforts and perspectives on the search for new drugs based on local uses of medicinal plants.

Stimulation de la capacité d'innovation des micro, petites et ...

International Development Research Centre (IDRC) Digital Library (Canada)

Stimulation de la capacité d'innovation des micro, petites et moyennes entreprises d'Asie par le truchement d'intermédiaires ... En plus d'études de cas comparatives menées en Chine et en Thaïlande, des bourses de recherche menant à la maîtrise ou au doctorat seront octroyées à de jeunes professeurs ainsi qu'à des ...

pour le trimestre qui a pris fin le 30 juin 2014

International Development Research Centre (IDRC) Digital Library (Canada)

Office 2004 Test Drive User

30 juin 2014 ... ÉTATS FINANCIERS INTERMÉDIAIRES RÉSUMÉS, NON AUDITÉS. 9. Déclaration de responsabilité de la direction. 11 État intermédiaire résumé de la situation ... d'information financière (normes IFRS). ..... Le total des passifs a diminué de 4,4 millions de dollars (ou 7,9 %) par rapport à ce qu'il était.

Morphologie et abondance des stades de développement d'Ilyocoris ...

African Journals Online (AJOL)

SARAH

31 juil. 2014 ... l'évolution de certaines variables physico-chimiques. Les larves pullulent pendant la saison sèche et les ... scutellum brillants. Les tibias intermédiaires et postérieurs sont hérissés de fortes épines (Poisson, .... entre l'abondance des différents stades de développement d'Ilyocoris cimicoïdes et les variables.

Conseils subventionnaires de la recherche scientifique : un examen ...

International Development Research Centre (IDRC) Digital Library (Canada)

La façon dont les pays à faible revenu et les pays à revenu intermédiaire financent la science publique a un effet direct sur la capacité des chercheurs de produire des connaissances et sur la manière dont les organismes tiennent compte de ces connaissances et les utilisent. Même si certains pays à faible revenu et pays à ...

The effectiveness of two techniques in teaching content words to EFL students at a Turkish university

OpenAIRE

Raif, Özge Tılsım

1999-01-01

Ankara : The Institute of Economics and Social Sciences of Bilkent Univ., 1999. Thesis (Master's) -- Bilkent University, 1999. Includes bibliographical refences. This relationship study aimed at investigating the effects of the mnemonic keyword technique on recall of vocabulary items in comparison to a dictionary-meaning supplied group. The study was conducted at Middle East Technical University, Department of Basic English. The participants were thirty-two Pre-Interme...

Wireless Sensor/Actuator Network Design for Mobile Control Applications

Directory of Open Access Journals (Sweden)

Youxian Sung

2007-10-01

Full Text Available Wireless sensor/actuator networks (WSANs are emerging as a new generationof sensor networks. Serving as the backbone of control applications, WSANs will enablean unprecedented degree of distributed and mobile control. However, the unreliability ofwireless communications and the real-time requirements of control applications raise greatchallenges for WSAN design. With emphasis on the reliability issue, this paper presents anapplication-level design methodology for WSANs in mobile control applications. Thesolution is generic in that it is independent of the underlying platforms, environment,control system models, and controller design. To capture the link quality characteristics interms of packet loss rate, experiments are conducted on a real WSAN system. From theexperimental observations, a simple yet efficient method is proposed to deal withunpredictable packet loss on actuator nodes. Trace-based simulations give promisingresults, which demonstrate the effectiveness of the proposed approach.

Intermediaries in sustainable urban transitions

DEFF Research Database (Denmark)

Hoffmann, Birgitte; Agger, Annika

´s, or semi public institutions. Our claim is that interme-diary actors have the potential to reach a broader scope of citizens due to their particular role in between public au-thorities and civil society. The key question of the paper is how the intermediary actors facilitate citizens' participatory...... processes in sustainable urban management and the paper explores the development of communities of practise as a way to develop learning processes and new practises? The aim is to analyse approaches of involving citizens and how they contribute to the development of new actor configurations in urban social...... the development of new practises plays a part in multi level transitions. Empirically, the article is based on case studies from Denmark of local environmental centres, green guides etc. that have performed innovative forms of involving citizens in sustainable urban development. The empirical material...

Foreign Debt: Causes and Measures Taken

Directory of Open Access Journals (Sweden)

Ion Botescu

2016-01-01

Full Text Available In an increasingly globalized world, any crisis, including the ones caused by the foreign debtdefault of a country, may have a negative impact which can be contagious both at regional and atglobal level. Taking into account all the risks to which international creditors were subjectedover time, thestock of foreign debt worldwide has experienced a significant increase in the current millennium,actually demonstrating that international lending is profitable. The causes of default, the measures taken by the concerned countries to get out of this situationand the specific examples were the elements which I have tried to capture in this paper. Last butnot least, I have performed an analysis of the evolution of the foreign debt stock and the repaymentcapacity of small and medium-income countries, respectively the most vulnerable countries interms of debt repayment.

Antibacterial activity of combined medicinal plants extract against multiple drug resistant strains

Directory of Open Access Journals (Sweden)

Rafiqul Islam

2015-06-01

Full Text Available Objective: To find out the combined antibacterial efficacy of Aegle marmelos, Aphanamixis polystachya, Cuscuta reflexa and Aesclynomene indica against bacterial pathogens. Methods: Antibacterial potency of combined plant extracts has been tested against Bacillus subtilis IFO 3026, Sarcina lutea IFO 3232, Xanthomonas campestris IAM 1671, Escherichia coli IFO 3007, Klebsiella pneumoniae ATTC 10031, Proteus vulgaris MTCC 321 and Pseudomonas denitrificans KACC 32026 by disc diffusion assay. Commercially available standard antibiotic discs were also used to find out antibiotic resistance pattern of test organisms. Results: Among the test organisms, Escherichia coli, Proteus vulgaris, Klebsiella pneumoniae and Proteus denitrificans showed resistance against multiple commercially available antibiotics. On the other hand, these multiple drug resistant organisms showed susceptibility against combined plant extracts. Conclusions: These combined plants extracts showed synergistic antibacterial activity and could lead to new antibacterial drug designing.

PENGARUH EKSTRAK BEBERAPA TANAMAN OBAT TERHADAP USUS TERISOLASI

Directory of Open Access Journals (Sweden)

B. Dzulkarnain

2012-09-01

Full Text Available The extraction of Anacardium occidentale L.leaves, Aegle marmelos Corr leaves and wood bark, Acorus calamus L. tuber and Desmodium triquetrum D.C. leaves has been tested on the isolated rabbit and guinea pig intestine. The extraction of A. occidentale L. leaves stimulated the isolated rabbit and guinea pig intestine which may due to the anacardic acid content. No consistent influence was seen by the extraction of A.marmelos Corr. leaves and wood bark. The A. calamus L. tuber extraction decreases the isolated intestine activities which is of the atropine-like type not antihistamin one. This may explain the use as antidysentri agent from the motility point of view. The D. triquetrum D.C. leaves extraction stimulated the isolated intestine which has a pilocarpine and histamine-like activity but does not exclude a seretonine-like action.

Identification of pyrogallol as an antiproliferative compound present in extracts from the medicinal plant Emblica officinalis: effects on in vitro cell growth of human tumor cell lines.

Science.gov (United States)

Khan, Mahmud Tareq Hassan; Lampronti, Ilaria; Martello, Dino; Bianchi, Nicoletta; Jabbar, Shaila; Choudhuri, Mohammad Shahabuddin Kabir; Datta, Bidduyt Kanti; Gambari, Roberto

2002-07-01

In this study we compared the in vitro antiproliferative activity of extracts from medicinal plants toward human tumor cell lines, including human erythromyeloid K562, B-lymphoid Raji, T-lymphoid Jurkat, erythroleukemic HEL cell lines. Extracts from Emblica officinalis were the most active in inhibiting in vitro cell proliferation, after comparison to those from Terminalia arjuna, Aphanamixis polystachya, Oroxylum indicum, Cuscuta reflexa, Aegle marmelos, Saraca asoka, Rumex maritimus, Lagerstroemia speciosa, Red Sandalwood. Emblica officinalis extracts have been studied previously, due to their hepatoprotective, antioxidant, antifungal, antimicrobial and anti-inflammatory medicinal activities. Gas chromatography/mass spectrometry analyses allowed to identify pyrogallol as the common compound present both in unfractionated and n-butanol fraction of Emblica officinalis extracts. Antiproliferative effects of pyrogallol were therefore determined on human tumor cell lines thus identifying pyrogallol as an active component of Emblica officinalis extracts.

Inovação e Relações Universidade-Indústra em Países de Desenvolvimento Intermédio

Directory of Open Access Journals (Sweden)

Luísa Oliveira

2010-08-01

Full Text Available Portugal has an active population with low levels of education, a specialized manufacturing pattern based on traditional sectors and firms of small and very small size. These characteristics have a strong impact on the improvement of innovations and on the university-industry relations which have to be understood differently from the developed countries. This article intends to know what are the basic conditions for firms be innovative, in this very specific context, what type of innovations are they able to produce and what are the circumstances in which they can develop advantageous relations with the academic world. We conclude that the basic condition for these to happen is a certain accumulation of knowledge inside firms. An increasing in the accumulation of this knowledge goes hand in hand with the improvement of innovations and with the integration capacity of firms in the innovation space, notion which is proposed in alternative to the one of innovation system.

Análise comportamental por intermédio das tecnologias de Big Data

OpenAIRE

Daniel dos Santos Bernardo; Danilo Romualdo Borlone

2016-01-01

O mundo está cada vez mais interligado. Novas tecnologias vêm sendo criadas para conectar e diminuir a distância entre as pessoas. Com a ascensão das tecnologias há um crescimento exponencial na geração de dados variados, estruturados ou não. Analisar estes dados em busca de informações úteis para o negócio, visando ainda, a obtenção do comportamento de um grupo de indivíduos sobre uma questão em exame, é o que este artigo aborda. Isso a partir de demonstrações e descrições das tecnologias de...

Grammaire progressive du français niveau intermédiaire : avec 680 exercices

CERN Document Server

Grégoire, Maïa

2013-01-01

Une organisation claire : la leçon de grammaire sur la page de gauche ; les exercices d'entraînement sur la page de droite ; 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues ; Un apprentissage progressif : il suit la progression naturelle des méthodes de français ; Un usage souple : pour la classe ou en auto-apprentissage ; Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens ; Une large place faite à l'évaluation : de nombreux exercices de révision et des bilans réguliers. À découvrir dans cette troisième édition tout en couleurs : Un CD audio avec 14 documents sonores ; 80 nouveaux exercices et activités communicatives ; Des chapitres révisés et des exercices plus variés ; Un test d'évaluation avec ses corrigés ; Et... un livre web, 100% en ligne, inclus. Cet ouvrage contient un code d'activation donnant gratuitement accès sur http://livre-web.com...

Análise comportamental por intermédio das tecnologias de Big Data

Directory of Open Access Journals (Sweden)

Daniel dos Santos Bernardo

2016-02-01

Full Text Available O mundo está cada vez mais interligado. Novas tecnologias vêm sendo criadas para conectar e diminuir a distância entre as pessoas. Com a ascensão das tecnologias há um crescimento exponencial na geração de dados variados, estruturados ou não. Analisar estes dados em busca de informações úteis para o negócio, visando ainda, a obtenção do comportamento de um grupo de indivíduos sobre uma questão em exame, é o que este artigo aborda. Isso a partir de demonstrações e descrições das tecnologias de Big Data, explorando ainda, os conceitos fundamentais aplicados ao contexto atual e, ao final, apresenta de forma básica o emprego de algumas das principais técnicas da plataforma IBM® InfoSphere® BigInsights™, que engloba diversos recursos para o auxílio na busca por insights relevantes. Explorando as potencialidades do Big Data é possível obter em tempo hábil resultados de processamentos de diferentes tipos de dados, traçando perfis comportamentais e classificações de sentimentos sobre uma determinada marca, produto ou serviço, além de permitir a aproximação com o público alvo.

Évaluer la réussite d'une politique visant la réduction de la violence ...

International Development Research Centre (IDRC) Digital Library (Canada)

24 févr. 2015 ... Un article publié dans la revue Aggression and Violent Behavior traite de cette situation et propose des moyens de soutenir la mise en oeuvre de la politique par l'intermédiaire de la recherche. Apprenez-en plus sur la politique, ses réalisations et les défis qui se posent en lisant le résumé de l'article.

Renforcement de la capacité d'améliorer les systèmes de santé en ...

International Development Research Centre (IDRC) Digital Library (Canada)

En dépit de ses richesses naturelles considérables, le Nigeria présente de profondes disparités. C'est maintenant un pays à revenu intermédiaire; en 2010, pourtant, plus de 60 % de Nigérians vivaient avec moins de un dollar par jour. Sa population compte parmi les plus désavantagées de la planète en ce qui concerne ...

La portee des projets urbains recents pour la grande ville ...

African Journals Online (AJOL)

... mobi-lisé, le potentiel de lisibilité qu'elle recèle pourrait la consolider dans le statut de ville intermédiaire aux échelles nationale et méditerra-néenne. Un statut qu'elle pourrait acquérir à partir d'une triangulation d'actions stratégiques pour consolider la connectivité, créer une syner-gie entre PME/PMI et tourisme, donner ...

Tableaux et modèles: «vive la sintayse»

Directory of Open Access Journals (Sweden)

Christian GERMANAZ

1994-09-01

Full Text Available L’image géographique et la peinture présentent beaucoup de similitudes. Il est possible d’analyser l’image picturale sous l’angle de la modélisation. Par l’intermédiaire de la chorématique une équivalence dans le langage plastique et pictural a été trouvée Le Christ jaune de Gauguin permet de tester cette transposition.

Résultats de recherche | Page 176 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

Dans le cadre de ce projet, les chercheurs étudieront l'impact de l'investissement étranger direct (IED) sur l'efficience économique, la pauvreté et les inégalités dans les pays à faible revenu et à revenu intermédiaire. Projet. Les liens entre les changements dans l'utilisation des terres et la santé humaine dans l'est de l' ...

Cotation de fabrication avec les normes ISO

CERN Document Server

Anselmetti, Bernard

2010-01-01

La cotation ISO en production impose de nouvelles méthodologies pour élaborer les documents de maîtrise de la qualité géométrique des produits : les dessins de phase, du brut et d'états intermédiaires pour la conformité des pièces et les fiches de production, de réglage, de contrôle et de surveillance pour la conformité des moyens de production. Une méthode de transfert unidirectionnelle simple permet d'établir des dessins de phase en normes ISO et d'optimiser la répartition des tolérances à isocapabilité. Cette cotation est déclinée en cotation d'état intermédiaire, de production et de réglage. Une méthode tridimensionnelle est proposée pour prendre en compte les effets des défauts angulaires. Une maquette montre les fonctionnalités envisageables pour les futurs outils d'aides au tolérancement de fabrication au sein de la CFAO. De nombreux exercices illustrent les différentes démarches. Ce Manuel de tolérancement est principalement destiné aux préparateurs méthodes et aux c...

Financial Development in 205 Economies, 1960 to 2010

OpenAIRE

Martin Čihák; Asli Demirgüč-Kunt; Erik Feyen; Ross Levine

2013-01-01

This paper describes our construction of the Global Financial Development Database and uses the data to compare financial systems around the world. The database provides information on financial systems in 205 economies over the period from 1960 to 2010 and includes measures of (1) size of financial institutions and markets (financial depth), (2) degree to which individuals and firms can and do use financial services (access), (3) efficiency of financial intermediaries and markets in intermed...

Extériorisation sonore avec des indices auditifs et visuels discordants

DEFF Research Database (Denmark)

Santurette, Sébastien; Carvajal, Juan Camilo Gil; Cubick, Jens

2016-01-01

Dans les environnements d’écoute naturels, les sons sont généralement perçus en dehors de la tête (extériorisés). En revanche, les sons présentés par l’intermédiaire d’un casque sont souvent perçus à l’intérieur de la tête (intériorisés). Les techniques de reproduction d’espaces sonores virtuels...

Intervention intégrée quant au risque de diabète après le diabète ...

International Development Research Centre (IDRC) Digital Library (Canada)

Les femmes ayant souffert de diabète sucré de la grossesse, un diabète temporaire qui apparaît pendant la grossesse, présentent un risque élevé de développer le diabète de type 2 après leur grossesse. Cette étude de recherche abordera le problème en Afrique du Sud par l'intermédiaire d'une intervention novatrice au ...

3rd International Multidisciplinary Microscopy and Microanalysis Congress

CERN Document Server

Oral, Zehra

2017-01-01

The 3rd International Multidisciplinary Microscopy Congress (InterM2015), held from 19 to 23 October 2015, focused on the latest developments concerning applications of microscopy in the biological, physical and chemical sciences at all dimensional scales, advances in instrumentation, techniques in and educational materials on microscopy. These proceedings gather 17 peer-reviewed technical papers submitted by leading academic and research institutions from nine countries and representing some of the most cutting-edge research available.

Subventions de renforcement des capacités en vue d'essais en ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'intervention du Canada à l'égard de l'épidémie de VIH/sida à l'échelle internationale s'inscrit surtout dans le cadre de l'Initiative canadienne de vaccin contre le VIH (ICVV). L'ICVV se propose d'accroître les capacités du Canada, des pays à faible revenu et des pays à revenu intermédiaire de contrer cette épidémie, ...

Connections, curvature and cohomology

CERN Document Server

Greub, Werner H; Vanstone, Ray

1976-01-01

Imidazole and Benzimidazole Synthesis is a comprehensive survey of the known methods of syntheses and ring modification. It brings together the multitude of synthesis of the imidazole ring in a systemic way interms of specific bond formation, and recommends the most attractive synthetic approaches. It also collects non-ring-synthetic approaches to classes of compounds such as nitro-, halogeno-, and amino-imidazoles, and covers the synthesis of N-substituted compounds and preparations of specific isomers.

Možnosti využití cloudových technologií v oblasti sdílené ekonomiky a FinTech

OpenAIRE

Chmelař, Ondřej

2016-01-01

This thesis is mapping in a detail and describes the current situation and prediction of the penetration of information technology based mostly on the cloud and blockchain technologies into the real global economy and identifying trends that affect these areas. Focus is primarily on socialization of services, concept of sharing economy and financial-technology (FinTech) companies. Next part describes the process of maturing of information technologies, which enables bypassing of costly interm...

Analisis Pemeliharaan Peralatan dan Pengawasan Pengolahan Air Minum Isi Ulang Terhadap Kualitas Bakteriologis (Escherichia coli) di Kec. Galang Kab. Deli serdang Tahun 2015

OpenAIRE

Tarigan, Yuni Marsela

2017-01-01

Each year population growth has increased. There is a public behavior changes interms of consume boiling water to be consumeing refill drinking water. That conditional will employer. To analyze control asessment of the bacteriologis quality (Escherichia coli) The purpose of this research is to analyze maintenance of equipment and the supervision drinking water treatmeant and quality the bacteriological (Escherichia coli) in Deli Serdang Galang 2015. The type of study us descriptive which t...

Application of the Kombucha 'tea fungus' for the enhancement of antioxidant and starch hydrolase inhibitory properties of ten herbal teas.

Science.gov (United States)

Watawana, Mindani I; Jayawardena, Nilakshi; Choo, Candy; Waisundara, Viduranga Y

2016-03-01

Ten herbal teas (Acacia arabica, Aegle marmelos flower, A. marmelos root bark, Aerva lanata, Asteracantha longifolia, Cassia auriculata, Hemidesmus indicus, Hordeum vulgare, Phyllanthus emblica, Tinospora cordifolia) were fermented with the Kombucha 'tea fungus'. The pH values of the fermented beverages ranged from 4.0 to 6.0 by day 7, while the titratable acidity ranged from 2.5 to 5.0g/mL (PKombucha beverages to have statistically significant increases (P<0.05) by day 7. The α-amylase inhibitory activities ranged from 52.5 to 67.2μg/mL in terms of IC50 values following fermentation, while the α-glucosidase inhibitory activities ranged from 95.2 to 196.1μg/mL. In conclusion, an enhancement of the antioxidant and starch hydrolase inhibitory potential of the herbal teas was observed by adding the tea fungus. Copyright © 2015 Elsevier Ltd. All rights reserved.

High resolution studies of the effects of magnetic fields on chemical reactions

OpenAIRE

Hamilton, C. A.; Hewitt, J. P.; McLauchlan, Keith A.; Steiner, Ulrich

1988-01-01

A simple and inexpensive experiment is described which detects magnetic field effects on chemical reactions with high signal-to-noise ratio and high resolution. It consists in applying a small modulation field to the sample, whilst the main field it experiences is varied, with optical detection at the modulation frequency. It consequently measures the derivative of the normal MARY spectrum. It is shown by theoretical analysis that when using this method it is better to monitor reaction interm...

An Evaluation of the Intermediation Role of Hong Kong in Chinese Foreign Trade

OpenAIRE

Xinhua He

2007-01-01

Two different data sources can be used to study Hong Kong's role in intermediating China's foreign trade. One is the bilateral trade statistics between Hong Kong and the Chinese Mainland reported by National Bureau of Statistics of China, and the other is the bilateral trade statistics published by Census and Statistics Department, Hong Kong. The corresponding statistics are not comparable to each other because of the different statistical criteria adopted by each source. Hong Kong's intermed...

Microstructural Characterization of HSLA-100 GMA-Weldments

Science.gov (United States)

1987-09-01

Intermeiate Oxygen Regime ----------- 66 D.) Schematic CCT Diagram - --------------- 66 9 ACKNOWLEDGEMENTS I wish to express my appreciation to my thesis...have been observed in this research [review Figures 31 (a), (b) and 35 (a)]. Figure 38 (d) shows a schematic CCT diagram reported by Glover (Ref. 5) and...Regime B.) High Ox. gen Regime C. )Interme late Oxygen Regime D.1 Schematic CCT Diagram 66 LIST OF REFERENCES 1. Anderson, T.L., Hyatt J A West, J.C

Systèmes de santé équitables : à qui revient la facture ? | IDRC ...

International Development Research Centre (IDRC) Digital Library (Canada)

24 oct. 2012 ... Les pays à faible revenu, de leur côté, s'efforcent d'offrir à leurs citoyens ce qui est déjà monnaie courante ailleurs : un accès à des services de santé ... à revenu intermédiaire s'appuient sur des sources variées : régimes d'assurance publics et privés, impôts et taxes directs et indirects, frais imposés aux ...

MX Siting Investigation Geotechnical Evaluation. Volume IB. Nevada-Utah Verification Studies, FY 79.

Science.gov (United States)

1979-08-24

Range. The southern tip of the range is composed of flows and intrusive masses of interme- diate to acidic composition (Cornwall, 1972). The east...suitable ’.7-10.0 18 O _(o. 2-3. [) 𔃼.2 NA [we 0] ,o,. 3: * [1 - Number of tests performed "CHARACTERISTICS OF SURFICIALAI SOIL: N HDA - No data available...commonly identified on the basis of reaction with dilute hydrochloric acid . CALICHE - Gravel, sand, or other material cemented principally by calcium

Role of Rural Nonfarm Employment in Philippine Development

OpenAIRE

Reyes, Edna A.

1991-01-01

This study analyzes the nature and role of rural nonfarm employment in development. It also traces the growth of nonfarm activities in the Philippines and determines the extent of their contribution to the transformation of the rural sector. In particular, it describes the structure of nonfarm activities in the rural sector and how this structure changes overtime. It also assesses the impact of nonfarm employment on the rural economy interms of changes in the structure of labor utilization, p...

A Model to Explain the Emergence of Reward Expectancy neurons using Reinforcement Learning and Neural Network

OpenAIRE

Shinya, Ishii; Munetaka, Shidara; Katsunari, Shibata

2006-01-01

In an experiment of multi-trial task to obtain a reward, reward expectancy neurons,###which responded only in the non-reward trials that are necessary to advance###toward the reward, have been observed in the anterior cingulate cortex of monkeys.###In this paper, to explain the emergence of the reward expectancy neuron in###terms of reinforcement learning theory, a model that consists of a recurrent neural###network trained based on reinforcement learning is proposed. The analysis of the###hi...

Stratégies Narratives de la Communication par l’Intermédiaire du Fantastique

Directory of Open Access Journals (Sweden)

Mirela Gheorghe

2010-07-01

Full Text Available The fantastic crisis affects the story forms and the expressive resources of language, thatbecome themselves subjects of the fantastic, questioning the boundaries between fiction and reality.Beyond a simple thematic inventory, the reflexive dimension (metafiction becomes consubstantial tothe fantastic, designating the textual strategies meant to convey the crisis of reality postulated bythemimesis. Readers, authors and characters are foundwithin a text type which, although proclaims itselfas fictional, it "erodes" the identities, worlds and discourses. Thus, the fantastic story exhibits thenarrative processes and the elements of intertextuality, permanently placing between the brackets theborder between the world in which the story is toldand the one about which the story is told.

New coumarin derivatives: design, synthesis and use as inhibitors of hMAO.

Science.gov (United States)

He, Xu; Chen, Yan-Yan; Shi, Jing-Bo; Tang, Wen-Jiang; Pan, Zhi-Xiang; Dong, Zhi-Qiang; Song, Bao-An; Li, Jun; Liu, Xin-Hua

2014-07-15

A series new 2H-chromene-3-carboxamides (4a-4i) and S-2H-chromene-3-carbothioates (5j-5t) were synthesized and evaluated as monoamine oxidase A and B inhibitors. Among them, compound 5k (IC50=0.21μM, IC50 iproniazid=7.65μM) showed the most activity and higher MAO-B selectivity (189.2-fold vs 1-fold) with respect to the MAO-A isoform. The need to clarify at a 3D level some important molecular aspects of discussed SAR, we undertaked a number of docking simulations to better assess. The steric effect was analyzed interms of both posing and scoring by investigating the nature of the binding interactions. The docking results of active compound 5k with hMAO-B complex indicated that conserved residue ILE 199 was important for ligand binding via Sigma-Pi interaction. Copyright © 2014 Elsevier Ltd. All rights reserved.

Genetic divergence among Psidium accessions based on biochemical and agronomic variables

Directory of Open Access Journals (Sweden)

Carlos Antonio Fernandes Santos

2011-01-01

Full Text Available Sixty-nine Psidium accessions collected in six Brazilian states were analyzed by two non-hierarchical clusteringmethods and principal components (PC, to provide orientation for breeding programs. The variables ascorbic acid, b-carotene,lycopene, total phenols, total flavonoids, antioxidant activity, titrable acidity, soluble solids, total soluble sugars, moisture content,lateral and transversal fruit diameter, fruit pulp and seed weighs, and plant fruit number and weight were analyzed. Specific groups were observed for the araçazeiros accessions, by the Tocher and the k-means methods, as well as by the three-dimensionaldispersion of the four PCs. The clustering separated accessions of araçazeiros from the guava. There was no specific grouping interms of States of origin, indicating the absence of barriers in the guava propagation accessions. Analyses suggested the collectionof a greater number of guava germplasm samples from a smaller number of regions and divergent accessions with high nutritionalcompound levels to develop new cultivars.

Proton Conducting Fuel Cells where Electrochemistry Meets Material Science

DEFF Research Database (Denmark)

Li, Qingfeng

Fuel cells are electrochemical devices which directly convert the chemical energy of fuels into electrical energy. They are featured of high energy conversion efficiency and minimized pollutant emission. Proton conducting electrolytes are primarily used as separator materials for low and intermed...... science point of view including novel proton conducting materials and non-precious metal catalysts. The discussion will be made with highlights of DTU´s recent research and of course addressing a diverse technical audience.......Fuel cells are electrochemical devices which directly convert the chemical energy of fuels into electrical energy. They are featured of high energy conversion efficiency and minimized pollutant emission. Proton conducting electrolytes are primarily used as separator materials for low...... followed by a review of the state-of-the-art in terms of performance, lifetime and cost. Technically faced challenges are then outlined on a system level and traced back to fundamental issues of the proton conducting mechanisms and materials. Perspectives and future research are sketched from a materials...

Survey on food consumption

International Nuclear Information System (INIS)

Ohmomo, Yoichiro

1979-01-01

Critical pathway approach is one of the methods for estimating discharge limits of radioactive nuclides into an environment. In connection with this it is presented that a term of 'critical group' is in danger of leading to the misunderstanding of 'dangerous group'. However, in fact, the present discharge is limited to a level as low as practicable. Therefore, on the evaluation of intermal radiation dose for such a low release, a term of 'reference group' should be recommended instead of critical group. In order to select reasonably 'the reference group', it was proposed to calculate 'effective whole body dose-equivalent limit', which was recommended by ICRP publication 26. It is a convenient method to sum up individual weighed dose of each critical organ by using the value of a ratio obtained from Wt as a weighing factor. Finally instructions for the survey on food consumption and the results were summarized on the basis of ten-years survey experiences in coastal area of Ibaraki prefecture. (author)

Os fugitivos e os mastins: em torno dos homens brutos de Cairu

Directory of Open Access Journals (Sweden)

Pedro Meira Monteiro

2006-04-01

Full Text Available PARTINDO da obra de José da Silva Lisboa, o visconde de Cairu, o artigo trata do lugar imaginário em que se situa o Outro da civilização. Pretende-se, por intermédio dele, inquirir e explorar a distância que separa o civilizado do bárbaro. No espaço intermédio entre a barbárie e a civilização, afinal, a literatura social desenha o território fronteiriço em que o discurso civilizado reaviva os fantasmas da regressão, trabalhando poeticamente o horror do retorno à selva. Trata-se de uma longa tradição literária que, no Brasil, tem em Euclides da Cunha o seu mestre.BASED ON the work of José da Silva Lisboa, the Viscount of Cairu, this article discusses the imaginary place of the Other in civilization. The objective of the article is to inquire into and explore the distance that separates civilized people from barbarians. In the intermediate space between civilization and barbarity, social literature plots out the frontier where civilized discourse revives fantasies of regression and poetically evokes the horror of a return to the jungle. This is a long literary tradition which, in Brazil, has Euclides da Cunha as its master.

Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3{NIT(C6H4OPh)}]: A μ+ spin relaxation study

Science.gov (United States)

Arosio, Paolo; Corti, Maurizio; Mariani, Manuel; Orsini, Francesco; Bogani, Lapo; Caneschi, Andrea; Lago, Jorge; Lascialfari, Alessandro

2015-05-01

The spin dynamics of the molecular magnetic chain [Dy(hfac)3{NIT(C6H4OPh)}] were investigated by means of the Muon Spin Relaxation (μ+SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac)3{NIT(C6H4OPh)}] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ+SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λinterm(T), associated with the intermediate relaxing component. The experimental λinterm(T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ0 exp(Δ/kBT), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state.

Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3(NIT(C6H4OPh))]: A μ+ spin relaxation study

International Nuclear Information System (INIS)

Arosio, Paolo; Orsini, Francesco; Corti, Maurizio; Mariani, Manuel; Bogani, Lapo; Caneschi, Andrea; Lago, Jorge; Lascialfari, Alessandro

2015-01-01

The spin dynamics of the molecular magnetic chain [Dy(hfac) 3 (NIT(C 6 H 4 OPh))] were investigated by means of the Muon Spin Relaxation (μ + SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac) 3 (NIT(C 6 H 4 OPh))] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ + SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λ interm (T), associated with the intermediate relaxing component. The experimental λ interm (T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ 0 exp(Δ/k B T), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state

Gêneros textuais, tipos de discursos e operações psicolingüísticas

Directory of Open Access Journals (Sweden)

Jean- Paul Bronckart

2012-11-01

Full Text Available L’article de Jean-Paul Bronckart est centré sur le problèmecontroversé du classement des textes en le situant dans le cadre dela psychologie du langage et dans le cadre théorique del’interactionisme social. La multiplicité et l’hétérogénéité des critèresde classement et de nomenclature ont abouti à des classementshomogènes, intermédiaires et hétérogènes. L’auteur part deconsidérations intermédiaires sur la notion de genre et sur lesproblèmes de classement et présente, sous une forme résumée,quatre thèses lapidaires des fondements du cadre de la psychologieinteractioniste sociale. Un modèle de production textuelle estsuggéré à partir du statut psychologique des textes empiriques etdes opérations psycholinguistiques qui y sont sous-jacents. Unetypologie centrée sur quatre entités basiques relève de ce modèle,nommé “archétypes discursifs”: discours interactif, discoursthéorique, récit et narration. L’auteur tient à montrer que lacompréhension du fonctionnement des textes est essentielle, visà-vis d’une lecture qui envisage une approche pédagogique.

Anti-HIV-1 activities of the extracts from the medicinal plant Linum grandiflorum Desf

DEFF Research Database (Denmark)

Mohammed, Magdy M. D.; Christensen, Lars Porskjær; Ibrahim, Nabaweya A.

2009-01-01

As part of our screening of anti-AIDS agents from natural sources e.g. Ixora undulata, Paulownia tomentosa, Fortunella margarita, Aegle marmelos and Erythrina abyssinica, the different organic and aqueous extracts of Linum grandiflorum leaves and seeds were evaluated in vitro by the microculture...... tetrazolium (MTT) assay. The activity of the tested extracts against multiplication of HIV-1 wild type IIIB, N119, A17, and EFVR in acutely infected cells was based on inhibition of virus-induced cytopathicity in MT-4 cells. Results revealed that both the MeOH and the CHCl3 extracts of L. grandiflorum have...... significant inhibitory effects against HIV-1 induced infection with MT-4 cells. The MeOH extract of the leaves is more potent than other extracts against MT-4 cell cultures infected with the wild type HIV-1, strain IIIB with an ED50 of 46 ± 6 µM, while the CHCl3 extract of the seeds is more potent than other...

Isolation and identification of antibacterial compound from the leaves of Cassia auriculata.

Science.gov (United States)

Senthilkumar, P K; Reetha, D

2011-09-01

Antimicrobial properties of medicinal plants and plant parts such as flowers, roots, fruits, seeds and oils are being used to cure some chronic and acute diseases throughout the world. In the present study, an attempt has been made to isolate and identify the antibacterial compound present in the leaves of the Cassia auriculata. A preliminary screening of antibacterial activity was carried out with fine different plant extracts viz., Aegle marmelos, Chloris Virgata, Clausena anisata, Feronia limonia and Cassia auriculata against different human pathogenic bacteriae such as Escherichia coil, Salmonella typhi, Proteus mirabilis and Klebsiella pneumoniae at different concentrations. Based on the results, the plant Cassia auriculata was selected as the efficient plant, which shows antibacterial activity against the tested organisms. Further compound responsible for its antibacterial activity was isolated and identified by IR spectrum, 1HNMR, 13CNMR and Mass spectrum studies, as oleanolic acid, which has the molecular formula of C30H48O3.

The Influence of Fundamental Factors on Stock Return (Case Study: Company Listed in Lq45 2011-2014)

OpenAIRE

Rumokoy, Farlane; Tamunu, Sonnia Cindy

2015-01-01

Consumption and investment are the two things are related because, delay consumption at a time could be interpreted as an investment that is used for future consumption. The investment is an investment for one or more assets owned and usually in a long period of time with the hope of obtaining a profit in the future. Investments can be classified into direct investment and indirect investment. Direct investment made by purchasing directly from a companys financial assets either through interm...

Brokers and Competitive Advantage

OpenAIRE

Michael D. Ryall; Olav Sorenson

2007-01-01

The broker profits by intermediating between two (or more) parties. Using a biform game, we examine whether such a position can confer a competitive advantage, as well as whether any such advantage could persist if actors formed relations strategically. Our analysis reveals that, if one considers exogenous the relations between actors, brokers can enjoy an advantage but only if (1) they do not face substitutes either for the connections they offer or the value they can create, (2) they interm...

Aufschaeumbarer Metallkoerper, Verfahren zu seiner Herstellung und seine Verwendung

OpenAIRE

Baumeister, J.; Veltl, G.; Zimmer, N.

2003-01-01

WO2003069002 A UPAB: 20030910 NOVELTY - Production of an expandable metal body comprises compacting a mixture containing at least one metal and at least one gas-splitting expanding agent to form a semi-finished product, in which the particles of the metal are tightly bound to one another and form a gas-tight seal for gas particles released from the gas expanding agent. DETAILED DESCRIPTION - A mixture of powdered or liquid metal and powdered or liquid metal-containing expanding agent intermed...

A DNA-based nanomechanical device with three robust states

OpenAIRE

Chakraborty, Banani; Sha, Ruojie; Seeman, Nadrian C.

2008-01-01

DNA has been used to build a variety of devices, ranging from those that are controlled by DNA structural transitions to those that are controlled by the addition of specific DNA strands. These sequence-dependent devices fulfill the promise of DNA in nanotechnology because a variety of devices in the same physical environment can be controlled individually. Many such devices have been reported, but most of them contain one or two structurally robust end states, in addition to a floppy interme...

New Forms of Mobility and Social Practices: The Starbucks Cafés in Beijing

OpenAIRE

Pons, Blandine; Xiaoting, Jin; Puel, Gilles

2007-01-01

Translated by Michael Black Version intermédiaire; International audience; The multinational coffee shop chain Starbucks has proved to be a pioneer in the United States, with the deployment of Wi-Fi access. Declaring itself to be an ethical company, it provides a non-smoking environment and non-alcoholic beverages and charges a fee for secure internet access, in the fashionable areas of big cities. Having first placed the company's economic model in the global context of new forms of mobility...

Fidelity and Game-based Technology in Management Education

Directory of Open Access Journals (Sweden)

Edgard B. Cornacchione Jr.

2012-04-01

Full Text Available This study explores educational technology and management education by analyzing fidelity in game-basedmanagement education interventions. A sample of 31 MBA students was selected to help answer the researchquestion: To what extent do MBA students tend to recognize specific game-based academic experiences, interms of fidelity, as relevant to their managerial performance? Two distinct game-based interventions (BG1 andBG2 with key differences in fidelity levels were explored: BG1 presented higher physical and functional fidelitylevels and lower psychological fidelity levels. Hypotheses were tested with data from the participants, collectedshortly after their experiences, related to the overall perceived quality of game-based interventions. The findingsreveal a higher overall perception of quality towards BG1: (a better for testing strategies, (b offering betterbusiness and market models, (c based on a pace that better stimulates learning, and (d presenting a fidelity levelthat better supports real world performance. This study fosters the conclusion that MBA students tend torecognize, to a large extent, that specific game-based academic experiences are relevant and meaningful to theirmanagerial development, mostly with heightened fidelity levels of adopted artifacts. Agents must be ready andmotivated to explore the new, to try and err, and to learn collaboratively in order to perform.

A propos livre de l'élève : B1-B2

CERN Document Server

Andant, Christine

2005-01-01

Les enseignants de Français langue étrangère disposeront grâce aux dossiers thématiques d'" A propos " d'un abondant matériel pédagogique, souple, diversifié et stimulant pour la préparation et l'animation de leurs cours au niveau intermédiaire. Ils y trouveront de surcroît de très nombreuses exploiter les documents sélectionnés ainsi que des suggestions pour construire des séquences pédagogiques

Power System Extreme Event Detection: The VulnerabilityFrontier

Energy Technology Data Exchange (ETDEWEB)

Lesieutre, Bernard C.; Pinar, Ali; Roy, Sandip

2007-10-17

In this work we apply graph theoretic tools to provide aclose bound on a frontier relating the number of line outages in a gridto the power disrupted by the outages. This frontier describes theboundary of a space relating the possible severity of a disturbance interms of power disruption, from zero to some maximum on the boundary, tothe number line outages involved in the event. We present the usefulnessof this analysis with a complete analysis of a 30 bus system, and presentresults for larger systems.

Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3(NIT(C6H4OPh))]: A μ{sup +} spin relaxation study

Energy Technology Data Exchange (ETDEWEB)

Arosio, Paolo, E-mail: paolo.arosio@guest.unimi.it; Orsini, Francesco [Department of Physics, Università degli Studi di Milano, and INSTM, Milano (Italy); Corti, Maurizio [Department of Physics, Università degli Studi di Pavia and INSTM, Pavia (Italy); Mariani, Manuel [Department of Physics and Astronomy, Università degli Studi di Bologna, Bologna (Italy); Bogani, Lapo [Physikalisches Institut, Universität Stuttgart, Stuttgart (Germany); Caneschi, Andrea [INSTM and Department of Chemistry, University of Florence, Firenze (Italy); Lago, Jorge [Departamento de Quimica Inorganica, Universidad del Pais Vasco, Bilbao (Spain); Lascialfari, Alessandro [Department of Physics, Università degli Studi di Milano, and INSTM, Milano (Italy); Centro S3, Istituto Nanoscienze - CNR, Modena (Italy)

2015-05-07

The spin dynamics of the molecular magnetic chain [Dy(hfac){sub 3}(NIT(C{sub 6}H{sub 4}OPh))] were investigated by means of the Muon Spin Relaxation (μ{sup +}SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac){sub 3}(NIT(C{sub 6}H{sub 4}OPh))] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ{sup +}SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λ{sub interm}(T), associated with the intermediate relaxing component. The experimental λ{sub interm}(T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ{sub 0} exp(Δ/k{sub B}T), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state.

Grammaire le nouvel entraînez-vous avec 450 nouveaux exercices : niveau intermédiaire

CERN Document Server

Sirejols, Evelyne

1996-01-01

Des activités d'apprentissage et de réemploi pour s'exercer, tester ses connaissances et ainsi progresser en français. • Chaque point de grammaire est introduit par un proverbe ou une citation. • Chaque exercice est accompagné d'un exemple.

Analyste intermédiaire de systèmes de gestion de l'information (h/f ...

International Development Research Centre (IDRC) Digital Library (Canada)

entreprendre des études, cerner et analyser les exigences en GI en consultation avec les clients et en réponse aux besoins de leurs utilisateurs;; élaborer et conserver des structures, définitions et normes d'information logique (par exemple, architecture de l'information et cadre des métadonnées);; définir des types de ...

Avaliação da corrosão em dutos rígidos submarinos em operação : comparação entre as técnicas de monitoramento da corrosão interna e inspeção com PIGS instrumentados

OpenAIRE

Pedro Nogueira Addor

2009-01-01

Grande parte do volume de hidrocarbonetos produzidos em ambiente offshore na atualidade é transportado por intermédio de dutos rígidos submarinos. O gerenciamento da integridade destes dutos abrange várias disciplinas, tais como: Resistência dos Materiais, Química, Geologia, Oceanografia, entre outras. A integração destas áreas de estudo é necessária ao conhecimento dos mecanismos de degradação de dutos, a fim de determinar as causas e os tipos possíveis de falhas. A metodologia empregada atu...

Dicty_cDB: Contig-U15060-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 000227 |pid:none) Bacillus cereus Q1, complete ge... 114 3e-23 B83991( B83991 ) glycolate oxidase subunit BH2730 [imported...ana interm... 56 2e-15 5 ( AF211126 ) Carsonella ruddii natural-host Bactericera cocker....psnkfvpqrlfqq*fvf tiqrkln*vllgnqvkvl*vnsqvqwlksifitfvplisrmfvslslvskvqrrl*isie lqfsissprmlplv*vlllvklgpkkdmi... la... 1074 0.0 1 ( AB000109 ) Dictyostelium discoideum mitochondrial DNA, compl... 1074 0.0 1 ( BJ412759 ) Dictyosteli...7, 3' ... 731 0.0 1 ( DQ336395 ) Dictyostelium citrinum mitochondrion, complete ge... 456 0.0 3 ( BJ387435 ) Dictyosteli

Dicty_cDB: Contig-U02523-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lorococcus marinus str. NATL2A, complete gen... 48 0.82 1 ( AF211148 ) Carsonella ruddii natural-host Russelliana interm...:none) Leishmania major strain Friedlin... 75 4e-12 CP000384_4494( CP000384 |pid:none) Mycobacterium sp. MCS, compl...elaginella moellendorffii mixe... 34 0.16 2 ( GD178393 ) EST04602 Watermelon fruit normalization and subtr...... 50 0.21 1 ( EJ643566 ) 1093012125502 Global-Ocean-Sampling_GS-29-01-01-1... 34 ...e, co... 48 0.82 1 ( EK325308 ) 1095467004903 Global-Ocean-Sampling_GS-31-01-01-1

Dinâmica motivacional entre alunos e professores de biologia que também lecionam outra disciplina : uma análise à luz da teoria de auto-eficácia de Bandura

OpenAIRE

Mota, Bárbara Janaína Brandão

2017-01-01

Trata-se de um relato de pesquisa que traçou um perfil da dinâmica motivacional entre alunos e professores de biologia que também lecionam outra disciplina, à luz da teoria de auto-eficácia de Albert Bandura. A pesquisa teve abordagem qualitativa. Os dados foram coletados de alunos e professores de escola pública do interior brasileiro, por intermédio de entrevista semi-estruturada. As análises foram baseadas em quatro categorias extraídas da teoria de Bandura: experiências individuais de êxi...

Dinâmica motivacional entre alunos e professores de biologia que também lecionam outra disciplina: uma análise à luz da teoria de auto-eficácia de Bandura

OpenAIRE

Mota, Bárbara Janaína Brandão; Razera, Julio César Castilho

2017-01-01

Trata-se de um relato de pesquisa que traçou um perfil da dinâmica motivacional entre alunos e professores de biologia que também lecionam outra disciplina, à luz da teoria de auto-eficácia de Albert Bandura. A pesquisa teve abordagem qualitativa. Os dados foram coletados de alunos e professores de escola pública do interior brasileiro, por intermédio de entrevista semi-estruturada. As análises foram baseadas em quatro categorias extraídas da teoria de Bandura: experiências individuais de êxi...

Cinema em cartazes: um passeio pelo percurso da escrita verbovisual

Directory of Open Access Journals (Sweden)

Denise Azevedo Duarte Guimarães

2011-01-01

Full Text Available Este artigo tem cartazes de cinema como objeto de estudo e pretende demonstrar como eles dão continuidade, hoje, a um projeto em busca da visualidade, proveniente do barroco e que conquista espaço e forma na contemporaneidade. A linguagem do cartaz, como produto comunicativo híbrido, é analisada por intermédio de um estudo comparativo sobre a evolução da poesia visual no ocidente. Uma leitura intersemiótica tenta investigar processos criativos que integram signos verbais e interfaces icônicas no texto impresso.

Bis{N-[5-(4-methoxy?phen?yl)-1,3,4-oxa?diazol-2-yl]ethanimidamidato}copper(II)

OpenAIRE

Djebli, Yacine; Mosbah, Salima; Boufas, Sihem; Bencharif, Leila; Roisnel, Thierry

2010-01-01

The title compound, [Cu(C11H11N4O2)2], was prepared by solvothermal synthesis using 2-amino-5-(4-methoxyphenyl)-1,3,4-oxadiazole and copper sulfate pentahydrate in an acetonitrile solution. The CuII atom lies on an inversion center and is four-coordinated in a slightly distorted square-planar geometry by four N atoms of the ligands obtained from the formation of a bond between the amine N atom of the oxadiazole molecule and the nitrile C atom of the solvent. In the crystal structure an interm...

Le commerce du Nord

OpenAIRE

Pourchasse, Pierrick; Bouëdec, Gérard Le

2015-01-01

Au XVIIIe siècle, la France s'approvisionne abondamment dans les pays du Nord : bois, chanvre et goudron de la Baltique, tonnellerie de Poméranie, pêche de rogue de Norvège, graines de lin de Courlande, barres de fer suédois… Sa balance commerciale est pourtant positive grâce aux sels, aux vins et surtout des nouvelles marchandises coloniales. Or, la plupart des transactions passent par l’incontournable intermédiaire hollandais. Les explications sur l’absence des Français dans le Nord sont re...

Mecanismos de mudança em ação em situações desafiantes do quotidiano : uma investigação qualitativa consensual com pacientes em psicoterapia, pela sua voz

OpenAIRE

Oliveira, Ana Beatriz Pereira Santos de

2015-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde, Núcleo de Psicoterapia Cognitiva-Comportamental e Integrativa), Universidade de Lisboa, Faculdade de Psicologia, 2015 Em psicoterapia, há muita investigação sobre resultados finais e sobre processos de mudança que ocorrem dentro da sessão e que podem contribuir para os resultados de sessão e para os resultados finais. Contudo há ainda pouca investigação sobre resultados intermédios ou mecanismos de mudança. O objetiv...

Un outil de prise de données sur une image numérisée et son utilité dans les études relatives aux poissons : exemple d'une application concrète en morphométrie

Directory of Open Access Journals (Sweden)

SAGNES P.

1995-04-01

Full Text Available Une configuration informatique polyvalente en analyse d'images est présentée. L'accent est mis sur une application morphométrique par l'intermédiaire d'un exemple concret chez les poissons, d'où ressortent les principales qualités du dispositif, soit la précision et la rapidité de collecte et de stockage des données. Des applications possibles de cet outil à des domaines d'étude précis sont également suggérées.

DEGRADATION PHOTOCATALYTIQUE DE L’ISOPROTURON EN SUSPENSIONS AQUEUSES DU BIOXYDE DE TITANE IRRADIEE PAR UV: CINETIQUE DE DEGRADATION, PRODUITS INTERMEDIAIRES ET MECANISME REACTIONNEL

Directory of Open Access Journals (Sweden)

S AZIZI

2008-06-01

sur la dégradation de IP a été également étudié. Les produits intermédiaires ont été identifiés par chromatographie liquide couplée à la spectrométrie de masse (LC-MS. Les produits principaux par ordre d'importance étaient les produits ortho- et méta hydroxylé et composés d'oxydation sur la chaînes urée qui mène au produit de la déméthylation

Proteínas da soja processadas de diferentes modos em dietas para desmame de leitões

OpenAIRE

Bertol,Teresinha Marisa; Mores,Nelson; Ludke,Jorge Vítor; Franke,Márcia Regina

2001-01-01

Foi realizado um experimento para avaliar a substituição parcial do farelo de soja (FS) por outros subprodutos da soja obtidos por intermédio de diferentes tipos de processamento, bem como comparar estes subprodutos entre si, como fonte protéica na dieta de leitões desmamados aos 21 dias de idade. Com este objetivo foram comparados quatro tratamentos: T1 - dieta controle, com FS como única fonte protéica; T2, T3 e T4 -- 50% do FS da dieta controle foi substituído por soja integral extrusada (...

Level 1 - level 2 interface

International Nuclear Information System (INIS)

Boneham, P.

2003-01-01

The Plant Damage States (PDS) are the starting point for the level 2 analysis. A PDS is group of core damage sequences that are expected to have similar severe accident progressions. In this paper an overview of Level 1/Level 2 interface, example PDS parameters, example PDS definitions using codes and example Bridge Tree are presented. PDS frequency calculation (identification of sequences for each PDS in level 1,split some CD sequences which have different level 2 progressions), code calculations providing support for grouping decisions and timings as well as PDS frequencies and definitions input to level 2 are also discussed

Des concepts aux indicateurs du développement durable: multidimensionnalité et responsabilisation

Directory of Open Access Journals (Sweden)

Gilles Allaire

2004-01-01

Full Text Available L’opérationnalisation du concept d’agriculture durable au moyen de la production d’indicateurs applicables à l’exploitation agricole pose de nombreuses difficultés en raison de l'intrication des dimensions spatiale et temporelle des problèmes et pratiques en jeu: les changements d’échelle sont alors problématiques. Les problèmes à traiter dans la perspective de plus de durabilité, compte tenu de leur nature publique, demandent d’être circonscrits à plusieurs niveaux: outre les niveaux global (biens publics mondiaux et local (activités privées, un niveau intermédiaire collectif et territorial est indispensable pour l’élaboration de solutions socialement acceptables.To deal with «sustainable agriculture» in practical ways needs to set up indicators. But such indicators are quite difficult to find out, due to the multi-scaled and inter-temporal dimensions of external effects of economic activities and especially of agricultural practices. Externalities issues, which are problems characterized by their public nature, have to be defined and sized at different levels: besides the global one (which concerns debates on global public goods and the local one (how sustainable are private activities, collective and territorial levels are also necessary to set up socially acceptable responses.

Best herbs for managing diabetes: a review of clinical studies

Directory of Open Access Journals (Sweden)

Ahmad Ghorbani

2013-09-01

Full Text Available Diabetes mellitus is a public health problem which leads to serious complications over time. Experimentally, many herbs have been recommended for treating diabetes. In most cases, however, the recommendations are based on animal studies and limited pieces of evidence exist about their clinical usefulness. This review focused on the herbs, the hypoglycemic actions of which have been supported by three or more clinical studies. The search was done in Google Scholar, Medline and Science Direct databases using the key terms diabetes, plants, herbs, glucose and patients. According to the clinical studies, Aegle marmelos, Allium cepa, Gymnema sylvestre, Momordica charantia, Ocimum sanctum, Nigella sativa, Ocimum sanctum, Panax quinquefolius, Salacia reticulate, Silybum marianum and Trigonella foenum-graecum have shown hypoglycemic and, in some cases, hypolipidemic activities in diabetic patients. Among them, Gymnema sylvestre, Momordica charantia, Silybum marianum and Trigonella foenum-graecum have acquired enough reputation for managing diabetes. Thus, it seems that physicians can rely on these herbs and advise for the patients to improve management of diabetes.

Indigenous drugs in ischemic heart disease in patients with diabetes.

Science.gov (United States)

Dwivedi, Shridhar; Aggarwal, Amitesh

2009-11-01

India is currently facing the silent epidemic of ischemic heart disease, type 2 diabetes mellitus (T2DM), hypertension, and stroke. Both diabetes and ischemic heart disease appear in Indian people a decade earlier compared to whites. The recent evidence that certain medicinal plants possess hypoglycemic, lipid-lowering, and immunomodulating properties on account of their rich flavonoid and/or other glucose-lowering active constituents merits scientific scrutiny in this regard. The present communication aims to give a brief review of those plants that could be useful in T2DM associated with hypertension, ischemic heart disease, and/or dyslipidemia. Aegle marmelos (bael), Allium sativum (garlic), Curcuma domestica (turmeric), Eugenia jambolana (jamun), Murraya koenigii (curry leaves), Trigonella foenum graecum (fenugreek), and Terminalia arjuna (arjun) have been found to be useful in diabetes associated with ischemic heart disease. Their active biomolecules have been identified. They have also been demonstrated to be safe in long-term use. Further clinical research regarding their potency and efficacy vis-à-vis oral hypoglycemics needs to done.

Botanicals to Control Soft Rot Bacteria of Potato

Directory of Open Access Journals (Sweden)

M. M. Rahman

2012-01-01

Full Text Available Extracts from eleven different plant species such as jute (Corchorus capsularis L., cheerota (Swertia chiraita Ham., chatim (Alstonia scholaris L., mander (Erythrina variegata, bael (Aegle marmelos L., marigold (Tagetes erecta, onion (Allium cepa, garlic (Allium sativum L., neem (Azadiracta indica, lime (Citrus aurantifolia, and turmeric (Curcuma longa L. were tested for antibacterial activity against potato soft rot bacteria, E. carotovora subsp. carotovora (Ecc P-138, under in vitro and storage conditions. Previously, Ecc P-138 was identified as the most aggressive soft rot bacterium in Bangladeshi potatoes. Of the 11 different plant extracts, only extracts from dried jute leaves and cheerota significantly inhibited growth of Ecc P-138 in vitro. Finally, both plant extracts were tested to control the soft rot disease of potato tuber under storage conditions. In a 22-week storage condition, the treated potatoes were significantly more protected against the soft rot infection than those of untreated samples in terms of infection rate and weight loss. The jute leaf extracts showed more pronounced inhibitory effects on Ecc-138 growth both in in vitro and storage experiments.

Environmental tributary law: fiscal benefits to companies for protection of the fundamental right to environment Direito tributário ambiental: benefícios fiscais às empresas para proteção do direito fundamental ao meio ambiente

Directory of Open Access Journals (Sweden)

Marlene kempfer Bassoli

2008-01-01

Full Text Available This work demonstrates that, for the materialization of the fundamental right to environment, it is necessary that the State intervenes in the Economic Order so as to implement environmental policies that redirect both private initiative and consumers to desirable practices. For such an aim, the efficiency of economic instruments is emphasized by means of the Environmental Tributary Law. Through tributes or concession of fiscal benefits it is possible to induce appropriate practices. This research confirms that the environmental tributary policies in Brazil should take the form of fiscal benefits, instruments considered more appropriate to discourage pollution and foment responsible environmental practices.Demonstra que para a concretização do direito fundamental ao meio ambiente é necessário que o Estado intervenha na Ordem Econômica a fim de implementar políticas ambientais que redirecionem a racionalidade da iniciativa privada e consumidores a práticas ambientalmente desejáveis. Para tal finalidade, enfatiza-se a eficiência dos instrumentos econômicos por intermédio dos institutos do Direito Tributário Ambiental. Por meio da instituição de tributos ou pela concessão de benefícios fiscais é possível a indução a práticas ambientalmente adequadas. Constata que a política tributária ambiental no Brasil deve ocorrer por intermédio de benefícios fiscais, instrumentos mais apropriados para desestimular a poluição e fomentar práticas ambientais responsáveis.

Blender Studio Projects Digital Movie-Making

CERN Document Server

Mullen, Tony

2010-01-01

Learn how to get professional results from Blender. Start from scratch-the way it happens in the studio-and create fully rendered objects with Blender open-source 3D animation software and this real-world, roll-up-your-sleeves guide. No time is wasted-this book plunges straight into step-by-step instruction designed to help you build skills and create solid assets for film, video, and games. Blender is gaining clout in professional settings, and you can get a running start with this series of hands-on tutorials that encompasses multiple disciplines. The book includes a DVD with starter, interm

Vocabulaire illustré 350 exercices : niveau débutant

CERN Document Server

Filpa-Ekvall, Dominique; Watcyn-Jones, Peter

1988-01-01

Un travail stimulant et amusant pour se construire un vocabulaire de base, soit 1350 mots courants, rassemblés par thèmes (la maison, les magasins, les métiers, les animaux, le bricolage...) ou par catégories grammaticales. Des exercices d'apprentissage, de révision et d'élargissement. aussi bien pour les jeunes que pour les adultes. L'ouvrage se compose de deux parties : - l'apprentissage du vocabulaire élémentaire - l'apprentissage du vocabulaire de niveau intermédiaire suivi d'activités de contrôle des acquisitions.

Clusters de religiosidade da juventude universitária portuguesa

OpenAIRE

Coutinho, José Pereira

2014-01-01

Este artigo apresenta resultados da tese de doutoramento do autor, baseados nas crenças e práticas religiosas e nas atitudes em relação ao casamento, vida e sexualidade. A amostra incluiu 500 estudantes universitários das universidades públicas de Lisboa. Aplicando análise de correspondências múltiplas e análise de clusters a estas crenças, práticas e atitudes, foram produzidos três clusters ou tipos de religiosidade: católicos nucleares, católicos intermédios e não católicos. Estes clusters ...

Judaísmo e capitalismo: contribuição judaica para a formação do ethos capitalista

OpenAIRE

Nogueira, António Fernando de Vasconcelos

2001-01-01

A Igreja de Roma, em diferentes épocas, por intermédio das suas doutrinas, condenou o modo de vida judaico. Estava muito mais preocupada com a usura, o justo preço e as corporações, que com a economia capitalista do lucro, a empresa, o mercado monetário. Contudo, durante a Idade Média, o comércio e a usura tornaram-se familiares não apenas a muitos judeus mas também a muitos cristãos. Estes tinham-se associado em parcerias comerciais de tipo familiar nas cidades. De facto foram mercadores e b...

Le contrôle de gestion des entreprises familiales : un contrôle non-financiarisé ?

OpenAIRE

Barbelivien , Dominique

2016-01-01

Nous examinons la tendance décrite dans la littérature quant à la financiarisation de la fonction de contrôle de gestion en nous appuyant sur le cas d’une entreprise de taille intermédiaire familiale. Nous constatons que le contrôle de gestion dans le cas étudié correspond à une rationalisation des décisions opérationnelles et développons les raisons qui peuvent expliquer la persistance d’un contrôle de gestion très opérationnel. Le contexte d’entreprise familiale dans laquelle il y a confusi...

Micenas na Viena fin-de-siècle: Nietzsche, Freud, Hofmannsthal e o eterno retorno do mito

Directory of Open Access Journals (Sweden)

Leonardo Munk

2012-12-01

Full Text Available Este artigo tem por objetivo investigar a correlação de pensamento entre três importantes nomes da segunda metade do século XIX - Friedrich Nietzsche, Sigmund Freud e Hugo von Hofmannsthal - que se debruçaram sobre as crises da identidade masculina frente ao retorno do matriarcado. Tendo a Viena fin-de-siècle como cenário, o feminino é apresentado aqui por intermédio de Electra, que no texto homônimo de Hofmannsthal representa não só o fortalecimento como a própria destruição da mulher.

Modélisation unidirectionnelle de séchage solaire convectif de certaines plantes aromatiques et médicinales

OpenAIRE

Boudhrioua-Mihoubi , Nourhène; MIHOUBI , Daoued; Kechaou , Nabil

2007-01-01

International audience; Les plantes aromatiques et médicinales sont de plus en plus utilisées pour plusieurs applications en pharmacie, médecine et agroalimentaire. Ces plantes sont généralement des produits à hautes humidités ou à humidités intermédiaires d'où l'intérêt de leur stabilisation par séchage. Le séchage solaire convectif peut être utilisé comme moyen de conservation de ces produits en abaissant leurs activité et teneur en eau. La modélisation des transferts dans le produit pendan...

Les mathématiques dans l'espace méditerranéen: l'exemple d'al-Andalus et du Maghreb

OpenAIRE

Djebbar, Ahmed

2016-01-01

International audience; Dans l'Histoire des activités mathématiques autour de la Méditerranée, l'espace constitué par le Maghreb et l'Andalus a joué un triple rôle : celui d'un conservatoire d'une partie des savoirs mathématiques préislamiques (particulièrement ceux de la Grèce et de l'Inde), celui d'un lieu de production de savoirs mathématiques nouveaux mais aussi d'enseignement et de publications d'ouvrages ; celui, enfin, d'un intermédiaire important dans la diffusion partielle, vers l'Eu...

Development and evaluation of a low cost servo-valve for liquid inputs application

OpenAIRE

Johann, André L.; Russo, Edison; Cappelli, Nelson L.; Umezu, Claudio K.

2006-01-01

O presente trabalho teve o objetivo de desenvolver uma servoválvula de baixo custo, que respondesse a um sinal eletrônico de controle, para a aplicação de insumos líquidos a taxas variáveis. Depois de realizada pesquisa na literatura das opções de válvulas existentes para a dosagem de líquidos a baixas pressões, partiu-se para o desenvolvimento de uma válvula proporcional com acionamento mecânico por intermédio de um servomotor controlado eletronicamente. Uma vez desenvolvida a servoválvula, ...

Dicty_cDB: Contig-U06686-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 477 |pid:none) Methanosaeta thermophila PT, com... 37 0.22 EF175614_1( EF175614 |pid:none) Yersinia intermed...CHO_OF382xn20r1.ab1 CHO_OF Nicotiana tabacum geno... 48 0.16 1 ( EJ323709 ) 1095403525209 Global-Ocean-Sampli...br... 48 0.16 1 ( CX574665 ) TTE00035304 Amplicon Express - Conjugative Form T... 48 0.16 1 ( AC09...ar... 40 1.1 2 ( DQ102703 ) Coreana raphaelis mitochondrion, complete genome. 30 1.1 4 ( AC095058 ) Homo sapie.... 36 2.1 2 ( CP000263 ) Buchnera aphidicola str. Cc (Cinara cedri), compl... 42 2

Les protéines laitières bouillonnent de propriétés fonctionnelles

OpenAIRE

2017-01-01

Le projet Profil,porté par l'Association Bba, regroupe Bel, CR & R, Isigny StMère, Eurial, Lactalis, Laiterie de Montaigu, Laïta, Savencia, Sill, Entremont-Sodiaal, l’Inra, Oniris, l’Université du Maine, l’Université de Bretagne Occidentale et l’Université de Rennes 1 Le consortium Profil, qui regroupe 80 % de la filière laitière, a présenté mi-septembre les résultats intermédiaires de son méta-projet.[br/] Le but de notre consortium est de monter des projets de recherche pré-...

Produção e formas de circulação do tema do Descobrimento do Brasil: uma análise de seu percurso e do filme Descobrimento do Brasil (1937), de Humberto Mauro

OpenAIRE

Morettin,Eduardo Victorio

2000-01-01

Este artigo discute a produção e as formas de circulação do tema do Descobrimento do Brasil, tendo em vista a análise do filme Descobrimento do Brasil (1937), de Humberto Mauro. Paratanto, procuramos traçar a maneira pela qual este tema surge no século XIX, acompanhando as discussões colocadas pela historiografia da época. Além disto, examinamos a construção de uma iconografia referente ao assunto, por intermédio das obras de Victor Meirelles e Oscar Pereira da Silva, entre outros. A circulaç...

Produção e formas de circulação do tema do Descobrimento do Brasil: uma análise de seu percurso e do filme Descobrimento do Brasil (1937), de Humberto Mauro

OpenAIRE

Morettin, Eduardo Victorio

2000-01-01

Este artigo discute a produção e as formas de circulação do tema do Descobrimento do Brasil, tendo em vista a análise do filme Descobrimento do Brasil (1937), de Humberto Mauro. Paratanto, procuramos traçar a maneira pela qual este tema surge no século XIX, acompanhando as discussões colocadas pela historiografia da época. Além disto, examinamos a construção de uma iconografia referente ao assunto, por intermédio das obras de Victor Meirelles e Oscar Pereira da Silva, entre outros. A circulaç...

"CAPITÃES DA AREIA": O ROMANCE POÉTICO-SOCIAL DE JORGE AMADO.

OpenAIRE

Marilia Danielle Santos Cerqueira; Universidade Federal da Bahia

2012-01-01

O artigo analisa o romance, Capitães da areia, do escritor Jorge Amado, com ênfase na convivência harmônica entre a poesia e o engajamento social. O contexto aparentemente vulgar, em que ocorrem as aventuras e desventuras dos capitães, estimula o autor na produção de texto poético que envolve idealismo e luta social. Diante da finalidade de crítica social do romance em questão, entende-se que o mundo é apresentado por intermédio da perspectiva dos excluídos e marginalizados. E, no âmbito lite...

Zona Franca de Manaus : um estudo sobre a renúncia tributária dos entes federativos e os benefícios socioeconômicos gerados pelo modelo

OpenAIRE

Jofre Luís da Costa Oliveira

2011-01-01

O presente trabalho avalia a renúncia tributária dos entes federativos e os benefícios socioeconômicos gerados pelo modelo da Zona Franca de Manaus (ZFM). Nosso objetivo foi mensurar os custos sociais do modelo por intermédio da desoneração tributária ou gastos tributários dos Entes e confrontá-los com os benefícios locais que foram medidos pelos diversos indicadores socioeconômicos. A plataforma teórica tem como sustentáculo a teoria dos pólos de Desenvolvimento e a Teoria da Base Exportador...

Sistemas integrados de gestão ERP em pequenas empresas: um confronto entre o referencial teórico e a prática empresarial

OpenAIRE

Mendes,Juliana Veiga; Escrivão Filho,Edmundo

2002-01-01

Nos últimos anos, os sistemas integrados de gestão, ou ERP (Enterprise Resource Planning) , passaram a ser largamente utilizados pelas empresas. Eles são apresentados como "solução" para a maioria dos problemas empresariais. São sistemas genéricos capazes de integrar todas as informações que fluem pela empresa por intermédio de uma base de dados única. A literatura sobre o assunto apresenta uma série de resultados positivos e benefícios a serem obtidos com a adoção desses sistemas. Porém, as ...

The Enterprise Resource Planning (ERP) in small businesses: facing theoretical references and the business world

OpenAIRE

Mendes, Juliana Veiga; Escrivão Filho, Edmundo

2002-01-01

Nos últimos anos, os sistemas integrados de gestão, ou ERP (Enterprise Resource Planning) , passaram a ser largamente utilizados pelas empresas. Eles são apresentados como "solução" para a maioria dos problemas empresariais. São sistemas genéricos capazes de integrar todas as informações que fluem pela empresa por intermédio de uma base de dados única. A literatura sobre o assunto apresenta uma série de resultados positivos e benefícios a serem obtidos com a adoção desses sistemas. Porém, as ...

Plutarco e a leitura alegórica dos hieróglifos

Directory of Open Access Journals (Sweden)

Emanuel Araújo

1999-12-01

Full Text Available Até a verdadeira tradução dos hieróglifos por Champollion (1822, fazia-se normalmente uma interpretação alegórica desses signos. No caso de Plutarco e de muitos outros autores, tratava-se na verdade de uma interpretatio graeca do Egito. Observa-se isso claramente na composição de Sobre Ísis e Osíris, onde se verifica a manipulação daquela escrita por intermédio de interpretações etimológicas não raro equivocadas, aqui examinadas à luz do instrumental egiptológico.

Big Brother is watching but helping you : analyse et interprétation de mouvements humains (expressions, gestes, postures) : Big Brother is watching but helping you : human motion analysis and interpretation

OpenAIRE

Caplier , Alice

2005-01-01

Mes activités de recherche portent sur l'analyse et l'interprétation des mouvements humains à partir de données visuelles avec comme application principale l'amélioration du processus de communication entre l'homme et la machine. L'idée sous-jacente est de tendre vers une communication homme machine non pas par l'intermédiaire des traditionnels écran/clavier/souris mais vers un processus plus « humain » de communication. Ceci suppose que la machine est capable de reconnaître et d'interpréter ...

A organização do trabalho na pedagogia diferenciada ao nível do 1º Ciclo do Ensino Básico : um estudo comparativo entre os modelos pedagógicos High/Scope e do Movimento da Escola Moderna

OpenAIRE

Gomes, Mário Henrique de Jesus

2014-01-01

Tese de Doutoramento em Educação na especialidade de Desenvolvimento Curricular apresentada à Universidade Aberta Portugal subscreveu o programa da U.E. «Quadro Estratégico de Cooperação Europeia em matéria de Educação e Formação» (EF2020), que estabeleceu objetivos para os sistemas educativos europeus, no horizonte de 2020. Neste quadro, o Ministério da Educação português publicou o intermédio Programa Educação 2015, que tem como principal objetivo “elevar as competências básicas dos alun...

Importância da região AV3V e de mecanismos colinérgicos e angiotensinérgicos centrais para os efeitos cardiovasculares produzidos pela ativação da área rostroventrolateral do bulbo

OpenAIRE

Alexandre Antonio Vieira

2008-01-01

Respostas cardiovasculares podem ser integradas em diferentes níveis do sistema nervoso central (SNC). No bulbo existem várias áreas importantes para o controle cardiovascular e dentre elas o principal sítio de ativação dos neurônios pré-ganglionares simpáticos para a coluna intermédio lateral (CIL), a área rostroventrolateral (RVL) cuja ativação glutamatérgica provoca resposta pressora. Semelhante à ativação glutamatérgica, também a ativação de receptores colinérgicos e ang...

Mot-croisé : Trafic.

Directory of Open Access Journals (Sweden)

Jacques Virchaux

2006-05-01

Full Text Available   Le point de vue de l’informatique. Le trafic est constitué des éléments d'informations qui circulent entre deux équipements — typiquement un ordinateur et un serveur — par l'intermédiaire du réseau. Ces informations sont structurées selon des protocoles pour permettre un dialogue harmonieux et ne pas se perdre. Elles sont organisées en différentes couches pour leur traitement jusqu'au niveau d'une application, seul résultat intéressant en fin de compte ...

CARACTERIZAÇÃO SOCIOECONÔMICA DOS AGRICULTORES FAMILIARES PRODUTORES E NÃO PRODUTORES DE MAMÃO IRRIGADO NA AGROVILA CANUDOS, CEARÁ MIRIM (RN)

OpenAIRE

Rebouças, Maria Agripina; IFRN; Antunes de Lima, Vera Lucia; Universidade Federal de Campina Grande-UFCG

2013-01-01

A economia da agrovila Canudos está baseada na agricultura familiar, principalmente na produção de mamão irrigado. O objetivo deste estudo foi a caracterização socioeconômica dos agricultores familiares da agrovila Canudos, assentamento Rosário, localizado no município de Ceará Mirim, Rio Grande do Norte, fazendo uma comparação entre as famílias produtoras e não produtoras de mamão. Os dados da pesquisa de campo foram obtidos por intermédio de entrevistas para preenchimento de formulários com...

Le commerce transnational « informel », vecteur d’une nouvelle hiérarchie de lieux. L’exemple de la périphérie urbaine de Salé (Maroc)

OpenAIRE

Bennafla, Karine

2016-01-01

Cet article examine les implications spatiales du commerce transnational dans les pays intermédiaires tel le Maroc. Si l’accentuation des réformes néo-libérales entraîne l’ouverture de grandes surfaces, de magasins franchisés ou de malls, elle ne signe pas la fin du commerce « informel », tout aussi globalisé. La nouvelle hiérarchisation de lieux sous l’effet du commerce transnational est peu abordée dans la littérature sur le commerce informel marocain. L’exemple d’une centralité marchande i...

Campanhas eleitorais em foco : a construção das imagens : estrategias de comunicação nas eleições presidenciais de 1994

OpenAIRE

Monica Machado Cardoso Rebello

1996-01-01

Resumo: Esta dissertação objetiva ressaltar o quanto as ações comunicativas integram os quadros eleitorais contemporâneos das sociedades democráticas. No Brasil, o marketing político e os meios de comunicação de massa são determinantes na construção das representações políticas: os candidatos aos cargos públícos elegem" sua máscaras", ajustam perfis adequados aos interesses dos eleitores, comunicam seus projetos e plataformas de governo por intermédio dos aparatos técnicos. A nova condição...

Controverses autour de l'anatomie dans les traités artistiques pendant la période moderne en France

OpenAIRE

Maria Portmann

2016-01-01

Dès la Renaissance, en France, les artistes s’intéressent de près à l’anatomie afin de représenter le corps humain le plus justement possible. Influencé par ses pairs, l’Eva Prima Pandora et le Livre de Pourtraicture de Jean Cousin font largement référence aux proportions de Vitruve par l’intermédiaire d’Albrecht Dürer et à l’anatomie pour justifier la primauté de la peinture sur la sculpture en prenant comme point de départ les commentaires de Benedetto Varchi. Dans ces deux œuvres, Jean Cou...

Como seria trabalhar astrobiologia na sala de aula?

OpenAIRE

Freitas Gomes, Sheila

2017-01-01

Neste trabalho são apresentados os resultados preliminares de uma aula experimental vi¬sando conhecer os subsunçores dos alunos de ensino médio a respeito da Astrobiologia. Este tema foi escolhido de modo a potencializar a aprendizagem significativa devido a sua natureza interdisciplinar. A aula foi aplicada em uma turma de terceiro período do curso médio técnico em controle ambien¬tal em uma escola pública do município de Nilópolis. Os subsunçores expressos, por intermédio de um questionário...

Effectiveness of a chemical herder in association with in-situ burning of oil spills in ice-infested water

DEFF Research Database (Denmark)

van Gelderen, Laurens; Fritt-Rasmussen, Janne; Jomaas, Grunde

2017-01-01

The average herded slick thickness, surface distribution and burning efficiency of a light crude oil were studied in ice-infested water to determine the effectiveness of a chemical herder in facilitating the in-situ burning of oil. Experiments were performed in a small scale (1.0m2) and an interm......The average herded slick thickness, surface distribution and burning efficiency of a light crude oil were studied in ice-infested water to determine the effectiveness of a chemical herder in facilitating the in-situ burning of oil. Experiments were performed in a small scale (1.0m2...

El futbol 9 com alternativa al futbol 11, a partir de l’estudi de la utilització de l’espai de joc

OpenAIRE

Lapresa Ajamil, Daniel; Arana Idiakez, Javier; Garzón Echevarría, Belén

2006-01-01

Aquest treball d’investigació pretén demostrar que l’actual configuració de la competició existent a la Comunitat Autònoma de la Rioja –entre d’altres–, en el primer any de la categoria infantil, en relació amb el trànsit de la modalitat de futbol 7 a futbol 11, presenta diferències manifestes que impliquen un desajustament entre les característiques del joc i les possibilitats reals del nen. Com a conseqüència d’això es proposa una modalitat intermèdia, el futbol 9 –una alternativa concreta ...

Exploring the impact of learning objects in middle school mathematics and science classrooms: A formative analysis

Directory of Open Access Journals (Sweden)

Robin H. Kay

2008-12-01

Full Text Available The current study offers a formative analysis of the impact of learning objects in middle school mathematics and science classrooms. Five reliable and valid measure of effectiveness were used to examine the impact of learning objects from the perspective of 262 students and 8 teachers (14 classrooms in science or mathematics. The results indicate that teachers typically spend 1-2 hours finding and preparing for learning-object based lesson plans that focus on the review of previous concepts. Both teachers and students are positive about the learning benefits, quality, and engagement value of learning objects, although teachers are more positive than students. Student performance increased significantly, over 40%, when learning objects were used in conjunction with a variety of teaching strategies. It is reasonable to conclude that learning objects have potential as a teaching tool in a middle school environment. L’impacte des objets d’apprentissage dans les classes de mathématique et de sciences à l’école intermédiaire : une analyse formative Résumé : Cette étude présente une analyse formative de l’impacte des objets d’apprentissage dans les classes de mathématique et de sciences à l’école intermédiaire. Cinq mesures de rendement fiables et valides ont été exploitées pour examiner l’effet des objets d’apprentissage selon 262 élèves et 8 enseignants (414 classes en science ou mathématiques. Les résultats indiquent que les enseignants passent typiquement 1-2 heures pour trouver des objets d’apprentissage et préparer les leçons associées qui seraient centrées sur la revue de concepts déjà vus en classe. Quoique les enseignants aient répondu de façon plus positive que les élèves, les deux groupes ont répondu positivement quant aux avantages au niveau de l’apprentissage, à la qualité ainsi qu’à la valeur motivationnelle des objets d’apprentissage. Le rendement des élèves aurait aussi augment

Dolni Vestonice (Czech Republic) an intermédiate loess series between Western and eastern European records

Science.gov (United States)

Rousseau, D.; Antoine, P.; Hatte, C.; Lagroix, F.; Fuchs, M.; Moine, O.; Gauthier, C.; Svoboda, J.; Lisa, L.

2010-12-01

Previous investigations on western and eastern European loess series have shown similarities at least for the main loess deposition during the last climate cycle, recording North-Atlantic abrupt climate changes, the Dansgaard-Oeschger and Heinrich events. To address the question of how such record occurred through modeling experiments (Sima et al., QSR, 2009), we need reference series located in an intermediary position between the Nussloch (Germany - Antoine et al, QI 2001, QSR, 2009; Rousseau et al, GRL 2007) and Stayky (Ukraine -Rousseau et al, Clim Past D 2010) loess series at about 50°N latitude, location of the main deposits. The key sequence of Dolni Vestonice in southern Czech Republic, had been investigated previously and described by many authors since 1961, and more especially by G Kukla and B Klima. Here we present the preliminary results of the new study of this key sequence by a multidisciplinary study, supported by ANR-ACTES project, combining the detailed stratigraphy, AMS 14C and IRSL dating, rock magnetic property, grain size, d13C and mollusks analyses. We applied the same sampling protocol than previously developed, by carefully cleaning the sequence on a vertical panel, 15m high and 5m wide in order to have parallel samples (on continuous columns) easily comparable. The results show similar patterns, high frequency variations of the different proxies in the upper part of the record corresponding to MIS 3 and 2, as observed in western and eastern European sequences supporting then our assumption of the recording of N Atlantic abrupt changes over Europe. Other interesting variations are clearly demonstrated for every proxy making these results remarkable new data for individual in deep studies. Moreover our detailed investigation also shows new data about abrupt dust events, markers, in the lower part of the sequence, and previously interpreted as strong dust events, and how they appear within sedimentary cycles linked to the cyclicity at the base of the last climate cycle.

Les dimensions d’une ombre: résonances intermédiales et collaborations artistiques entre femmes

Directory of Open Access Journals (Sweden)

Maryse Larivière

2014-04-01

Full Text Available Au sujet de l’ouvrage d’Andrea Oberhuber, Corps de papier : résonances[avec des accompagnements de Catherine Mavrikakis, Nicole Brossard et Verena Stefan] (Québec, QC, Nota Bene, 2012, 237 p. ISBN: 978-2-89518-442-3.

Lathe leveler

Energy Technology Data Exchange (ETDEWEB)

Lovelady, III, Michael W.J.

2018-03-06

A lathe leveler for centering a cutting tool in relation to a cylindrical work piece includes a first leveling arm having a first contact point disposed adjacent a distal end of the first leveling arm, a second leveling arm having a second contact point disposed adjacent a distal end of the second leveling arm, a leveling gage, and a leveling plate having a cutting tool receiving surface positioned parallel to a horizontal axis of the leveling gage and on a same plane as a midpoint of the first contact point and the second contact point. The leveling arms and leveling plate are dimensioned and configured such that the cutting tool receiving surface is centered in relation to the work piece when the first and second contact points are in contact with one of the inner surface and outer surface of the cylindrical work piece and the leveling gage is centered.

Gender Equity and Public Policies in Latin America: Opportunities and Risks in the PRS Approach

OpenAIRE

Geske Dijkstra

2011-01-01

Cet article cherche à déterminer dans quelle mesure les programmes de l’initiative de la Stratégie de Réduction de la Pauvreté ont contribué à promouvoir l’égalité des sexes dans les politiques publiques en Bolivie, au Honduras et au Nicaragua. Les processus de SRP présentent, en théorie, des opportunités pour promouvoir l’égalité entre les sexes à travers la participation de la société civile dans l’élaboration des stratégies ainsi que leur gestion et suivi, et aussi par l’intermédiaire des ...

Sistemas de tubagem de PPR reforçado com fibra de vidro destinados à distribuição de água quente e fria e a sistemas de aquecimento e de extinção automática de incêndio por água com aspersores no interior de edifícios - Critério para avaliação da aptidão ao uso

OpenAIRE

Real, L. P.

2016-01-01

Nesta publicação apresenta-se o critério presentemente seguido pelo LNEC para concessão de homologação com certificação, bem como para o posterior controlo periódico da qualidade a sistemas de tubagem de copolímero de polipropileno estatístico (“random”) reforçado com fibra de vidro na camada intermédia (PPR-FV-PPR), destinados à distribuição de água quente e fria, ao aquecimento e a redes de extinção automática de incêndio por água. Projeto ECOPOL / NÃO CONFIDENCIAL DED/NAICI...

Evolução tectonomagmática da Zona de Ossa-Morena durante o ciclo Varisco: Estará o ciclo de J. Tuzo Wilson completo?

OpenAIRE

Pedro, Jorge; Moita, Patricia; Araújo, Alexandre; Fonseca, Paulo; Munhá, José

2006-01-01

A evolução tectonomagmática varisca da Zona de Ossa-Morena mostra evidências claras dos estádios iniciais (“rifting”) e finais (colisionais) de um ciclo de Wilson, estando o estádio intermédio de magmatismo oceânico, em bacias com margens passivas, representado pelas Sequências Ofiolíticas Internas. As variações no tempo das características geológicas/geoquímicas do magmatismo no ramo SW da Cadeia Varisca Ibérica, são consistentes com as variações expectáveis durante a evolução típica de um c...

Faux produits et marchandises contrefaites dans la Chine et le Japon prémodernes. Réglementations, corps de métiers et contraintes éthiques1

OpenAIRE

Carré, Guillaume; Lamouroux, Christian

2013-01-01

L’article est consacré au problème des faux produits et des copies, abordé à partir de deux exemples, les soies et soieries dans la Chine des Song et les faux remèdes pharmaceutiques dans le Japon d’Edo, deux sociétés marquées par la croissance du secteur commercial entraînant de rapides changements sociaux. Notre approche s’est concentrée sur trois points : 1) le rôle des marchands et des intermédiaires dans la stabilité et la légalité des échanges ; 2) les négociations permanentes entre les...

Dicty_cDB: Contig-U04495-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Full=Seryl-tRNA synthetase; EC=6.1.1.... 38 0.097 AF101063_1( AF101063 |pid:none) Hirudo medicinalis intermed...9 |pid:none) Haemopis marmorata neuronal intermedia... 40 0.033 (Q2JXL1) RecName:..... 36 5.2 3 ( AC222582 ) Bos taurus clone CH240-445A18, WORKING DRAFT SEQU... 38 5.5 3 ( EJ360574 ) 1092963685063 Global-Ocean-Sampli...eptomyces natalensis Pho regulo... 32 6.9 AJ575294_1( AJ575294 |pid:none) Ciona intestinali...a gladiata maturase K (matK) gene, compl... 48 0.28 1 ( AY034204 ) Wolffiella oblonga maturase K (matK) gene, compl

Dicty_cDB: Contig-U01385-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available DRAF... 46 2.0 1 ( EJ296094 ) 1095388038537 Global-Ocean-Sampling_GS-27-01-01-1... 46 2.0 1 ( CB895163 ) EST647955 HOGA Med...067741 |pid:none) Homo sapiens proteasome (prosome, ... 35 2.7 AF323913_1( AF323913 |pid:none) Neurospora crassa interm...094293 ) 1092962025663 Global-Ocean-Sampling_GS-31-01-01-1... 36 1.4 2 ( CU570868 ) M.truncatula DNA sequenc...:none) Leishmania major strain Friedlin... 37 0.94 CP001213_467( CP001213 |pid:none) Bifidobacterium animali...icago truncatula clone mth2-165c4, complete se... 46 2.0 1 ( AC150776 ) Medicago truncatula c

Dicty_cDB: Contig-U12832-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available N... 44 5.2 1 ( CV571667 ) oe15g07.y1 Human keratoconus cornea, unamplified,... 44 5.2 1 ( AI973283 ) wr54c0...Name: Full=E3 ubiquitin-protein ligase RNF19B; ... 41 0.024 (Q17RB8) RecName: Full=LON peptidase N-terminal ...urpuratus clone R3-3082J12, W... 38 0.34 6 ( EK301514 ) 1095462366289 Global-Ocean-Sampli...RI-214 Salmo salar genomic clone S... 44 5.2 1 ( ER301481 ) 1092343697994 Global-Ocean-Sampli...Y598454_1( AY598454 |pid:none) Danio rerio transcriptional interm... 39 0.070 CR853286_7( CR853286 |pid:none

James L.W. West III, ed. The Cambridge Edition of the Works of F. Scott Fitzgerald : « Trimalchio » : an Early Version of The Great Gatsby.

Directory of Open Access Journals (Sweden)

Jean-Loup Bourget

2006-04-01

Full Text Available Présenté comme « an early version of The Great Gatsby », “Trimalchio” est une tentative de reconstitution du manuscrit dactylographié envoyé par Fitzgerald à son éditeur, Scribner’s, en octobre 1924. Ce tapuscrit étant perdu, le texte a été établi à partir des épreuves avant correction, elles-mêmes composées à partir du tapuscrit. Il représente donc un stade intermédiaire entre le manuscrit holographe conservé à Princeton (fac-similé publié par les soins de Matthew J. Bruccoli en 1973 et le ...

Plurimidialidade e arte

OpenAIRE

Maria Gabriela Capper

2015-01-01

Esta dissertação tem por objetivo o estudo e a realização de procedimentos artísticos singulares que se abrem após o modernismo em diferenças flagrantes, levando a formas contemporâneas de organização do sensível em que as fronteiras entre as especificidades artísticas são cada vez mais diluídas. Conceitos como, dentre outros, o de campo expandido ou campo ampliado, de Rosalind Krauss, de arte inespecífica, de Florencia Garramuño, de intermídia, de Dick Higgins, de quase-cinema, de Hélio Oiti...

Du cinéma à l’intermedia : autour de Fluxus

OpenAIRE

Bovier, François

2016-01-01

La notion d’art intermédiatique, théorisée par Dick Higgins, désigne un vaste ensemble d’expérimentations artistiques qui transgressent la pensée moderniste de la spécificité du support d’expression. Bovier soutient que c’est dans ce contexte que le cinéma élargi doit être envisagé, celui-ci ne s’assujettissant aucunement à un simple paradigme cinématographique. Les incursions des artistes du mouvement à géométrie variable Fluxus dans les domaines de l’installation, du film, de la vidéo et de...

Um Estudo do Discurso Psicanalítico no Filme Fahrenheit 451: a destruição do conhecimento

Directory of Open Access Journals (Sweden)

Paula Puhl

2008-12-01

Full Text Available O presente artigo busca fazer uma análise, a partir do filme Fahrenheit 451, por intermédio da personagem do bombeiro Montag, utilizando as idéias de Gaston Bachelard expostas em suas obras, em especial, em a Psicanálise do Fogo, a fim de verificar o significado do Fogo na obra cinematográfica. O pensamento de Bachelard se caracteriza pela busca da subjetividade na interpretação das imagens, ligando a poesia à ciência, servindo como suporte teórico para a interpretação da comunicação cinematográfica.

WIND ENERGY – ECOSUSTAINABILITY ENGINEERING SOLUTION

Directory of Open Access Journals (Sweden)

Roxana Gabriela POPA

2013-05-01

Full Text Available Renewables provides increased safety energy supply and limiting imports of energy resources, interms of sustainable economic development. The new requirements for sustainable development have determinedthe world to put the issue of energy production methods and increase the share of energy produced fromrenewable energy. This paper presents the history of wind power, advantages and disadvantages of renewableenergy, particularly wind energy as an alternative source of energy. Windmills can be horizontal axis or verticalaxis Savonius and Darrieus rotor. Latest innovations allow operation of variable speed wind turbines, or turbinespeed control based on wind speed. Wind energy is considered one of the most sustainable choices betweenvariants future wind resources are immense.

Determinação dos valores de energia e do balanço de nitrogênio de alguns alimentos para leitões na fase inicial

OpenAIRE

Bertol,Teresinha Marisa; Ludke,Jorge Vítor

1999-01-01

Este trabalho foi realizado para obter valores de energia digestível (ED) e metabolizável (EM) de quatorze alimentos, em cinco experimentos, utilizando-se 144 leitões com 28 dias de idade e peso médio de 9,42±0,76 kg. O teor de energia digestível (ED) e o de energia metabolizável (EM) foram determinados por intermédio do método de coleta total de fezes e urina. As fontes de proteína provenientes do leite foram superiores aos subprodutos da soja, com relação à digestibilidade da energia e da p...

Prediction equation of crude protein requirements for broiler breeders hens

OpenAIRE

Rabello, Carlos Bôa-Viagem; Sakomura, Nilva Kazue; Longo, Flavio Alves; Resende, Kleber Tomaz de; Couto, Humberto Pena

2002-01-01

O objetivo do presente trabalho foi determinar as exigências de proteína para aves reprodutoras pesadas através do método fatorial. A exigência de proteína bruta para mantença (PBm) foi determinada por intermédio da técnica do balanço de nitrogênio por meio de ensaio de metabolismo com aves submetidas a quatro dietas com níveis decrescentes de proteína, proporcionando balanço positivo, próximo a zero e negativo. Para determinar a exigência de proteína bruta para o ganho de peso (PBg) dois exp...

Des peintures de Nevers aux œuvres de la réforme du XIIe siècle : les témoins d’une tradition iconographique

Directory of Open Access Journals (Sweden)

Barbara Franzé

2008-07-01

Full Text Available Les peintures murales de la cathédrale Saint-Cyr de Nevers figurent parmi les plus importantes et les mieux conservées de Bourgogne ; elles ornent l’immense abside occidentale de la cathédrale, dont l’architecture semble s’inspirer de modèles ottoniens.L’ensemble iconographique est organisé en deux zones distinctes, architecturalement définies par un « arc-doubleau intermédiaire » séparant le cul-de-four de la « travée droite ��. Dans le cul-de-four, le Christ bénit de la main droite et tient ...

Rôle des coopératives dans le fonctionnement du bassin de collecte laitier du Tadla, Maroc

OpenAIRE

Le Gal , P.-Y.; Oudin , E.; Kuper , M.; Moulin , C.-H.; Sraïri , T.

2007-01-01

International audience; Le bassin de collecte laitier situé sur le périmètre du Tadla se structure autour d'une usine de transformation industrielle approvisionnée par une myriade de petits éleveurs. Cette atomisation de l'offre a rendu nécessaire la mise en place de coopératives de collecte chargées d'agréger l'offre et d'assurer la chaîne du froid au plus près des producteurs. De fait, ces coopératives jouent un rôle central d'intermédiaire dans la chaîne d'approvisionnement allant de l'eau...

Doenças das crianças goianas no século XIX. Os registros de óbitos do Hospital de Caridade São Pedro de Alcântara

OpenAIRE

Sônia Maria de Magalhães; Elias Nazareno

2013-01-01

Recuperar a história da infância no Brasil constitui-se numa tarefa árdua empreendida pelos historiadores desde as últimas décadas do século XX. As pesquisas desenvolvidas buscam dar voz aos meninos e meninas por intermédio da pesquisa e da revalorização do documento histórico. Apesar dos grandes avanços, pouco se conhece sobre os jogos e brincadeiras, a literatura infantil, a saúde e a educação. Deste modo, este estudo propende a municiar subsídios sobre as doenças e a alimentação das crianç...

Previsão e identificação de eventos de quebra de segurança em vídeo-vigilância

OpenAIRE

Duque, Duarte

2009-01-01

Tese de doutoramento em Tecnologias e Sistemas de Informação (ramo de conhecimento em Sistemas de Computação e Comunicação) Esta tese tem como propósito a detecção e previsão de comportamentos passíveis de originar uma quebra de segurança. Estes são reconhecidos por meio da observação de padrões de actividade humana, extraídos de sequências de imagens digitalizadas, adquiridas por intermédio de uma câmara de vídeo a cores, monocular e fixa. A aferição dos comportamentos é sup...

Étudier la science-fiction en France aujourd’hui

Directory of Open Access Journals (Sweden)

Irène Langlet

2012-10-01

Full Text Available La science-fiction est une pratique intermédiatique reconnue dans la culture contemporaine mais discrète dans le monde universitaire. Ce contraste s’explique par l’histoire du genre et sa constitution progressive, dans notre pays, en « paralittérature », voire en « subculture ». Mais la situation évolue, grâce à des pratiques académiques en pleine recomposition disciplinaire, ainsi renouvellement des générations accentuant la porosité des barrières culturelles. Les perspectives qui peuvent en être tirées se déduisent de ce paysage complexe.

Recurrent population improvement of rice breeding facilitated with male sterility

International Nuclear Information System (INIS)

Fujimaki, Hiroshi

1982-01-01

A new rice breeding system has been developed, making use of genic male sterility to utilize diverse breeding materials and to promote genetic recombination. In this system, recurrent selection technique and introgressive hybridization were used to increase the frequencies of producing desired genotypes and to improve the population in succession. To promote genetic recombination by the recurrent selection technique, intermating within the population is necessary, and to introduce useful germ plasms by the introgressive hybridization, back crossing with new genetic material is necessary. These can be done efficiently by using the recessive alleles for male sterility, and the representative models for thisF type of breeding were presented. (Kaihara, S.)

Guidance levels, achievable doses and expectation levels

International Nuclear Information System (INIS)

Li, Lianbo; Meng, Bing

2002-01-01

The National Radiological Protection Board (NRPB), the International Atomic Energy Agency (IAEA) and the Commission of the European Communities (CEC) published their guidance levels and reference doses for typical X-ray examination and nuclear medicine in their documents in 1993, 1994 and 1996 respectively. From then on, the concept of guidance levels or reference doses have been applied to different examinations in the field of radiology and proved to be effective for reduction of patient doses. But the guidance levels or reference doses are likely to have some shortcomings and can do little to make further reduction of patient dose in the radiology departments where patient dose are already below them. For this reason, the National Radiological Protection Board (NRPB) proposed a concept named achievable doses which are based on the mean dose observed for a selected sample of radiology departments. This paper will review and discuss the concept of guidance levels and achievable doses, and propose a new concept referred to as Expectation Levels that will encourage the radiology departments where patient dose are already below the guidance levels to keep patient dose as low as reasonably achievable. Some examples of the expectation levels based on the data published by a few countries are also illustrated in this paper

Utilization of unconventional lignocellulosic waste biomass for the biosorption of toxic triphenylmethane dye malachite green from aqueous solution.

Science.gov (United States)

Selvasembian, Rangabhashiyam; P, Balasubramanian

2018-05-12

Biosorption potential of novel lignocellulosic biosorbents Musa sp. peel (MSP) and Aegle marmelos shell (AMS) was investigated for the removal of toxic triphenylmethane dye malachite green (MG), from aqueous solution. Batch experiments were performed to study the biosorption characteristics of malachite green onto lignocellulosic biosorbents as a function of initial solution pH, initial malachite green concentration, biosorbents dosage, and temperature. Biosorption equilibrium data were fitted to two and three parameters isotherm models. Three-parameter isotherm models better described the equilibrium data. The maximum monolayer biosorption capacities obtained using the Langmuir model for MG removal using MSP and AMS was 47.61 and 18.86 mg/g, respectively. The biosorption kinetic data were analyzed using pseudo-first-order, pseudo-second-order, Elovich and intraparticle diffusion models. The pseudo-second-order kinetic model best fitted the experimental data, indicated the MG biosorption using MSP and AMS as chemisorption process. The removal of MG using AMS was found as highly dependent on the process temperature. The removal efficiency of MG showed declined effect at the higher concentrations of NaCl and CaCl 2 . The regeneration test of the biosorbents toward MG removal was successful up to three cycles.

Assessing human variability in kinetics for exposures to multiple environmental chemicals: a physiologically based pharmacokinetic modeling case study with dichloromethane, benzene, toluene, ethylbenzene, and m-xylene.

Science.gov (United States)

Valcke, Mathieu; Haddad, Sami

2015-01-01

The objective of this study was to compare the magnitude of interindividual variability in internal dose for inhalation exposure to single versus multiple chemicals. Physiologically based pharmacokinetic models for adults (AD), neonates (NEO), toddlers (TODD), and pregnant women (PW) were used to simulate inhalation exposure to "low" (RfC-like) or "high" (AEGL-like) air concentrations of benzene (Bz) or dichloromethane (DCM), along with various levels of toluene alone or toluene with ethylbenzene and xylene. Monte Carlo simulations were performed and distributions of relevant internal dose metrics of either Bz or DCM were computed. Area under the blood concentration of parent compound versus time curve (AUC)-based variability in AD, TODD, and PW rose for Bz when concomitant "low" exposure to mixtures of increasing complexities occurred (coefficient of variation (CV) = 16-24%, vs. 12-15% for Bz alone), but remained unchanged considering DCM. Conversely, AUC-based CV in NEO fell (15 to 5% for Bz; 12 to 6% for DCM). Comparable trends were observed considering production of metabolites (AMET), except for NEO's CYP2E1-mediated metabolites of Bz, where an increased CV was observed (20 to 71%). For "high" exposure scenarios, Cmax-based variability of Bz and DCM remained unchanged in AD and PW, but decreased in NEO (CV= 11-16% to 2-6%) and TODD (CV= 12-13% to 7-9%). Conversely, AMET-based variability for both substrates rose in every subpopulation. This study analyzed for the first time the impact of multiple exposures on interindividual variability in toxicokinetics. Evidence indicates that this impact depends upon chemical concentrations and biochemical properties, as well as the subpopulation and internal dose metrics considered.

Littérature progressive du français avec 600 activités : niveau intermédiaire

CERN Document Server

Blondeau, Nicole; Né, Marie-Françoise

2004-01-01

Une organisation claire : le texte littéraire, une courte biographie de l'auteur et des notes explicatives sur la page de gauche; des activités guidées de découverte et d'exploitation sur la page de droite la progression : les textes sont classés par ordre chronologique. Les activitées de lecture et d'analyse constituent un véritable parcours d'aprentissage le choix des textes : du Moyen Age à nos jours, avec une priorité accordée à la littérature contemporaine (XIXe et XXe), des textes parmi les plus représentatifs de la littérature française, avec une ouverture sur la littérature francophone l'appareil pédagogique propose une approche facilitant la découverte et la compréhension de l'histoire littéraire, le repérage des genres et la portée des idées un usage souple : pour la classe ou en auto-apprentissage A découvrir dans cette deuxième édition revue et augmentée:

Charlatans, intermédiaires de Dieu, confidents ou attraction touristique: ethnographie des pratiques d'herboristerie à Marrakech

OpenAIRE

Matter, Yvan; Wendling, Thierry

2006-01-01

Ce travail, effectué dans le cadre d’un inventaire sur les plantes et animaux commercialisés dans les souks de Marrakech, dresse un constat sur la médecine populaire au Maroc, laquelle est cernée dans son actualité au travers de l’exemple des herboristes. Après avoir décrit le contexte de l’étude et ses aspects méthodologiques, cette recherche tentera de dresser un tableau général de l’intrigue dans laquelle se trouvent projetés les divers acteurs du système de santé "traditionnel", et cela ...

Average County-Level IQ Predicts County-Level Disadvantage and Several County-Level Mortality Risk Rates

Science.gov (United States)

Barnes, J. C.; Beaver, Kevin M.; Boutwell, Brian B.

2013-01-01

Research utilizing individual-level data has reported a link between intelligence (IQ) scores and health problems, including early mortality risk. A growing body of evidence has found similar associations at higher levels of aggregation such as the state- and national-level. At the same time, individual-level research has suggested the…

Variation in the post-mating fitness landscape in fruit flies.

Science.gov (United States)

Fricke, C; Chapman, T

2017-07-01

Sperm competition is pervasive and fundamental to determining a male's overall fitness. Sperm traits and seminal fluid proteins (Sfps) are key factors. However, studies of sperm competition may often exclude females that fail to remate during a defined period. Hence, the resulting data sets contain fewer data from the potentially fittest males that have most success in preventing female remating. It is also important to consider a male's reproductive success before entering sperm competition, which is a major contributor to fitness. The exclusion of these data can both hinder our understanding of the complete fitness landscapes of competing males and lessen our ability to assess the contribution of different determinants of reproductive success to male fitness. We addressed this here, using the Drosophila melanogaster model system, by (i) capturing a comprehensive range of intermating intervals that define the fitness of interacting wild-type males and (ii) analysing outcomes of sperm competition using selection analyses. We conducted additional tests using males lacking the sex peptide (SP) ejaculate component vs. genetically matched (SP + ) controls. This allowed us to assess the comprehensive fitness effects of this important Sfp on sperm competition. The results showed a signature of positive, linear selection in wild-type and SP + control males on the length of the intermating interval and on male sperm competition defence. However, the fitness surface for males lacking SP was distinct, with local fitness peaks depending on contrasting combinations of remating intervals and offspring numbers. The results suggest that there are alternative routes to success in sperm competition and provide an explanation for the maintenance of variation in sperm competition traits. © 2017 The Authors. Journal of Evolutionary Biology published by John Wiley & Sons Ltd on behalf of European Society for Evolutionary Biology.

Redes de relações sociais e acesso ao emprego entre os jovens: o discurso da meritocracia em questão Social networks and access to employment among youths: questioning the meritocracy discourse

Directory of Open Access Journals (Sweden)

Mariléia Maria da Silva

2010-03-01

Full Text Available Este trabalho consiste em analisar a trajetória de inserção profissional dos egressos do ensino superior, enfatizando as formas de acesso empregadas pelos jovens para alcançar um emprego, relacionando-as às redes de relações sociais. O discurso em voga, sobretudo proveniente dos arautos das agências de consultoria de recursos humanos, enfatiza o aumento da qualificação como antídoto contra o desemprego. O estudo se pauta nos dados obtidos para elaboração de tese de doutorado. Os resultados da pesquisa apontam três modos predominantes de acesso ao emprego: "intermédio da família", "intermédio dos amigos" e "concurso público". Nesse sentido, a garantia de estabilidade no emprego representada pelo ingresso no setor público e as formas particularistas são as que se destacam, o que contraria o discurso da excelência da competitividade como fator determinante na conquista e permanência no emprego.This paper analyzes the professional insertion trajectory of graduation and post-graduation students. It traces the ways followed by youths to have access to employment and associates them to social networks. The discourse in vogue, which mainly comes from human resources consultation agencies, stresses qualification as an antidote against unemployment. This study is based on an analysis of the data obtained to elaborate a PhD thesis, whose results point out three predominant ways to have access to employment: "family", "friends" and "civil service exams". Thus, the guaranty of employment stability represented by the admission in civil services and particularistic ways stand out, which contradicts the discourse on the excellence of competitiveness as a determinant factor to conquer and keep an employment.

Irrigação do nó sinoatrial em suínos da raça Piètrain

Directory of Open Access Journals (Sweden)

Renato Souto Severino

2000-01-01

Full Text Available Estudou-se, em 30 (trinta corações de suínos da raça Piètrain, adultos e de ambos os sexos, a irrigação do nó sinoatrial, visando conhecer a origem, trajeto e distribuição dos vasos responsáveis pela nutrição deste tecido, bem como eventuais anastomoses que pudessem ocorrer entre estes colaterais. Para tanto, os corações tiveram seus sistemas coronarianos canulados e injetados com uma solução corada de Neoprene látex 450, fixados em solução aquosa de formol a 10% e dissecados os ramos atriais das artérias coronárias esquerda e direita. Constatou-se que em 27 (90% ± 5,47 corações o tecido nodal é irrigado por colaterais provenientes da A. coronária direita, mais precisamente pelo ramo atrial proximal direito, isoladamente em 18 (60% ± 8,94 órgãos ou associado: ao ramo atrial intermédio direito em 7 (23,33% ± 7,72 ou ao ramo atrial distal direito em 2 (6,66% ± 4,55. Em 3 (10% ± 5,47 órgãos, o nó sinoatrial é vascularizado por colaterais provenientes das Aa. coronárias direita e esquerda, sempre por meio do ramo atrial proximal direito, associado ao ramo atrial proximal esquerdo em 2 (6,66% ± 4,55 ou aos ramos atriais intermédio direito e proximal esquerdo em 1 (3,33% ± 3,27 órgão. Evidenciaram-se, ainda, anastomoses travadas entre os diferentes vasos que participam da irrigação do nó sinoatrial em suínos da raça Piètrain.

Level densities

International Nuclear Information System (INIS)

Ignatyuk, A.V.

1998-01-01

For any applications of the statistical theory of nuclear reactions it is very important to obtain the parameters of the level density description from the reliable experimental data. The cumulative numbers of low-lying levels and the average spacings between neutron resonances are usually used as such data. The level density parameters fitted to such data are compiled in the RIPL Starter File for the tree models most frequently used in practical calculations: i) For the Gilber-Cameron model the parameters of the Beijing group, based on a rather recent compilations of the neutron resonance and low-lying level densities and included into the beijing-gc.dat file, are chosen as recommended. As alternative versions the parameters provided by other groups are given into the files: jaeri-gc.dat, bombay-gc.dat, obninsk-gc.dat. Additionally the iljinov-gc.dat, and mengoni-gc.dat files include sets of the level density parameters that take into account the damping of shell effects at high energies. ii) For the backed-shifted Fermi gas model the beijing-bs.dat file is selected as the recommended one. Alternative parameters of the Obninsk group are given in the obninsk-bs.dat file and those of Bombay in bombay-bs.dat. iii) For the generalized superfluid model the Obninsk group parameters included into the obninsk-bcs.dat file are chosen as recommended ones and the beijing-bcs.dat file is included as an alternative set of parameters. iv) For the microscopic approach to the level densities the files are: obninsk-micro.for -FORTRAN 77 source for the microscopical statistical level density code developed in Obninsk by Ignatyuk and coworkers, moller-levels.gz - Moeller single-particle level and ground state deformation data base, moller-levels.for -retrieval code for Moeller single-particle level scheme. (author)

Vpliv razvoja kontekstualnega znanja na razlikovalne kompetence = The Influence of the Development of Contextual Knowledge on Differentiating Competencies

Directory of Open Access Journals (Sweden)

Ramon Podreka

2010-06-01

Full Text Available The subject of this paper is based on the definition of competence asthe individual’s ability to activate, utilize and merge the knowledge andskills acquired when faced with complex, diverse and unpredictablework situations. The purpose of this study is to determine whether thedevelopment of specific contextual knowledge and skills within an organizationleads to the adoption of specific differentiating competenciesby individuals. The survey included marketers employed by threemedium-sized Slovenian enterprises, who function in three differentwork contexts, according to our findings. The results of the researchshow that the differentiating competencies that distinguish the superiorjob performance marketing employee from an average one interms of work success are subject to the development of specific contextualknowledge and skills.

La densité a-t-elle une influence sur les comportements sociaux ? Des échelles territoriales différentes

Directory of Open Access Journals (Sweden)

Hervé Le Bras

1996-04-01

Full Text Available L'idée de densité a sans doute précédé celle de population. Pour Jean Bodin dont on cite sans vergogne le célèbre "Il n'est de richesses que d'hommes", la densité indiquait à la fois la cause et le critère du fonctionnement de l'État. Pour Montesquieu elle épousait le régime politique : les Républiques étaient densément peuplées ; dans les Monarchies, la population se groupait au centre du pouvoir et à la frontière, laissant l'espace intermédiaire presque vide, et dans les tyrannies, la densi...

Harcèlement psychologique au travail : pistes pour une meilleure compréhension et prise en charge

Directory of Open Access Journals (Sweden)

Raymond Baril

2005-11-01

Full Text Available S’il y a des concepts qui ont pris de l’importance et ont été largement diffusés depuis la fin des années 90 dans les publications scientifiques et, plus récemment, dans les médias grand-public, ce sont bien ceux de harcèlement moral ou psychologique, ou de mobbing ou encore de bullying pour décrire une réalité dans les milieux de travail qui fait encore beaucoup de ravages aujourd’hui. PISTES est heureux de contribuer au débat dans ce numéro spécial thématique par l’intermédiaire d’une broch...

Preenchimento automático de formulários na web oculta

OpenAIRE

Gustavo Zanini Kantorski

2014-01-01

Muitas informações disponíveis na Web estão armazenadas em bancos de dados on-line e são acessíveis somente após um usuário enviar uma consulta por meio de uma interface de busca. Essas informações estão localizadas em uma parte da Web conhecida como Web Oculta ou Web Profunda e, geralmente, são inacessíveis por máquinas de busca tradicionais. Uma vez que a forma de acessar os dados na Web Oculta se dá por intermédio de submissões de consultas, muitos trabalhos têm focado em como preencher au...

Equilíbrio acído-base e a acidose metabólica da insuficiência renal crónica

OpenAIRE

Andrade, Sara Isabel Oliveira de Castro e

1999-01-01

Resumo da tese: O organismo mantém num equilíbrio dinâmico a composição e o volume de todos os compartimentos líquidos corporais, apesar de não bebermos sempre a mesma quantidade de líquidos e de não comermos sempre os mesmos alimentos. Mantém um equilíbrio entre as entradas e as saídas e, quando percebe que algo está mal, age, por intermédio dos seus órgâos sintonizados num integrado mecanismo de regulação, sem que sequer nos apercebamos. Mas quando o organismo fica doente, quando há algo qu...

Dicty_cDB: Contig-U14443-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 314998_1( AK314998 |pid:none) Homo sapiens cDNA, FLJ95925, highl... 36 3.6 AY092033_1( AY092033 |pid:none) Homo sapiens NALP3 interm... EK187609 ) 1095460006975 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.5 3 ( AC168354 ) Strongylocentrotus pu... 9 ( EJ184534 ) 1092344144110 Global-Ocean-Sampling_GS-27-01-01-1... 34 2.6 3 ( BX571898 ) Zebrafish DNA seq... |pid:none) Leishmania major strain Friedlin,... 57 2e-06 AM494972_448( AM494972 |pid:none) Leishmania brazilie...1( AK304700 |pid:none) Homo sapiens cDNA FLJ54257 complet... 47 0.002 AF165215_1( AF165215 |pid:none) Gallus gallus Sk-tropomoduli

Dicty_cDB: Contig-U13391-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 587_82( CP000587 |pid:none) Ostreococcus lucimarinus CCE9901 ... 43 0.004 AY092033_1( AY092033 |pid:none) Homo sapiens NALP3 interm...3015498109 Global-Ocean-Sampling_GS-35-01-01-1... 46 0.91 1 ( DU327579 ) 1098473610927 CHORI-243 Ovis aries ...018 2 ( AC188370 ) Glycine max clone gmp1-120k16, complete sequence. 50 0.058 1 ( ER548246 ) 1093016198016 Global-Ocean-Sampli... DKEY-258P11 in ... 38 0.97 3 ( EJ508572 ) 1095407031867 Global-Ocean-Sampling_GS-28-01-01-1... 40 1.0 2 ( E...R418890 ) 1092963689437 Global-Ocean-Sampling_GS-35-01-01-1... 36 1.1 3 ( CR450742 ) Zebrafish DNA sequence

International Multidisciplinary Microscopy Congress

CERN Document Server

Oral, Ahmet; Ozer, Mehmet; InterM; INTERM2013

2014-01-01

The International Multidisciplinary Microscopy Congress (INTERM2013) was organized on October 10-13, 2013. The aim of the congress was to bring together scientists from various branches to discuss the latest advances in the field of microscopy. The contents of the congress have been broadened to a more "interdisciplinary" scope, so as to allow all scientists working on related subjects to participate and present their work. These proceedings include 39 peer-reviewed technical papers, submitted by leading academic and research institutions from over 12 countries and representing some of the most cutting-edge research available. The 39 papers are grouped into the following sections: - Applications of Microscopy in the Physical Sciences - Applications of Microscopy in the Biological Sciences

Éditorial

OpenAIRE

Krajewski, Pascal

2017-01-01

L'idée de média en art est apparue dans la deuxième moitié du xxe siècle pour acter de l'hybridation des arts entre eux et de l'irruption des médias du quotidien, culturels puis numériques. La notion d'intermédia (outre ses concurrents : multi-, trans-, mixed, etc.) insistait justement sur les logiques de remédiations, de mélanges voire de fusions. Higgins faisait alors figure de farouche défenseur de cette conception des arts « impurs ». A-t-elle triomphé aujourd’hui ? La notion de « média »...

Measurement of DEM roughness using the local fractal dimension

OpenAIRE

Taud, Hind; Parrot, Jean-François

2008-01-01

Les relations entre les traits géomorphologiques et la rugosité de surface des Modèles Numériques de Terrain (MNT) ont été étudiées par l’intermédiaire de la géométrie fractale. La dimension fractale dans l’espace à trois dimensions est estimée localement sur la surface du MNT. Cette mesure se fait à l’aide d’une procédure dérivée de la technique du « comptage de boîtes ». Ce traitement a été appliqué sur deux zones tests choisies pour leurs différences lithologiques et tectoniques. La premiè...

Variations morphologiques de l’appareil nucléaire chez les ciliés Astomes Almophrya bivacuolata et A. mediovacuolata (Protozoa : Ciliophora endocommensaux d’oligochètes terricoles du Cameroun

Directory of Open Access Journals (Sweden)

Nana P.A.

2010-12-01

Full Text Available L’imprégnation argentique complétée par la coloration nucléaire de Feulgen et la coloration au DAPI nous ont permis d’étudier les variations morphologiques de l’appareil nucléaire chez deux espèces de ciliés Astomes, Almophrya bivacuolata (de Puytorac et Dragesco, 1968 et A. mediovacuolata (Ngassam, 1983 endocommensaux. Nous avons mis en évidence d’importantes digitations et la présence de bandes sombres dans la structure du macronoyau en “H” des petits types cellulaires ainsi que la présence de formes intermédiaires entre “H” et “X” dans ces deux espèces.

Elections régionales 2004 : jeux d'échelles entre local, régional et national. L'enseignement des cartes de France par canton

Directory of Open Access Journals (Sweden)

Michel Bussi

2004-03-01

Full Text Available Les élections de mars 2004 relèvent-elles principalement d'un enjeu national ou d'un enjeu régional ? Selon le modèle de "l'élection intermédiaire" de Jean-Luc Parodi, elles dépendraient avant tout d'un enjeu national. Mais depuis l'élaboration de ce modèle, les régions ont gagné en puissance et le débat sur la régionalisation gagné en consistance. Les échelles nationales et régionales ne sont pas les seules à l’oeuvre. Les cartes de ce dossier mettent également en évidence l'importance des e...

La regulación económica y la representación corporativa en la Argentina y el Brasil

Directory of Open Access Journals (Sweden)

Aníbal Pablo Jáuregui

2000-06-01

Full Text Available L'article présente le processus régulateur de l'Etat à l'égard des économies nationales du Brésil et de l'Argentine, en s'appuyant principalement sur le modèle des «conseils techniques», depuis le début du siècle et notamment après la crise économique mondiale de 1929. Parallèlement, en examinant le rôle du corporativisme dans chacun de ces pays, l'article analyse comment ces États ont entretenu des rapports avec plusieurs acteurs sociaux, surtout les entrepreneurs, par l'intermédiaire des associations de classe, afin de distribuer les recours économiques et politiques.

Design e crime

Directory of Open Access Journals (Sweden)

Hal Foster

2011-01-01

Full Text Available Neste artigo, Hal Foster nos narra o que ele chama da "vingança do capitalismo contra o pós-modernismo" por intermédio do design. Partindo do Art Nouveau, que nos anos 2000 voltou à moda como objeto de exposições e estudos, ele compara este estilo ao design total de nossos dias, tomando como exemplo principal o designer Bruce Mau. Do fordismo ao consumismo, as modulações que levaram à expansão de um tipo de design em detrimento da subjetividade são a base para a argumentação de Foster em favor das distinções que "dão margem de manobra à cultura".

Agricultural Production. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Gadd, Nick; Lucas, Michele

This publication contains the three communication skills units of the three levels of Support Materials for Agricultural Training (SMAT) in agricultural production: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her written and spoken communication skills needed to deal with…

Modeling category-level purchase timing with brand-level marketing variables

NARCIS (Netherlands)

D. Fok (Dennis); R. Paap (Richard)

2003-01-01

textabstractPurchase timing of households is usually modeled at the category level. Marketing efforts are however only available at the brand level. Hence, to describe category-level interpurchase times using marketing efforts one has to construct a category-level measure of marketing efforts from

Correlation between physics A-levels/A-levels and degree performance

Science.gov (United States)

Chadwick, Roy

1985-09-01

The author presents an analysis of 178 students who left Solihull Sixth form College between 1975 and 1981 to do a degree in physics (approximately one third) or engineering (approximately two thirds) at university or polytechnic. The first table is an analysis of physics A-level grade and degree performance; the second table an analysis of the points total for physics A-level plus maths A-level (five for A, four for B, etc.), against degree performances, and the final table an analysis of the points total for physics A-level plus maths A-level plus third A-level (again five for A, four for B, etc.), against degree performance.

Sea level report

International Nuclear Information System (INIS)

Schwartz, M.L.

1979-01-01

Study of Cenozoic Era sea levels shows a continual lowering of sea level through the Tertiary Period. This overall drop in sea level accompanied the Pleistocene Epoch glacio-eustatic fluctuations. The considerable change of Pleistocene Epoch sea level is most directly attributable to the glacio-eustatic factor, with a time span of 10 5 years and an amplitude or range of approximately 200 m. The lowering of sea level since the end of the Cretaceous Period is attributed to subsidence and mid-ocean ridges. The maximum rate for sea level change is 4 cm/y. At present, mean sea level is rising at about 3 to 4 mm/y. Glacio-eustacy and tectono-eustacy are the parameters for predicting sea level changes in the next 1 my. Glacio-eustatic sea level changes may be projected on the basis of the Milankovitch Theory. Predictions about tectono-eustatic sea level changes, however, involve predictions about future tectonic activity and are therefore somewhat difficult to make. Coastal erosion and sedimentation are affected by changes in sea level. Erosion rates for soft sediments may be as much as 50 m/y. The maximum sedimentation accumulation rate is 20 m/100 y

Investigations of chemical warfare agents and toxic industrial compounds with proton-transfer-reaction mass spectrometry for a real-time threat monitoring scenario.

Science.gov (United States)

Kassebacher, Thomas; Sulzer, Philipp; Jürschik, Simone; Hartungen, Eugen; Jordan, Alfons; Edtbauer, Achim; Feil, Stefan; Hanel, Gernot; Jaksch, Stefan; Märk, Lukas; Mayhew, Chris A; Märk, Tilmann D

2013-01-30

Security and protection against terrorist attacks are major issues in modern society. One especially challenging task is the monitoring and protection of air conditioning and heating systems of buildings against terrorist attacks with toxic chemicals. As existing technologies have low selectivity, long response times or insufficient sensitivity, there is a need for a novel approach such as we present here. We have analyzed various chemical warfare agents (CWAs) and/or toxic industrial compounds (TICs) and related compounds, namely phosgene, diphosgene, chloroacetone, chloroacetophenone, diisopropylaminoethanol, and triethyl phosphate, utilizing a high-resolution proton-transfer-reaction time-of-flight mass spectrometry (PTR-TOFMS) instrument with the objective of finding key product ions and their intensities, which will allow a low-resolution quadrupole mass spectrometry based PTR-MS system to be used with high confidence in the assignment of threat agents in the atmosphere. We obtained high accuracy PTR-TOFMS mass spectra of the six compounds under study at two different values for the reduced electric field in the drift tube (E/N). From these data we have compiled a table containing product ions, and isotopic and E/N ratios for highly selective threat compound detection with a compact and cost-effective quadrupole-based PTR-MS instrument. Furthermore, using chloroacetophenone (tear gas), we demonstrated that this instrument's response is highly linear in the concentration range of typical Acute Exposure Guideline Levels (AEGLs). On the basis of the presented results it is possible to develop a compact and cost-effective PTR-QMS instrument that monitors air supply systems and triggers an alarm as soon as the presence of a threat agent is detected. We hope that this real-time surveillance device will help to seriously improve safety and security in environments vulnerable to terrorist attacks with toxic chemicals. Copyright © 2012 John Wiley & Sons, Ltd.

Acceptance criteria for deposition of low-level and intermediate-level radiation levels radioactive wastes

International Nuclear Information System (INIS)

2002-09-01

This norm establishes the criteria for acceptance low and intermediate radiation level for safe deposition in repositories, for assuring the protection of workers, population and environment against the hazardous effects of the ionizing radiations. The criteria of this norm applies to the low and intermediate radiation levels

Level-3 Calorimetric Resolution available for the Level-1 and Level-2 CDF Triggers

CERN Document Server

Canepa, A.; Liu, T.; Cortiana, G.; Flanagan, G.; Frisch, H.; Krop, D.; Pilcher, C.; Rusu, V.; Cavaliere, V.; Greco, V.; Giannetti, P.; Piendibene, M.; Sartori, L.; Vidal, Miguel

2008-01-01

As the Tevatron luminosity increases sophisticated selections are required to be efficient in selecting rare events among a very huge background. To cope with this problem, CDF has pushed the offline calorimeter algorithm reconstruction resolution up to Level 2 and, when possible, even up to Level 1, increasing efficiency and, at the same time, keeping under control the rates. The CDF Run II Level 2 calorimeter trigger is implemented in hardware and is based on a simple algorithm that was used in Run I. This system has worked well for Run II at low luminosity. As the Tevatron instantaneous luminosity increases, the limitation due to this simple algorithm starts to become clear: some of the most important jet and MET (Missing ET) related triggers have large growth terms in cross section at higher luminosity. In this paper, we present an upgrade of the Level 2 Calorimeter system which makes the calorimeter trigger tower information available directly to a CPU allowing more sophisticated algorithms to be impleme...

Sea level change

Digital Repository Service at National Institute of Oceanography (India)

Church, J.A.; Clark, P.U.; Cazenave, A.; Gregory, J.M.; Jevrejeva, S.; Levermann, A.; Merrifield, M.A.; Milne, G.A.; Nerem, R.S.; Nunn, P.D.; Payne, A.J.; Pfeffer, W.T.; Stammer, D.; Unnikrishnan, A.S.

This chapter considers changes in global mean sea level, regional sea level, sea level extremes, and waves. Confidence in projections of global mean sea level rise has increased since the Fourth Assessment Report (AR4) because of the improved...

Agricultural Production. Numeracy. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Tully, Chris

This publication contains the three numeracy units of the three levels of Support Materials for Agricultural Training (SMAT) in agricultural production: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her numeracy skills needed to deal with agricultural production. SMAT materials…

Understanding low-level radioactive waste. National Low-Level Radioactive Waste Management Program

International Nuclear Information System (INIS)

1983-10-01

Chapters are devoted to: background and policymaking for low-level waste management; commercial low-level waste generation; Department of Energy low-level waste generation; low-level waste treatment; packaging and transportation; commercial low-level waste disposal; Department of Energy low-level waste disposal; Department of Energy low-level waste management program; and laws and regulations

'Level-level correlation and absorption in nuclear reactions'

International Nuclear Information System (INIS)

Hussein, M.S.

Level-level correlation (LLC) in nuclear reactions is discussed in general and it is shown that in the presence of LLC, N sub(μ) = Σ/g μa/ 2 > divided by gamma μ T tilde, where T tilde is the average absorption in the eigen channels [pt

Farmers as Employers. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Gadd, Nick; Lucas, Michele

This publication contains the three communication skills units of the three levels of Support Materials for Agricultural Training (SMAT) in the area of farmers as employers: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her written and spoken communication and numeracy skills…

Liquid level measurement in high level nuclear waste slurries

International Nuclear Information System (INIS)

Weeks, G.E.; Heckendorn, F.M.; Postles, R.L.

1990-01-01

Accurate liquid level measurement has been a difficult problem to solve for the Defense Waste Processing Facility (DWPF). The nuclear waste sludge tends to plug or degrade most commercially available liquid-level measurement sensors. A liquid-level measurement system that meets demanding accuracy requirements for the DWPF has been developed. The system uses a pneumatic 1:1 pressure repeater as a sensor and a computerized error correction system. 2 figs

Readability versus Leveling.

Science.gov (United States)

Fry, Edward

2002-01-01

Shows some similarities and differences between readability formulas and leveling procedures and reports some current large-scale uses of readability formulas. Presents a dictionary definition of readability and leveling, and a history and background of readability and leveling. Discusses what goes into determining readability and leveling scores.…

Green engineering of biomolecule-coated metallic silver nanoparticles and their potential cytotoxic activity against cancer cell lines

Science.gov (United States)

Prasannaraj, Govindaraj; Venkatachalam, Perumal

2017-06-01

This report describes the synthesis of metallic silver nanoparticles (AgNPs) using extracts of four medicinal plants (Aegle marmelos (A. marmelos), Alstonia scholaris (A. scholaris), Andrographis paniculata (A. paniculata) and Centella asiatica (C. asiatica)). The bio-conjugates were characterized by UV-visible spectroscopy, scanning electron microscopy-energy dispersive spectroscopy (SEM-EDS), Fourier transform infrared spectrometry (FTIR), x-ray diffraction (XRD) and zeta potential. This analysis confirmed that UV-Vis spectral peaks at 375 nm, 380 nm, 420 nm and 380 nm are corresponding to A. marmelos, A. scholaris, A. paniculata and C. asiatica mediated AgNPs, respectively. SEM images revealed that all the obtained four AgNPs are predominantly spherical, fibres and rectangle in shape with an average size of 36-97 nm. SEM-EDS and XRD analysis confirmed the presence of elemental AgNPs in crystalline form for all the four nanoparticle samples. The phytochemicals of various medicinal plant extracts with different functional groups were responsible for reduction of Ag+ to AgNPs, which act as capping and stabilizing agent. Among four types of AgNPs tested for anticancer activity, the Ap mediated AgNPs had shown enhanced activity against HepG2 cells (27.01 µg ml-1) and PC3 cells (32.15 µg ml-1).

Triglyceride level

Science.gov (United States)

... page: //medlineplus.gov/ency/article/003493.htm Triglyceride level To use the sharing features on this page, please enable JavaScript. The triglyceride level is a blood test to measure the amount ...

Modeling category-level purchase timing with brand-level marketing variables

OpenAIRE

Fok, D.; Paap, R.

2003-01-01

textabstractPurchase timing of households is usually modeled at the category level. Marketing efforts are however only available at the brand level. Hence, to describe category-level interpurchase times using marketing efforts one has to construct a category-level measure of marketing efforts from the marketing mix of individual brands. In this paper we discuss two standard approaches suggested in the literature to solve this problem, that is, using individual choice shares as weights to aver...

LevelMerge: Collaborative Game Level Editing by Merging Labeled Graphs

OpenAIRE

Santoni, Christian; Salvati, Gabriele; Tibaldo, Valentina; Pellacini, Fabio

2016-01-01

Game level editing is the process of constructing a full game level starting from 3D asset libraries, e.g. 3d models, textures, shaders, scripts. In level editing, designers define the look and behavior of the whole level by placing objects, assigning materials and lighting parameters, setting animations and physics properties and customizing the objects AI and behavior by editing scripts. The heterogeneity of the task usually translates to a workflow where a team of people, experts on separa...

Cortisol level

Science.gov (United States)

... enable JavaScript. The cortisol blood test measures the level of cortisol in the blood. Cortisol is a ... in the morning. This is important, because cortisol level varies throughout the day. You may be asked ...

Synthèse énantiosélective du Monate de méthyle C et réaction aldol organocatalysée d'aldéhydes a,b-insaturés : application à la synthèse de dérivés de la Goniothalamine

OpenAIRE

van Innis, Livia

2007-01-01

Le Monate de méthyle C est produit par Pseudomonas Fluorescens et possède des propriétés antibactériennes intéressantes envers les bactéries Gram-positives. Afin de permettre un accès efficace au noyau pyrannique du (+)-Monate de méthyle C, une méthodologie impliquant une séquence ène-IMSC a été mise au point. L'introduction de la chaîne latérale axiale a été effectuée par une réaction d'allylation asymétrique suivie d'une métathèse croisée sélective. Enfin, une réduction de la cétone intermé...

Formações do argumento autoritário e ditatorial do século XIX ao XX: da teologia política de Donoso Cortés e Jaime Balmes a Carl Schmitt

Directory of Open Access Journals (Sweden)

Roberto Bueno

2013-05-01

Full Text Available Este artigo analisa alguns dos compromissos teóricos do conservadorismo no século XIX espanhol cujo marcado enraizamento teológico católico (Donoso Cortés e Jaime Balmes sugerimos manter forte ligação com o autoritarismo. Este artigo analisa os primeiros passos conceituais realizados por Donoso e Balmes e como este pode ter sido uma das bases de apoio para a construção teórica que permitiu que o século XX desenvolvesse sólidas teorias autoritárias, especialmente por intermédio da reinterpretação de Donoso realizada por Carl Schmitt que promoveu a reconstrução da teoria da ditadura.

Promoting system-level learning from project-level lessons

Energy Technology Data Exchange (ETDEWEB)

Jong, Amos A. de, E-mail: amosdejong@gmail.com [Innovation Management, Utrecht (Netherlands); Runhaar, Hens A.C., E-mail: h.a.c.runhaar@uu.nl [Section of Environmental Governance, Utrecht University, Utrecht (Netherlands); Runhaar, Piety R., E-mail: piety.runhaar@wur.nl [Organisational Psychology and Human Resource Development, University of Twente, Enschede (Netherlands); Kolhoff, Arend J., E-mail: Akolhoff@eia.nl [The Netherlands Commission for Environmental Assessment, Utrecht (Netherlands); Driessen, Peter P.J., E-mail: p.driessen@geo.uu.nl [Department of Innovation and Environment Sciences, Utrecht University, Utrecht (Netherlands)

2012-02-15

A growing number of low and middle income nations (LMCs) have adopted some sort of system for environmental impact assessment (EIA). However, generally many of these EIA systems are characterised by a low performance in terms of timely information dissemination, monitoring and enforcement after licencing. Donor actors (such as the World Bank) have attempted to contribute to a higher performance of EIA systems in LMCs by intervening at two levels: the project level (e.g. by providing scoping advice or EIS quality review) and the system level (e.g. by advising on EIA legislation or by capacity building). The aims of these interventions are environmental protection in concrete cases and enforcing the institutionalisation of environmental protection, respectively. Learning by actors involved is an important condition for realising these aims. A relatively underexplored form of learning concerns learning at EIA system-level via project level donor interventions. This 'indirect' learning potentially results in system changes that better fit the specific context(s) and hence contribute to higher performances. Our exploratory research in Ghana and the Maldives shows that thus far, 'indirect' learning only occurs incidentally and that donors play a modest role in promoting it. Barriers to indirect learning are related to the institutional context rather than to individual characteristics. Moreover, 'indirect' learning seems to flourish best in large projects where donors achieved a position of influence that they can use to evoke reflection upon system malfunctions. In order to enhance learning at all levels donors should thereby present the outcomes of the intervention elaborately (i.e. discuss the outcomes with a large audience), include practical suggestions about post-EIS activities such as monitoring procedures and enforcement options and stimulate the use of their advisory reports to generate organisational memory and ensure a better

Promoting system-level learning from project-level lessons

International Nuclear Information System (INIS)

Jong, Amos A. de; Runhaar, Hens A.C.; Runhaar, Piety R.; Kolhoff, Arend J.; Driessen, Peter P.J.

2012-01-01

A growing number of low and middle income nations (LMCs) have adopted some sort of system for environmental impact assessment (EIA). However, generally many of these EIA systems are characterised by a low performance in terms of timely information dissemination, monitoring and enforcement after licencing. Donor actors (such as the World Bank) have attempted to contribute to a higher performance of EIA systems in LMCs by intervening at two levels: the project level (e.g. by providing scoping advice or EIS quality review) and the system level (e.g. by advising on EIA legislation or by capacity building). The aims of these interventions are environmental protection in concrete cases and enforcing the institutionalisation of environmental protection, respectively. Learning by actors involved is an important condition for realising these aims. A relatively underexplored form of learning concerns learning at EIA system-level via project level donor interventions. This ‘indirect’ learning potentially results in system changes that better fit the specific context(s) and hence contribute to higher performances. Our exploratory research in Ghana and the Maldives shows that thus far, ‘indirect’ learning only occurs incidentally and that donors play a modest role in promoting it. Barriers to indirect learning are related to the institutional context rather than to individual characteristics. Moreover, ‘indirect’ learning seems to flourish best in large projects where donors achieved a position of influence that they can use to evoke reflection upon system malfunctions. In order to enhance learning at all levels donors should thereby present the outcomes of the intervention elaborately (i.e. discuss the outcomes with a large audience), include practical suggestions about post-EIS activities such as monitoring procedures and enforcement options and stimulate the use of their advisory reports to generate organisational memory and ensure a better information

High-level verification

CERN Document Server

Lerner, Sorin; Kundu, Sudipta

2011-01-01

Given the growing size and heterogeneity of Systems on Chip (SOC), the design process from initial specification to chip fabrication has become increasingly complex. This growing complexity provides incentive for designers to use high-level languages such as C, SystemC, and SystemVerilog for system-level design. While a major goal of these high-level languages is to enable verification at a higher level of abstraction, allowing early exploration of system-level designs, the focus so far for validation purposes has been on traditional testing techniques such as random testing and scenario-based

Multi-Level Model

Directory of Open Access Journals (Sweden)

Constanta Nicoleta BODEA

2008-01-01

Full Text Available Is an original paper, which contains a hierarchical model with three levels, for determining the linearized non-homogeneous and homogeneous credibility premiums at company level, at sector level and at contract level, founded on the relevant covariance relations between the risk premium, the observations and the weighted averages. We give a rather explicit description of the input data for the multi- level hierarchical model used, only to show that in practical situations, there will always be enough data to apply credibility theory to a real insurance portfolio.

The association between estimated average glucose levels and fasting plasma glucose levels

Directory of Open Access Journals (Sweden)

Giray Bozkaya

2010-01-01

Full Text Available OBJECTIVE: The level of hemoglobin A1c (HbA1c, also known as glycated hemoglobin, determines how well a patient's blood glucose level has been controlled over the previous 8-12 weeks. HbA1c levels help patients and doctors understand whether a particular diabetes treatment is working and whether adjustments need to be made to the treatment. Because the HbA1c level is a marker of blood glucose for the previous 120 days, average blood glucose levels can be estimated using HbA1c levels. Our aim in the present study was to investigate the relationship between estimated average glucose levels, as calculated by HbA1c levels, and fasting plasma glucose levels. METHODS: The fasting plasma glucose levels of 3891 diabetic patient samples (1497 male, 2394 female were obtained from the laboratory information system used for HbA1c testing by the Department of Internal Medicine at the Izmir Bozyaka Training and Research Hospital in Turkey. These samples were selected from patient samples that had hemoglobin levels between 12 and 16 g/dL. The estimated glucose levels were calculated using the following formula: 28.7 x HbA1c - 46.7. Glucose and HbA1c levels were determined using hexokinase and high performance liquid chromatography (HPLC methods, respectively. RESULTS: A strong positive correlation between fasting plasma glucose levels and estimated average blood glucose levels (r=0.757, p<0.05 was observed. The difference was statistically significant. CONCLUSION: Reporting the estimated average glucose level together with the HbA1c level is believed to assist patients and doctors determine the effectiveness of blood glucose control measures.

Correlations of hair level with salivary level in cortisol and cortisone.

Science.gov (United States)

Zhang, Quan; Chen, Zheng; Chen, Shenghuo; Yu, Tian; Wang, Juxia; Wang, Weiwen; Deng, Huihua

2018-01-15

Contrary findings exist on the consistency between hair cortisol and salivary cortisol in assessing the basal activity of the hypothalamic-pituitary-adrenal (HPA) axis. The mismatches in temporal characteristic and the indices of hair and salivary cortisol might be potential reasons for the inconsistency. The aim of this study was to investigate the consistency between hair and salivary levels in cortisol and cortisone by directly examining the correlation between hair level and salivary level with different temporal characteristics (acute, short-term and long-term levels) and reflecting different HPA functions (basal level and reactivity level) in the well-matched time span. A longitudinal design within a five-week period was conducted in a sample of 44 healthy female college students (mean age: 18.8yrs.; age range: 18-22yrs) of Han nationality with the exclusion criteria, such as use of oral contraceptives or glucocorticoids and bleached hairs, etc. Four saliva samples (awakening, awakening+30min, awakening+4h and awakening+9h) were collected from an identical participant on three separate days with an interval of one week and 1-cm hair segment nearest to the scalp was collected two weeks later after completing saliva collection. Cortisol and cortisone in saliva and hair were simultaneously measured with high performance liquid chromatography tandem mass spectrometry. There were significantly moderate correlations in cortisol and cortisone between hair level and three-day average of single-day salivary level, but low to moderate correlations between hair level and single-point and single-day salivary level. Hair cortisol and cortisone were unrelated to single-day level and three-day average of diurnal slope and cortisol awakening response of salivary cortisol and cortisone, respectively. The considerable consistency between hair level and long-term salivary level in cortisol and cortisone implies that cortisol and cortisone in hair are valid biomarkers of

Occupational Health and Safety. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Gadd, Nick; Lucas, Michele

This publication contains the three communication skills units of the three levels of Support Materials for Agricultural Training (SMAT) in the area of occupational health and safety: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her written and spoken communication skills needed…

Farm Management and Leadership. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Gadd, Nick; Lucas, Michele

This publication contains the three communication skills units of the three levels of Support Materials for Agricultural Training (SMAT) in farm management and leadership: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner with the reading, writing, and spoken communication skills needed to deal with…

Farmers as Employers. Numeracy. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Tully, Chris

This publication contains the three numeracy units of the three levels of Support Materials for Agricultural Training (SMAT) in the area of farmers as employers: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her numeracy skills needed to deal with employment of agriculture…

Intestinal digestibility of protein of adapted forages and by-products in Brazilian Northeast by three-steps technique Digestão intestinal da proteína de forrageiras e co-produtos da agroindústria produzidos no Nordeste Brasileiro por intermédio da técnica de três estágios

Directory of Open Access Journals (Sweden)

José Gilson Lousada Regadas Filho

2010-06-01

Full Text Available It was aimed to estimate the intestinal digestibility (ID of rumen-undegradable protein (RUDP of several feeds by a three-steps procedure. The evaluated forages were algaroba (Prosopis juliflora, canafístula (Pithecellobium multiflorum, flor-de-seda (Calotropis procera, jitirana (Ipomea sp., juazeiro (Ziziphus joazeiro, mata-pasto (Senna obtusifolia, sabiá (Mimosa caesalpiniaefolia Benth, palma gigante (Opuntia ficus indica and xique-xique (Cereus gounellei, and the agroindustry byproducts were pineapple (Ananas comosus L., barbados cherry (Malpighia emarginata, cashew (Anacardium occidentale, coconut (Cocos nucifera L., melon (Cucumis melo, passion fruit (Passiflora eduli, grape (Vitis labrusca and anatto seeds (Bixa orellana L.. The feeds were incubated in rumen during 16 hours to determine the RUDP, and the residue was submitted to the digestion with pepsin solution during one hour, and pancreatic solution during 24 hours at 38ºC, those residues were analyzed for total nitrogen. The estimative of RUDP forage ranged from 13.37 to 83.6%, and the RUDP by-product ranged from 39.14 to 89.06%. The intestinal digestion of RUDP of the forages ranged from 26.09 to 80.68%, while for by-products varied from 22.26 to 76.82%. The sabiá was the forage that presented the highest intestinal digestibility and digestive rumen-undegradable protein (RUDPd, and the flor-de-seda, the lowest digestibility; while for by-products, melon and cashew presented, respectively, the highest values for DI and RUDP. The coconut presented the lowest values for ID and RUDPd. Although, some formulation systems of diets for ruminant consider that the RUDP present constant ID, the data obtained in this work suggest variation among the different feeds.A pesquisa objetivou estimar a digestibilidade intestinal (DI da proteína não-degradada no rúmen (PNDR de alimentos por intermédio da técnica de três estágios. As forragens avaliadas foram algaroba (Prosopis juliflora

Comments About a Chameleon Theory: Level I/Level II.

Science.gov (United States)

Horn, John; Stankov, Lazar

1982-01-01

Jensen's ideas about two levels of intellectual abilities are criticized as being oversimplified. More than two levels of intellectual abilities and relationships between variables reflecting more than racial and socioeconomic status (SES) differences are suggested, arguing that Jensen's statements about race and SES differences are not properly…

Low-level toxicity of chemicals: No acceptable levels?

Directory of Open Access Journals (Sweden)

Bruce P Lanphear

2017-12-01

Full Text Available Over the past 3 decades, in a series of studies on some of the most extensively studied toxic chemicals and pollutants, scientists have found that the amount of toxic chemical linked with the development of a disease or death-which is central to determining "safe" or "hazardous" levels-is proportionately greater at the lowest dose or levels of exposure. These results, which are contrary to the way the United States Environmental Protection Agency (EPA and other regulatory agencies assess the risk of chemicals, indicate that we have underestimated the impact of toxic chemicals on death and disease. If widely disseminated chemicals and pollutants-like radon, lead, airborne particles, asbestos, tobacco, and benzene-do not exhibit a threshold and are proportionately more toxic at the lowest levels of exposure, we will need to achieve near-zero exposures to protect public health.

Equivalence of velocity-level and acceleration-level redundancy-resolution of manipulators

International Nuclear Information System (INIS)

Cai Binghuang; Zhang Yunong

2009-01-01

The equivalence of velocity-level and acceleration-level redundancy resolution of robot manipulators is investigated in this Letter. Theoretical analysis based on gradient-descent method and computer simulations based on PUMA560 robot manipulator both demonstrate the equivalence of redundancy-resolution schemes at different levels.

Tiltmeter leveling mechanism

Science.gov (United States)

Hunter, Steven L.; Boro, Carl O.; Farris, Alvis

2002-01-01

A tiltmeter device having a pair of orthogonally disposed tilt sensors that are levelable within an inner housing containing the sensors. An outer housing can be rotated to level at least one of the sensor pair while the inner housing can be rotated to level the other sensor of the pair. The sensors are typically rotated up to about plus or minus 100 degrees. The device is effective for measuring tilts in a wide range of angles of inclination of wells and can be employed to level a platform containing a third sensor.

Level best : drilling seasonal load leveling business case : final report

International Nuclear Information System (INIS)

2005-10-01

Drilling and seismic costs in Western Canada are as much as 35 per cent higher during winter months. Favourable commodity pricing has prompted aggressive expansion of drilling programs in the Western Canada Sedimentary Basin (WCSB), and capacity is becoming a significant issue. Many operators are turning to load leveling in order to secure rigs and crew availability. However, many operators still adhere to the traditional view that drilling of oil and gas wells is best accomplished during the winter. The purpose of the project discussed in this paper was to develop and present a business case for greater seasonal load leveling in the WCSB and spreading it more evenly throughout the year. Using calendar year quarters, publicly available data for a 5 year period from 2000-2004 for drilling activity, safety, weather, and environmental restrictions were examined. A list of candidate fields with high levels of activity and a good representation of well depths was selected. Well cost and rig data from 14 different companies was used. A variety of industry participants, drilling contractors, load leveling technology suppliers and provincial agencies were consulted to supplement well cost analyses. The financial impacts of load leveling were examined. Benefits included lower well costs; advanced production; avoided rig construction; reduced incident rates; and reduced turnover. While the focus of the business case for load leveling was based on hard cost data, many indirect benefits were identified, including First Nations sustainability and greater job security and comfort for workers. Various policies and incentives that encouraged load leveling in British Columbia and Alberta were reviewed. 57 figs

System level ESD protection

CERN Document Server

Vashchenko, Vladislav

2014-01-01

This book addresses key aspects of analog integrated circuits and systems design related to system level electrostatic discharge (ESD) protection.  It is an invaluable reference for anyone developing systems-on-chip (SoC) and systems-on-package (SoP), integrated with system-level ESD protection. The book focuses on both the design of semiconductor integrated circuit (IC) components with embedded, on-chip system level protection and IC-system co-design. The readers will be enabled to bring the system level ESD protection solutions to the level of integrated circuits, thereby reducing or completely eliminating the need for additional, discrete components on the printed circuit board (PCB) and meeting system-level ESD requirements. The authors take a systematic approach, based on IC-system ESD protection co-design. A detailed description of the available IC-level ESD testing methods is provided, together with a discussion of the correlation between IC-level and system-level ESD testing methods. The IC-level ESD...

Beyond level planarity

NARCIS (Netherlands)

Angelini, P.; Da Lozzo, G.; Di Battista, G.; Frati, F.; Patrignani, M.; Rutter, I.; Hu, Y.; Nöllenburg, M.

2016-01-01

In this paper we settle the computational complexity of two open problems related to the extension of the notion of level planarity to surfaces different from the plane. Namely, we show that the problems of testing the existence of a level embedding of a level graph on the surface of the rolling

Hybrid Fusion for Biometrics: Combining Score-level and Decision-level Fusion

NARCIS (Netherlands)

Tao, Q.; Veldhuis, Raymond N.J.

2008-01-01

A general framework of fusion at decision level, which works on ROCs instead of matching scores, is investigated. Under this framework, we further propose a hybrid fusion method, which combines the score-level and decision-level fusions, taking advantage of both fusion modes. The hybrid fusion

How Team-Level and Individual-Level Conflict Influences Team Commitment: A Multilevel Investigation

Science.gov (United States)

Lee, Sanghyun; Kwon, Seungwoo; Shin, Shung J.; Kim, MinSoo; Park, In-Jo

2018-01-01

We investigate how two different types of conflict (task conflict and relationship conflict) at two different levels (individual-level and team-level) influence individual team commitment. The analysis was conducted using data we collected from 193 employees in 31 branch offices of a Korean commercial bank. The relationships at multiple levels were tested using hierarchical linear modeling (HLM). The results showed that individual-level relationship conflict was negatively related to team commitment while individual-level task conflict was not. In addition, both team-level task and relationship conflict were negatively associated with team commitment. Finally, only team-level relationship conflict significantly moderated the relationship between individual-level relationship conflict and team commitment. We further derive theoretical implications of these findings. PMID:29387033

How Team-Level and Individual-Level Conflict Influences Team Commitment: A Multilevel Investigation

Directory of Open Access Journals (Sweden)

Sanghyun Lee

2018-01-01

Full Text Available We investigate how two different types of conflict (task conflict and relationship conflict at two different levels (individual-level and team-level influence individual team commitment. The analysis was conducted using data we collected from 193 employees in 31 branch offices of a Korean commercial bank. The relationships at multiple levels were tested using hierarchical linear modeling (HLM. The results showed that individual-level relationship conflict was negatively related to team commitment while individual-level task conflict was not. In addition, both team-level task and relationship conflict were negatively associated with team commitment. Finally, only team-level relationship conflict significantly moderated the relationship between individual-level relationship conflict and team commitment. We further derive theoretical implications of these findings.

Data analysis at Level-1 Trigger level

CERN Document Server

Wittmann, Johannes; Aradi, Gregor; Bergauer, Herbert; Jeitler, Manfred; Wulz, Claudia; Apanasevich, Leonard; Winer, Brian; Puigh, Darren Michael

2017-01-01

With ever increasing luminosity at the LHC, optimum online data selection is getting more and more important. While in the case of some experiments (LHCb and ALICE) this task is being completely transferred to computer farms, the others - ATLAS and CMS - will not be able to do this in the medium-term future for technological, detector-related reasons. Therefore, these experiments pursue the complementary approach of migrating more and more of the offline and High-Level Trigger intelligence into the trigger electronics. This paper illustrates how the Level-1 Trigger of the CMS experiment and in particular its concluding stage, the Global Trigger, take up this challenge.

Participation et conflits : l’enjeu des espaces intermédiaires. Conflits socio-spatiaux à Berlin et Saint-Denis

Directory of Open Access Journals (Sweden)

Élise Roche

2011-12-01

Full Text Available La participation institutionnelle est souvent présentée comme un espace de débat à une échelle très localisée ; on lui reproche souvent le manque d’enjeux et d’impact qu’elle peut comporter pour les projets urbains. En postulant que ces dispositifs naissent de conflits micro-locaux, nous essaierons d’interroger en quoi ce processus reflète au contraire des enjeux sociaux importants qui se jouent à l’échelle de quartiers. Ce questionnement s’appuiera notamment sur l’hypothèse que l’objet territorial de la participation masque bien souvent des tensions sociales, et donc des conflits d’ordre socio-spatiaux. En analysant deux conflits locaux de gestion urbaine, à Berlin et à Saint-Denis, nous analyserons l’articulation entre ceux-ci et les processus de participation locaux. Les quartiers en marge en constituent un bon cadre d’étude par les processus de ségrégation qui s’y exercent.Die Bürgerbeteiligung wird oft als ein Aktionsfeld ohne politische Wirkunskraft gesehen, in welchem nur lokale Themen behandelt werden; die Bürgerbeteiligung sei nicht fähig die Stadtplanung zu ändern. Das politische Engagement der Bürgerinnen und Bürger erweist sich hingegen als sehr wichtig, wenn man Konflikte der institutionellen Bürgerbeteiligung betrachtet, die sich auf einer mikro-geographischen Ebene abspielen. Die territoriale Verankerung der Bürgerbeteiligung tendiert allerdings dazu, die soziale Komponente der Konflikte zu verdecken. Der vorliegende Artikel untersucht, wie lokale Konflikte über Stadtplanung und -organisation in Berlin und Saint-Denis mit lokalen partizipativen Prozessen angegangen werden könnten. Stadtteile mit besonderem Entwicklungsbedarf wie Stadtrandgebiete, die von Stadterneuerung, Gentrifizierungs- sowie Segregationsprozessen betroffen sind, gelten hierfür als geeignete Untersuchungsgegenstände.

Levels of safety

International Nuclear Information System (INIS)

Povyakalo, A.A.

1996-01-01

When speaking about danger of catastrophe, it is the first level of danger. Its absence is the first level of safety. When speaking about danger of danger of catastrophe, it is the second level of danger. Its absence is the second level of safety. The paper proposes the way to formalize these ideas and use formal models to construct the states-and-event scale for a given object. The proposed approach can be applied to objects of different nature. The states-and-events scale may be used for transformation of initial objectives state-and-transitions graph to reduce bad classes of states

A School-Level Proxy Measure for Individual-level Poverty Using School-Level Eligibility for Free and Reduced-Price Meals

Science.gov (United States)

Day, Sophia E.; Hinterland, Kinjia; Myers, Christa; Gupta, Leena; Harris, Tiffany G.; Konty, Kevin J.

2016-01-01

Background: Socioeconomic status (SES) impacts health outcomes. The Youth Risk Behavior Survey (YRBS), like many school-based data sources, lacks individual-level poverty information. We propose using school-level percentages of student eligibility for free/reduced-price meals (%FRPM) as a proxy for individual-level poverty. Methods: Using the New…

Viabilidade econômica de estocagem de alevinos de carpa comum (Cyprinus Carpio Var. Specularis no inverno em alta densidade

Directory of Open Access Journals (Sweden)

Graeff Álvaro

2001-01-01

Full Text Available O objetivo desta pesquisa foi estudar o efeito econômico de povoamento de alevinos I de carpa comum (Cyprinus carpio L., no inverno em alta densidade, com suplementação artificial e adubação química. O delineamento foi inteiramente casualizado com quatro tratamentos (5; 10; 15 e 20 peixes/m² e nove repetições. Os peixes foram estocados com peso e comprimento médios de 0,48 g e 3,15 cm, respectivamente, em todos tratamentos, por 45 dias de idade. As dietas foram formuladas com 27% de PB e 2925 kcal/kg de ração, sendo fornecidas diariamente, em duas vezes, na quantidade de 3% do peso vivo. O comportamento das variáveis explicativas em função dos tratamentos foi estudado por intermédio da análise de regressão. Os resultados para o comprimento e peso médio final nas densidades de 5; 10; 15 e 20 foram 8,67; 8,06; 7,81 e 7,47 cm e 3,64; 2,80; 2,31 e 2,25 g, respectivamente. O comportamento do peso em função das densidades estudadas é descrito pela equação de regressão quadrática Y= 4,41 - 0,29 X + 0,0077X² . O comportamento do comprimento e da conversão alimentar, em função das densidades, é explicado por regressão linear, por intermédio das equações Y= 5,83 - 0,077X e Y= 0,9978 + 0,0844X, respectivamente. A sobrevivência foi de 98,41; 97,61; 97,35 e 97,21%, respectivamente, nas densidades de 5 a 20. Em condições similares, pode-se recomendar todas as densidades estudadas e, economicamente, a lucratividade da atividade é crescente com o aumento da densidade, havendo diminuição do custo médio ou unitário.

Translation of a High-Level Temporal Model into Lower Level Models: Impact of Modelling at Different Description Levels

DEFF Research Database (Denmark)

Kraft, Peter; Sørensen, Jens Otto

2001-01-01

given types of properties, and examine how descriptions on higher levels translate into descriptions on lower levels. Our example looks at temporal properties where the information is concerned with the existence in time. In a high level temporal model with information kept in a three-dimensional space...... the existences in time can be mapped precisely and consistently securing a consistent handling of the temporal properties. We translate the high level temporal model into an entity-relationship model, with the information in a two-dimensional graph, and finally we look at the translations into relational...... and other textual models. We also consider the aptness of models that include procedural mechanisms such as active and object databases...

Farm Management and Leadership. Numeracy. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Gadd, Nick; Lucas, Michele

This publication contains the three numeracy units of the three levels of Support Materials for Agricultural Training (SMAT) in farm management and leadership: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her numeracy skills needed to deal with farm management. SMAT materials can…

Occupational Health and Safety. Numeracy. Level 1. Level 2. Level 3. Support Materials for Agricultural Training.

Science.gov (United States)

Batman, Kangan; Tully, Chris

This publication contains the three numeracy units of the three levels of Support Materials for Agricultural Training (SMAT) in the area of occupational health and safety: Level 1 (starting), 2 (continuing), and 3 (completing). The units are designed to help the learner improve his or her numeracy skills needed to deal with occupational safety and…

Multiple Level Crowding: Crowding at the Object Parts Level and at the Object Configural level.

Science.gov (United States)

Kimchi, Ruth; Pirkner, Yossef

2015-01-01

In crowding, identification of a peripheral target in the presence of nearby flankers is worse than when the target appears alone. Prevailing theories hold that crowding occurs because of integration or "pooling" of low-level features at a single, relatively early stage of visual processing. Recent studies suggest that crowding can occur also between high-level object representations. The most relevant findings come from studies with faces and may be specific to faces. We examined whether crowding can occur at the object configural level in addition to part-level crowding, using nonface objects. Target (a disconnected square or diamond made of four elements) identification was measured at varying eccentricities. The flankers were similar either to the target parts or to the target configuration. The results showed crowding in both cases: Flankers interfered with target identification such that identification accuracy decreased with an increase in eccentricity, and no interference was observed at the fovea. Crowding by object parts, however, was weaker and had smaller spatial extent than crowding by object configurations; we related this finding to the relationship between crowding and perceptual organization. These results provide strong evidence that crowding occurs not only between object parts but also between configural representations of objects. © The Author(s) 2015.

Serum Levels of Progranulin Do Not Reflect Cerebrospinal Fluid Levels in Neurodegenerative Disease.

Science.gov (United States)

Wilke, Carlo; Gillardon, Frank; Deuschle, Christian; Dubois, Evelyn; Hobert, Markus A; Müller vom Hagen, Jennifer; Krüger, Stefanie; Biskup, Saskia; Blauwendraat, Cornelis; Hruscha, Michael; Kaeser, Stephan A; Heutink, Peter; Maetzler, Walter; Synofzik, Matthis

2016-01-01

Altered progranulin levels play a major role in neurodegenerative diseases, like Alzheimer's dementia (AD), frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS), even in the absence of GRN mutations. Increasing progranulin levels could hereby provide a novel treatment strategy. However, knowledge on progranulin regulation in neurodegenerative diseases remains limited. We here demonstrate that cerebrospinal fluid progranulin levels do not correlate with its serum levels in AD, FTD and ALS, indicating a differential regulation of its central and peripheral levels in neurodegeneration. Blood progranulin levels thus do not reliably predict central nervous progranulin levels and their response to future progranulin-increasing therapeutics.

Fission level densities

International Nuclear Information System (INIS)

Maslov, V.M.

1998-01-01

Fission level densities (or fissioning nucleus level densities at fission saddle deformations) are required for statistical model calculations of actinide fission cross sections. Back-shifted Fermi-Gas Model, Constant Temperature Model and Generalized Superfluid Model (GSM) are widely used for the description of level densities at stable deformations. These models provide approximately identical level density description at excitations close to the neutron binding energy. It is at low excitation energies that they are discrepant, while this energy region is crucial for fission cross section calculations. A drawback of back-shifted Fermi gas model and traditional constant temperature model approaches is that it is difficult to include in a consistent way pair correlations, collective effects and shell effects. Pair, shell and collective properties of nucleus do not reduce just to the renormalization of level density parameter a, but influence the energy dependence of level densities. These effects turn out to be important because they seem to depend upon deformation of either equilibrium or saddle-point. These effects are easily introduced within GSM approach. Fission barriers are another key ingredients involved in the fission cross section calculations. Fission level density and barrier parameters are strongly interdependent. This is the reason for including fission barrier parameters along with the fission level densities in the Starter File. The recommended file is maslov.dat - fission barrier parameters. Recent version of actinide fission barrier data obtained in Obninsk (obninsk.dat) should only be considered as a guide for selection of initial parameters. These data are included in the Starter File, together with the fission barrier parameters recommended by CNDC (beijing.dat), for completeness. (author)

Water level indicator

International Nuclear Information System (INIS)

Murase, Michio; Araki, Hidefumi.

1996-01-01

A difference of pressure between a standard pressure conduit in communication with a gas phase of a reactor pressure vessel and a water level pressure conduit in communication with a liquid phase of the pressure vessel is detected by a pressure difference gage. A communication pipe and a standard level vessel are disposed between the pressure vessel and the standard pressure conduit, and a standard liquid surface on the side of the standard pressure conduit is formed in the standard level vessel. A gas releaser is disposed to the gas phase portion of the standard level vessel. The gas releaser equipment is constituted by a porous material, a permeation membrane and a gas exhaustion hole. The gas phase of the standard level vessel is divided by a partition plate into a first gas phase being in contact with a connection portion with the communication pipe and a second gas phase in contact with the gas releaser. A gas flow channel hole and a condensate descending hole are disposed to the partition plate. Since incondensible gases accumulated to the standard level vessel are effectively exhausted, the incondensible gases are prevented from being dissolved into liquid. (I.N.)

Inferring individual-level processes from population-level patterns in cultural evolution

Science.gov (United States)

Wilder, Bryan

2017-01-01

Our species is characterized by a great degree of cultural variation, both within and between populations. Understanding how group-level patterns of culture emerge from individual-level behaviour is a long-standing question in the biological and social sciences. We develop a simulation model capturing demographic and cultural dynamics relevant to human cultural evolution, focusing on the interface between population-level patterns and individual-level processes. The model tracks the distribution of variants of cultural traits across individuals in a population over time, conditioned on different pathways for the transmission of information between individuals. From these data, we obtain theoretical expectations for a range of statistics commonly used to capture population-level characteristics (e.g. the degree of cultural diversity). Consistent with previous theoretical work, our results show that the patterns observed at the level of groups are rooted in the interplay between the transmission pathways and the age structure of the population. We also explore whether, and under what conditions, the different pathways can be distinguished based on their group-level signatures, in an effort to establish theoretical limits to inference. Our results show that the temporal dynamic of cultural change over time retains a stronger signature than the cultural composition of the population at a specific point in time. Overall, the results suggest a shift in focus from identifying the one individual-level process that likely produced the observed data to excluding those that likely did not. We conclude by discussing the implications for empirical studies of human cultural evolution. PMID:28989786

Inferring individual-level processes from population-level patterns in cultural evolution.

Science.gov (United States)

Kandler, Anne; Wilder, Bryan; Fortunato, Laura

2017-09-01

Our species is characterized by a great degree of cultural variation, both within and between populations. Understanding how group-level patterns of culture emerge from individual-level behaviour is a long-standing question in the biological and social sciences. We develop a simulation model capturing demographic and cultural dynamics relevant to human cultural evolution, focusing on the interface between population-level patterns and individual-level processes. The model tracks the distribution of variants of cultural traits across individuals in a population over time, conditioned on different pathways for the transmission of information between individuals. From these data, we obtain theoretical expectations for a range of statistics commonly used to capture population-level characteristics (e.g. the degree of cultural diversity). Consistent with previous theoretical work, our results show that the patterns observed at the level of groups are rooted in the interplay between the transmission pathways and the age structure of the population. We also explore whether, and under what conditions, the different pathways can be distinguished based on their group-level signatures, in an effort to establish theoretical limits to inference. Our results show that the temporal dynamic of cultural change over time retains a stronger signature than the cultural composition of the population at a specific point in time. Overall, the results suggest a shift in focus from identifying the one individual-level process that likely produced the observed data to excluding those that likely did not. We conclude by discussing the implications for empirical studies of human cultural evolution.

Emotion-driven level generation

OpenAIRE

Togelius, Julian; Yannakakis, Georgios N.

2016-01-01

This chapter examines the relationship between emotions and level generation. Grounded in the experience-driven procedural content generation framework we focus on levels and introduce a taxonomy of approaches for emotion-driven level generation. We then review four characteristic level generators of our earlier work that exemplify each one of the approaches introduced. We conclude the chapter with our vision on the future of emotion-driven level generation.

Switching between global and local levels: the level repetition effect and its hemispheric asymmetry

Science.gov (United States)

Kéïta, Luc; Bedoin, Nathalie; Burack, Jacob A.; Lepore, Franco

2014-01-01

The global level of hierarchical stimuli (Navon’s stimuli) is typically processed quicker and better than the local level; further differential hemispheric dominance is described for local (left hemisphere, LH) and global (right hemisphere, RH) processing. However, neuroimaging and behavioral data indicate that stimulus category (letter or object) could modulate the hemispheric asymmetry for the local level processing. Besides, when the targets are unpredictably displayed at the global or local level, the participant has to switch between levels, and the magnitude of the switch cost increases with the number of repeated-level trials preceding the switch. The hemispheric asymmetries associated with level switching is an unresolved issue. LH areas may be involved in carrying over the target level information in case of level repetition. These areas may also largely participate in the processing of level-changed trials. Here we hypothesized that RH areas underly the inhibitory mechanism performed on the irrelevant level, as one of the components of the level switching process. In an experiment using a within-subject design, hierarchical stimuli were briefly presented either to the right or to the left visual field. 32 adults were instructed to identify the target at the global or local level. We assessed a possible RH dominance for the non-target level inhibition by varying the attentional demands through the manipulation of level repetitions (two or gour repeated-level trials before the switch). The behavioral data confirmed a LH specialization only for the local level processing of letter-based stimuli, and detrimental effect of increased level repetitions before a switch. Further, data provides evidence for a RH advantage in inhibiting the non-target level. Taken together, the data supports the notion of the existence of multiple mechanisms underlying level-switch effects. PMID:24723903

Impact of Credit Restructuring on the Quality of Bank Asset Portfolio. A Cluster Analysis Approach

Directory of Open Access Journals (Sweden)

Nicolae Dardac

2011-06-01

Full Text Available In this paper we proposed an analysis of the financial crisis impact on the procedures formanagement of loan portfolios in several banking systems. Despite ample liquidity injectionprograms implemented by major central banks and government actions, credit risk remains a keychallenge of the current banking systems. On a medium term, the high percentage of bad loans hasbecome a structural vulnerability. To maintain an acceptable quality of loan portfolios and not todamage the prudential and profitability indicators, credit institutions in EU member states haveproceeded to apply various techniques for credit restructuring. The quantitative analysis carried out inthe last part of the paper revealed a relatively moderate granularity of banking systems considered, interms of capitalization, volume of bank reserves and net provisions, in response to the persistent trendof loan portfolio deterioration.

Tipos de tarefas e estratégias de comunicação: investigando a validade de narrativas baseadas em tópicos e em figuras

Directory of Open Access Journals (Sweden)

Gicele Virgine Vieira Prebiana

2012-11-01

Full Text Available This study set up to investigate the validity of different oral tasks,namely topic-based and picture-based narratives, as data elicitationtasks. Our ultimate goal was to examine whether these two types ofnarratives would impact upon intermediate learners’ L2 oralproduction, regarding their use of communication strategies (CSduring speech performance. Spearman correlational tests were runso as to check for ranking and frequency of the strategies used byparticipants in each narrative task. Results indicate that the type oftask and its intrinsic characteristics may affect the use of CS interms of frequency. Additionally, results show that the participantstended to experience fewer difficulties when performing the picturebasednarrative, which led them to use a fewer number of strategies.On the contrary, the two topic-based narratives led participants toapply a greater number of CS.

O assassinato de um homossexual diante de um tribunal da Capital da República em meados do século XX

Directory of Open Access Journals (Sweden)

Rivail Carvalho Rolim

2013-05-01

Full Text Available http://dx.doi.org/10.1590/S0104-026X2013000100017 O objetivo deste artigo é o de analisar como o assassinato de um homossexual foitratado em um tribunal da Capital da República em meados do século XX. Os autos criminaispodem revelar aspectos significativos sobre a aplicação do direito nas instâncias judiciais.Ressaltamos como a cultura jurídico-penal no país continuou reproduzindo os mesmos padrõessocioculturais das culturas jurídico-penais ocidentais; em última instância, condenando o prazerou pelo menos determinadas formas de senti-lo. Da mesma forma, inferimos que, por intermédioda legalidade processual, se reprimiu determinado comportamento sexual, já que a legalidadeformal não preceituava a homossexualidade como crime.

Fragility issues of medical video streaming over 802.11e-WLAN m-health environments.

Science.gov (United States)

Tan, Yow-Yiong Edwin; Philip, Nada; Istepanian, Robert H

2006-01-01

This paper presents some of the fragility issues of a medical video streaming over 802.11e-WLAN in m-health applications. In particular, we present a medical channel-adaptive fair allocation (MCAFA) scheme for enhanced QoS support for IEEE 802.11 (WLAN), as a modification for the standard 802.11e enhanced distributed coordination function (EDCF) is proposed for enhanced medical data performance. The medical channel-adaptive fair allocation (MCAFA) proposed extends the EDCF, by halving the contention window (CW) after zeta consecutive successful transmissions to reduce the collision probability when channel is busy. Simulation results show that MCAFA outperforms EDCF in-terms of overall performance relevant to the requirements of high throughput of medical data and video streaming traffic in 3G/WLAN wireless environments.

浅谈深圳地区的电力需求侧管理%Few Ideas on DSM in Shenzhen City

Institute of Scientific and Technical Information of China (English)

黄昆彪; 贾振旺

2001-01-01

Combined with the practice in Shenzhen City, this paper analyses basic conditions to practise DSM interms of price system, relation between ownership and management, power structure, etc. The necessity and urgency ofpromoting DSM and carrying out integrated resources plan are clarified, and ideas of carrying out DSM are raised.%本文结合深圳地区实际，从电价体系、产权关系、电源结构等方面分析了深圳地区推行DsM的基础条件，阐明促进DsM，实行综合资源规划的必要性和紧迫性，提出了实施DsM的工作设想。

Sea level hazards: Altimetric monitoring of tsunamis and sea level rise

Science.gov (United States)

Hamlington, Benjamin Dillon

Whether on the short timescale of an impending tsunami or the much longer timescale of climate change-driven sea level rise, the threat stemming from rising and inundating ocean waters is a great concern to coastal populations. Timely and accurate observations of potentially dangerous changes in sea level are vital in determining the precautionary steps that need to be taken in order to protect coastal communities. While instruments from the past have provided in situ measurements of sea level at specific locations across the globe, satellites can be used to provide improved spatial and temporal sampling of the ocean in addition to producing more accurate measurements. Since 1993, satellite altimetry has provided accurate measurements of sea surface height (SSH) with near-global coverage. Not only have these measurements led to the first definitive estimates of global mean sea level rise, satellite altimetry observations have also been used to detect tsunami waves in the open ocean where wave amplitudes are relatively small, a vital step in providing early warning to those potentially affected by the impending tsunami. The use of satellite altimetry to monitor two specific sea level hazards is examined in this thesis. The first section will focus on the detection of tsunamis in the open ocean for the purpose of providing early warning to coastal inhabitants. The second section will focus on estimating secular trends using satellite altimetry data with the hope of improving our understanding of future sea level change. Results presented here will show the utility of satellite altimetry for sea level monitoring and will lay the foundation for further advancement in the detection of the two sea level hazards considered.

Adjacent level effects of bi level disc replacement, bi level fusion and disc replacement plus fusion in cervical spine--a finite element based study.

Science.gov (United States)

Faizan, Ahmad; Goel, Vijay K; Biyani, Ashok; Garfin, Steven R; Bono, Christopher M

2012-03-01

Studies delineating the adjacent level effect of single level disc replacement systems have been reported in literature. The aim of this study was to compare the adjacent level biomechanics of bi-level disc replacement, bi-level fusion and a construct having adjoining level disc replacement and fusion system. In total, biomechanics of four models- intact, bi level disc replacement, bi level fusion and fusion plus disc replacement at adjoining levels- was studied to gain insight into the effects of various instrumentation systems on cranial and caudal adjacent levels using finite element analysis (73.6N+varying moment). The bi-level fusion models are more than twice as stiff as compared to the intact model during flexion-extension, lateral bending and axial rotation. Bi-level disc replacement model required moments lower than intact model (1.5Nm). Fusion plus disc replacement model required moment 10-25% more than intact model, except in extension. Adjacent level motions, facet loads and endplate stresses increased substantially in the bi-level fusion model. On the other hand, adjacent level motions, facet loads and endplate stresses were similar to intact for the bi-level disc replacement model. For the fusion plus disc replacement model, adjacent level motions, facet loads and endplate stresses were closer to intact model rather than the bi-level fusion model, except in extension. Based on our finite element analysis, fusion plus disc replacement procedure has less severe biomechanical effects on adjacent levels when compared to bi-level fusion procedure. Bi-level disc replacement procedure did not have any adverse mechanical effects on adjacent levels. Copyright © 2011 Elsevier Ltd. All rights reserved.

Optimal maintenance policy incorporating system level and unit level for mechanical systems

Science.gov (United States)

Duan, Chaoqun; Deng, Chao; Wang, Bingran

2018-04-01

The study works on a multi-level maintenance policy combining system level and unit level under soft and hard failure modes. The system experiences system-level preventive maintenance (SLPM) when the conditional reliability of entire system exceeds SLPM threshold, and also undergoes a two-level maintenance for each single unit, which is initiated when a single unit exceeds its preventive maintenance (PM) threshold, and the other is performed simultaneously the moment when any unit is going for maintenance. The units experience both periodic inspections and aperiodic inspections provided by failures of hard-type units. To model the practical situations, two types of economic dependence have been taken into account, which are set-up cost dependence and maintenance expertise dependence due to the same technology and tool/equipment can be utilised. The optimisation problem is formulated and solved in a semi-Markov decision process framework. The objective is to find the optimal system-level threshold and unit-level thresholds by minimising the long-run expected average cost per unit time. A formula for the mean residual life is derived for the proposed multi-level maintenance policy. The method is illustrated by a real case study of feed subsystem from a boring machine, and a comparison with other policies demonstrates the effectiveness of our approach.

Excitation into 3p55p levels from the metastable levels of Ar

International Nuclear Information System (INIS)

Jung, R. O.; Boffard, John B.; Anderson, L. W.; Lin, Chun C.

2007-01-01

Measurements of cross sections for electron-impact excitation out of the J=0 and J=2 3p 5 4s metastable levels of argon into nine of the ten levels of the 3p 5 5p manifold are presented in the energy range from threshold to 10 eV. A mixed target of atoms in both metastable levels was created by a hollow cathode discharge. Laser quenching was used to depopulate either one of the metastable levels, allowing separate measurements of the cross sections from each of the two metastable levels. Unlike the metastable excitation cross sections into 3p 5 4p levels, the cross sections into the 3p 5 5p levels are not found to be proportional to optical oscillator strengths

Liquid level controller

International Nuclear Information System (INIS)

Mangus, J.D.; Redding, A.H.

1975-01-01

A system for maintaining two distinct sodium levels within the shell of a heat exchanger having a plurality of J-shaped modular tube bundles each enclosed in a separate shell which extends from a common base portion. A lower liquid level is maintained in the base portion and an upper liquid level is maintained in the shell enwrapping the long stem of the J-shaped tube bundles by utilizing standpipes with a notch at the lower end which decreases in open area the distance from the end of the stand pipe increases and a supply of inert gas fed at a constant rate to produce liquid levels, which will remain generally constant as the flow of liquid through the vessel varies

Sea Levels Online: Sea Level Variations of the United States Derived from National Water Level Observation Network Stations

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Water level records are a combination of the fluctuations of the ocean and the vertical land motion at the location of the station. Monthly mean sea level (MSL)...

24 CFR 990.175 - Utilities expense level: Computation of the current consumption level.

Science.gov (United States)

2010-04-01

...: Computation of the current consumption level. 990.175 Section 990.175 Housing and Urban Development... Calculating Formula Expenses § 990.175 Utilities expense level: Computation of the current consumption level. The current consumption level shall be the actual amount of each utility consumed during the 12-month...

Contemporary Arctic Sea Level

Science.gov (United States)

Cazenave, A. A.

2017-12-01

During recent decades, the Arctic region has warmed at a rate about twice the rest of the globe. Sea ice melting is increasing and the Greenland ice sheet is losing mass at an accelerated rate. Arctic warming, decrease in the sea ice cover and fresh water input to the Arctic ocean may eventually impact the Arctic sea level. In this presentation, we review our current knowledge of contemporary Arctic sea level changes. Until the beginning of the 1990s, Arctic sea level variations were essentially deduced from tide gauges located along the Russian and Norwegian coastlines. Since then, high inclination satellite altimetry missions have allowed measuring sea level over a large portion of the Arctic Ocean (up to 80 degree north). Measuring sea level in the Arctic by satellite altimetry is challenging because the presence of sea ice cover limits the full capacity of this technique. However adapted processing of raw altimetric measurements significantly increases the number of valid data, hence the data coverage, from which regional sea level variations can be extracted. Over the altimetry era, positive trend patterns are observed over the Beaufort Gyre and along the east coast of Greenland, while negative trends are reported along the Siberian shelf. On average over the Arctic region covered by satellite altimetry, the rate of sea level rise since 1992 is slightly less than the global mea sea level rate (of about 3 mm per year). On the other hand, the interannual variability is quite significant. Space gravimetry data from the GRACE mission and ocean reanalyses provide information on the mass and steric contributions to sea level, hence on the sea level budget. Budget studies show that regional sea level trends over the Beaufort Gyre and along the eastern coast of Greenland, are essentially due to salinity changes. However, in terms of regional average, the net steric component contributes little to the observed sea level trend. The sea level budget in the Arctic

Projecting future sea level

Science.gov (United States)

Cayan, Daniel R.; Bromirski, Peter; Hayhoe, Katharine; Tyree, Mary; Dettinger, Mike; Flick, Reinhard

2006-01-01

California’s coastal observations and global model projections indicate that California’s open coast and estuaries will experience increasing sea levels over the next century. Sea level rise has affected much of the coast of California, including the Southern California coast, the Central California open coast, and the San Francisco Bay and upper estuary. These trends, quantified from a small set of California tide gages, have ranged from 10–20 centimeters (cm) (3.9–7.9 inches) per century, quite similar to that estimated for global mean sea level. So far, there is little evidence that the rate of rise has accelerated, and the rate of rise at California tide gages has actually flattened since 1980, but projections suggest substantial sea level rise may occur over the next century. Climate change simulations project a substantial rate of global sea level rise over the next century due to thermal expansion as the oceans warm and runoff from melting land-based snow and ice accelerates. Sea level rise projected from the models increases with the amount of warming. Relative to sea levels in 2000, by the 2070–2099 period, sea level rise projections range from 11–54 cm (4.3–21 in) for simulations following the lower (B1) greenhouse gas (GHG) emissions scenario, from 14–61 cm (5.5–24 in) for the middle-upper (A2) emission scenario, and from 17–72 cm (6.7–28 in) for the highest (A1fi) scenario. In addition to relatively steady secular trends, sea levels along the California coast undergo shorter period variability above or below predicted tide levels and changes associated with long-term trends. These variations are caused by weather events and by seasonal to decadal climate fluctuations over the Pacific Ocean that in turn affect the Pacific coast. Highest coastal sea levels have occurred when winter storms and Pacific climate disturbances, such as El Niño, have coincided with high astronomical tides. This study considers a range of projected future

Nuclear Level Densities

International Nuclear Information System (INIS)

Grimes, S.M.

2005-01-01

Recent research in the area of nuclear level densities is reviewed. The current interest in nuclear astrophysics and in structure of nuclei off of the line of stability has led to the development of radioactive beam facilities with larger machines currently being planned. Nuclear level densities for the systems used to produce the radioactive beams influence substantially the production rates of these beams. The modification of level-density parameters near the drip lines would also affect nucleosynthesis rates and abundances

Adopting the EU sustainable performance scheme Level(s) in the Danish building sector

DEFF Research Database (Denmark)

Kanafani, Kai; Rasmussen, Freja Nygaard; Zimmermann, Regitze Kjær

2018-01-01

to life cycle assessment (LCA) requirements within the Level(s) scheme. As a measure for the Danish building sector’s LCA practice, the specifications for LCAbyg, the official Danish building LCA tool, is used. In 2017, the European commission’s Joint Research Centre has launched Level(s) as a vo...

Stepwise latent class models for explaining group-level putcomes using discrete individual-level predictors

NARCIS (Netherlands)

Bennink, Margot; Croon, M.A.; Vermunt, J.K.

2015-01-01

Explaining group-level outcomes from individual-level predictors requires aggregating the individual-level scores to the group level and correcting the group-level estimates for measurement errors in the aggregated scores. However, for discrete variables it is not clear how to perform the

Low-level waste management

International Nuclear Information System (INIS)

Levin, G.B.

1980-01-01

An overview of the current situation in the United States and a look to the future of low-level waste management are presented. Current problems and challenges are discussed, such as: the need of additional disposal sites in the future; risks and costs involved in transport of low-level wastes; reduction of low-level waste volume through smelting, incineration, and storage for wastes containing nuclides with short half lives; development of a national policy for the management of low-level waste, and its implementation through a sensible system of regulations. Establishing a success with low-level waste management should provide the momentum and public confidence needed to continue on and to resolve the technical and politically more difficult low-level waste problems

Comparative study on agro-physiology of sugarcane (saccharum officinarum l.) genotypes at different irrigation co-efficient values

International Nuclear Information System (INIS)

Farooq, Z.; Mehmood, S.

2015-01-01

Drought is the primary factor limiting sugarcane growth and physiological development under the climatic conditions of Pakistan; especially in those areas where without supplemental irrigation, productivity is not possible. Lack of detailed information regarding the performance of cane varieties under drought during formative stage and poor selection breeding program played key role in limiting cane productivity. The proposed study was conducted to investigate the genetic response of different cultivars viz., CSSG-676, CSSG-668, HoSG-795, HoSG-529, NSG-59 and HSF- 240 (standard) regarding the physiological development of sugarcane and its productivity at different irrigation co-efficient levels (100%, 80% and 60%). This study elucidates that moisture has a pronounced impact on the physiological attributes of sugarcane and proper irrigation scheduling with 20 no. of irrigations were reported best in-term of better germination (69.65%), leaf area index (7.13), crop growth rate (8.44), net assimilation rate (1.06) and chlorophyll contents (5.98). Similarly in case of genomic response, NSG-59 was reported significant best as compared to all other test cultivars in term of better physiological performance, showing significant higher leaf area index, crop growth rate, chlorophyll contents and water use efficiency that maximized the crop growth and resulted in higher net assimilation rate. Higher proline contents (1.59) produced in NSG-59 also made it best under drought conditions. (author)

Between national states and cosmopolitan societies: the institution of citizenship takes the immigration test

Directory of Open Access Journals (Sweden)

Mauricio Ambrosini

2013-02-01

Full Text Available The permanent settlement of immigrants of foreignorigin, and the subsequent formation of the second and thirdgenerations, has long contributed to re-launching the debate onthe content and limits of the institution of citizenship, bringinginto question the close connection with the national States. The increasing number and the growing diversity of the legal statusof foreigners residing in the territory of sovereign States blurs thedividing lines between insiders and outsiders. Therefore this raisesquestions about the criteria and ways of participation of residents inthe community of citizens, with all the obligations and benefi ts thatderive from it. In parallel, various forms of political participationof migrants across borders are developing, especially in terms ofthe countries of origin. The article examines the implications andmeanings that derive, in the current context, from what can bedefi ned as transnational reconfi gurations in the democratic sphere. After having considered the citizenship «from above», that is interms of the type of rights granted to foreign residents, their extent,timing and modes of access, the article presents a more recent branch of studies that start «from below», i.e. from the point ofview of actual practices to access and use, reinterpretations andnegotiations of the contents of citizenship: processes in which migrants and refugees take active roles at various levels and indifferent ways, both individual and collective.

Reference handbook: Level detectors

International Nuclear Information System (INIS)

1990-01-01

The purpose of this handbook is to provide Rocky Flats personnel with the information necessary to understand level measurement and detection. Upon completion of this handbook you should be able to do the following: List three reasons for measuring level. Describe the basic operating principles of the sight glass. Demonstrate proper techniques for reading a sight glass. Describe the basic operating principles of a float level detector. Describe the basic operating principles of a bubbler level indicating system. Explain the differences between a wet and dry reference leg indicating system, and describe how each functions. This handbook is designed for use by experienced Rocky Flats operators to reinforce and improve their current knowledge level, and by entry-level operators to ensure that they possess a minimum level of fundamental knowledge. Level Detectors is applicable to many job classifications and can be used as a reference for classroom work or for self-study. Although this reference handbook is by no means all-encompassing, you will gain enough information about this subject area to assist you in contributing to the safe operation of Rocky Flats Plant

Low-level radioactive waste, mixed low-level radioactive waste, and biomedical mixed waste

International Nuclear Information System (INIS)

Anon.

1994-01-01

This document describes the proceedings of a workshop entitled: Low-Level Radioactive Waste, Mixed Low-Level Radioactive Waste, and Biomedical Mixed Waste presented by the National Low-Level Waste Management Program at the University of Florida, October 17-19, 1994. The topics covered during the workshop include technical data and practical information regarding the generation, handling, storage and disposal of low-level radioactive and mixed wastes. A description of low-level radioactive waste activities in the United States and the regional compacts is presented

Errors and conflict at the task level and the response level.

Science.gov (United States)

Desmet, Charlotte; Fias, Wim; Hartstra, Egbert; Brass, Marcel

2011-01-26

In the last decade, research on error and conflict processing has become one of the most influential research areas in the domain of cognitive control. There is now converging evidence that a specific part of the posterior frontomedian cortex (pFMC), the rostral cingulate zone (RCZ), is crucially involved in the processing of errors and conflict. However, error-related research has focused primarily on a specific error type, namely, response errors. The aim of the present study was to investigate whether errors on the task level rely on the same neural and functional mechanisms. Here we report a dissociation of both error types in the pFMC: whereas response errors activate the RCZ, task errors activate the dorsal frontomedian cortex. Although this last region shows an overlap in activation for task and response errors on the group level, a closer inspection of the single-subject data is more in accordance with a functional anatomical dissociation. When investigating brain areas related to conflict on the task and response levels, a clear dissociation was perceived between areas associated with response conflict and with task conflict. Overall, our data support a dissociation between response and task levels of processing in the pFMC. In addition, we provide additional evidence for a dissociation between conflict and errors both at the response level and at the task level.

Storage for low-level and intermediate-level radioactive wastes

International Nuclear Information System (INIS)

1992-11-01

The objective of this report was to assess whether three nominated sites in Norway for underground storage of low-level and intermediate-level radioactive wastes would comply with safety standards and applicable laws and regulations. The site selection criteria are described and the report evaluates the technical, environmental and socio-economic suitability of the different sites. The site selection process eliminated two of the nominated sites, whereas one site was singled out. 28 refs., 14 figs., 10 tabs

Low magnesium level

Science.gov (United States)

Low magnesium level is a condition in which the amount of magnesium in the blood is lower than normal. The medical ... that convert or use energy ( metabolism ). When the level of magnesium in the body drops below normal, ...

IMMEDIATE RECIPROCAL CHANGES AT ADJACENT LEVEL FOLLOWING SINGLE-LEVEL ALIF

Directory of Open Access Journals (Sweden)

Enrique Vargas Uribe

2015-12-01

Full Text Available Objective : To assess the segmental sagittal parameters and the adjacent mobile segment after interbody fusion by anterior approach in single-level L5-S1. Methods : Retrospective study. Inclusion: Interbody fusion by anterior approach (10°/15° angle, due to DDD, low-grade spondylolisthesis and/or stenosis without prior lumbar fusion. Thirty-five cases were included (25 women; mean age 47±15 years. Analysis of lumbar radiographs were performed preoperatively and 3 months after surgery. The following parameters were evaluated: lumbar lordosis; segmental lordosis L4-L5 and L5-S1; sacral and L5 slope. Two independent evaluators made the measurements. Student's t test was used. Results : There was correction of lordosis at the L5-S1 level, from an average of 19° prior to surgery to 28° three months after surgery (p<0.001. It was observed reduction of the L4-L5 angle from 17° to 14° (p <0.001. Moreover, there was a small, but statistically significant, reduction of L5 inclination from 17 ° to 13 ° (p=0.007 and increase in the sacral slope from 37° to 40° (p=0.002. The change of total lumbar lordosis was not significant: 52° versus 53° (p=0.461. Before surgical correction, lordosis of the L5-S1 level contributed, on average, 37% of lumbar lordosis, and after, 54% (p<0.001. The L4-L5 level accounted for 34% and decreased to 24% (p<0.001. Conclusion : In the group studied, it was observed a decrease in lordosis of the adjacent mobile level following the treatment of the degenerate level by anterior interbody fusion and concomitant increase in lordosis.

Nuclear level density

International Nuclear Information System (INIS)

Cardoso Junior, J.L.

1982-10-01

Experimental data show that the number of nuclear states increases rapidly with increasing excitation energy. The properties of highly excited nuclei are important for many nuclear reactions, mainly those that go via processes of the compound nucleus type. In this case, it is sufficient to know the statistical properties of the nuclear levels. First of them is the function of nuclear levels density. Several theoretical models which describe the level density are presented. The statistical mechanics and a quantum mechanics formalisms as well as semi-empirical results are analysed and discussed. (Author) [pt

Adaptive Reference Levels in a Level-Crossing Analog-to-Digital Converter

Directory of Open Access Journals (Sweden)

Andrew C. Singer

2008-11-01

Full Text Available Level-crossing analog-to-digital converters (LC ADCs have been considered in the literature and have been shown to efficiently sample certain classes of signals. One important aspect of their implementation is the placement of reference levels in the converter. The levels need to be appropriately located within the input dynamic range, in order to obtain samples efficiently. In this paper, we study optimization of the performance of such an LC ADC by providing several sequential algorithms that adaptively update the ADC reference levels. The accompanying performance analysis and simulation results show that as the signal length grows, the performance of the sequential algorithms asymptotically approaches that of the best choice that could only have been chosen in hindsight within a family of possible schemes.

Correlation of Salivary Glucose Level with Blood Glucose Level in Diabetes Mellitus

Directory of Open Access Journals (Sweden)

Arati S. Panchbhai

2012-07-01

Full Text Available Objectives: There is alarming rise in number of people with diabetes mellitus over these years. If glucose in saliva is linked to glucose in blood it can be used to detect diabetes mellitus at an early stage. The present study is undertaken with the aim to assess the correlation of salivary glucose level with blood glucose level in people with diabetes mellitus. Material and Methods: For investigations, 2 sets of samples of people with diabetes and the age and sex matched non-diabetic subjects were recruited. The salivary glucose was analyzed in unstimulated whole saliva samples using glucose oxidase method. Pearson’s correlation coefficient test was applied to assess the correlation between salivary glucose level and blood glucose level. Results: The significant (P < 0.05 positive correlation of salivary glucose level and fasting blood glucose level was observed in people with uncontrolled diabetes in both the sets of samples.Conclusions: Although study suggests some potential for saliva as a marker in monitoring of diabetes mellitus, there are many aspects that need clarification before we reach to a conclusion.

Mitochondrial Respiration Inhibitors Suppress Protein Translation and Hypoxic Signaling via the Hyperphosphorylation and Inactivation of Translation Initiation Factor eIF2α and Elongation Factor eEF2

Science.gov (United States)

Li, Jun; Mahdi, Fakhri; Du, Lin; Datta, Sandipan; Nagle, Dale G.; Zhou, Yu-Dong

2011-01-01

Over 20000 lipid extracts of plants and marine organisms were evaluated in a human breast tumor T47D cell-based reporter assay for hypoxia-inducible factor-1 (HIF-1) inhibitory activity. Bioassay-guided isolation and dereplication-based structure elucidation of an active extract from the Bael tree (Aegle marmelos) afforded two protolimonoids, skimmiarepin A (1) and skimmiarepin C (2). In T47D cells, 1 and 2 inhibited hypoxia-induced HIF-1 activation with IC50 values of 0.063 µM and 0.068 µM, respectively. Compounds 1 and 2 also suppressed hypoxic induction of the HIF-1 target genes GLUT-1 and VEGF. Mechanistic studies revealed that 1 and 2 inhibited HIF-1 activation by blocking the hypoxia-induced accumulation of HIF-1α protein. At the range of concentrations that inhibited HIF-1 activation, 1 and 2 suppressed cellular respiration by selectively inhibiting the mitochondrial electron transport chain at complex I (NADH dehydrogenase). Further investigation indicated that mitochondrial respiration inhibitors such as 1 and rotenone induced the rapid hyperphosphorylation and inhibition of translation initiation factor eIF2α and elongation factor eEF2. The inhibition of protein translation may account for the short-term exposure effects exerted by mitochondrial inhibitors on cellular signaling, while the suppression of cellular ATP production may contribute to the inhibitory effects following extended treatment periods. PMID:21875114

Food and feeding behaviour of Asiatic elephant (Elephas maximus Linn.) in Kuldiha Wild Life Sanctuary, Odisha, India.

Science.gov (United States)

Mohapatra, Kalpana K; Patra, A K; Paramanik, D S

2013-01-01

The feeding behaviour of Asiatic elephant (Elephas maximus) with food reference was studied in Kuldiha Wildlife Sanctuary in Odisha during 2007 to 2009. Though the study area houses a good number of plant species only 71 species were identified as elephant fodder plants. The food trail of elephant was observed as twig breaking, bark peeling, branch breaking, stem twisting uprooting and flower plucking in different regions of study area during different seasons. Alteration of predominantly browsing strategy with that of grazing around the year was related to seasonal variation of food plants. Consumption of tree species (56%) was highest as compared to shrubs (20%), herbs (14%) and climbers (10%). A high degree of variation in dicot- monocot ratio (61:10)) was marked during identification of elephant fodder plant by direct observation. Microscopic analysis of dung showing a high degree of variation in average dicot- monocot ratio suggested that the food plant selection of elephant was highly opportunistic and seasonal. The elephants extensively fed on the plant species like Careya arborea, Kydia calycina, Helicteres isora, Mallotus philippinensis, Aegle marmelos, Zizyphus mauritiona, Bauhinia racemosa, Bauhinia vahlii, Mimosa pudica, Asparagus racemosus, Smilax zeylanica and Diosporea species. They were fond of Madhuca indica (Mahula) flowers in winter and fruits of Mangifera indica (Mango) in summer. They were never found feeding on Tectona grandis and Eucalyptus maculate inside the study area.

Low-level Radioactive waste Management

International Nuclear Information System (INIS)

1991-01-01

This meeting describes low-level radioactive waste management problems and contains 8 papers: 1 Low-level radioactive waste management: exemption concept and criteria used by international organizations. 2 Low-level radioactive waste management: french and foreign regulations 3 Low-level radioactive waste management in EDF nuclear power plants (FRANCE) 4 Low-level radioactive waste management in COGEMA (FRANCE) 5 Importance of low-level radioactive wastes in dismantling strategy in CEA (FRANCE) 6 Low-level radioactive waste management in hospitals 7 Low-level radioactive waste disposal: radiation protection laws 8 Methods of low-level radioactive materials measurements during reactor dismantling or nuclear facilities demolition (FRANCE)

Precision contact level gauge

International Nuclear Information System (INIS)

Krejci, M.; Pilat, M.; Stulik, P.

1977-01-01

Equipment was developed measuring the heavy water level in the TR-0 reactor core within an accuracy of several hundredths of a millimeter in a range of around 3.5 m and at a temperature of up to 90 degC. The equipment uses a vibrating needle contact as a high sensitivity level gauge and a servomechanical system with a motion screw carrying the gauge for monitoring and measuring the level in the desired range. The advantage of the unique level gauge consists in that that the transducer converts the measured level position to an electric signal, ie., pulse width, with high sensitivity and without hysteresis. (Kr)

Properties of 112Cd from the (n,n'γ) reaction: Levels and level densities

International Nuclear Information System (INIS)

Garrett, P. E.; Lehmann, H.; Jolie, J.; McGrath, C. A.; Yeh, Minfang; Younes, W.; Yates, S. W.

2001-01-01

Levels in 112 Cd have been studied through the (n,n'γ) reaction with monoenergetic neutrons. An extended set of experiments that included excitation functions, γ-ray angular distributions, and γγ coincidence measurements was performed. A total of 375 γ rays were placed in a level scheme comprising 200 levels (of which 238 γ-ray assignments and 58 levels are newly established) up to 4 MeV in excitation. No evidence to support the existence of 47 levels as suggested in previous studies was found, and these have been removed from the level scheme. From the results, a comparison of the level density is made with the constant temperature and back-shifted Fermi gas models. The back-shifted Fermi gas model with the Gilbert-Cameron spin cutoff parameter provided the best overall fit. Without using the neutron resonance information and only fitting the cumulative number of low-lying levels, the level density parameters extracted are a sensitive function of the maximum energy used in the fit

Disposal of high level and intermediate level radioactive wastes

International Nuclear Information System (INIS)

Flowers, R.H.

1991-01-01

The waste products from the nuclear industry are relatively small in volume. Apart from a few minor gaseous and liquid waste streams, containing readily dispersible elements of low radiotoxicity, all these products are processed into stable solid packages for disposal in underground repositories. Because the volumes are small, and because radioactive wastes are latecomers on the industrial scene, a whole new industry with a world-wide technological infrastructure has grown up alongside the nuclear power industry to carry out the waste processing and disposal to very high standards. Some of the technical approaches used, and the Regulatory controls which have been developed, will undoubtedly find application in the future to the management of non-radioactive toxic wastes. The repository site outlined would contain even high-level radioactive wastes and spent fuels being contained without significant radiation dose rates to the public. Water pathway dose rates are likely to be lowest for vitrified high-level wastes with spent PWR fuel and intermediate level wastes being somewhat higher. (author)

Level dynamics: An approach to the study of avoided level crossings and transition to chaos

International Nuclear Information System (INIS)

Wang, S.; Chu, S.Y.

1993-01-01

The Dyson-Pechukas level dynamics has been reformulated and made suitable for studying avoided level crossings and transition to chaos. The N-level dynamics is converted into a many-body problem of one-dimensional Coulomb gas with N-constituent particles having intrinsic excitations. It is shown that local fluctuation of the level distribution is generated by a large number of avoided level crossings. The role played by avoided level crossings in generating chaoticity in level dynamics is similar to the role played by short-range collisions in causing thermalization in many-body dynamics. Furthermore, the effect of level changing rates in producing avoided level crossings is the same as particle velocities in causing particle-particle collisions. A one-dimensional su(2) Hamiltonian has been constructed as an illustration of the level dynamics, showing how the avoided level crossings cause the transition from a regular distribution to the chaotic Gaussian orthogonal ensemble (GOE) distribution of the levels. The existence of the one-dimensional su(2) Hamiltonian which can show both GOE and Poisson level statistics is remarkable and deserves further investigation

Surface-Level Diversity and Decision-Making in Groups: When Does Deep-Level Similarity Help?

OpenAIRE

2006-01-01

Abstract We examined how surface-level diversity (based on race) and deep-level similarities influenced three-person decision-making groups on a hidden-profile task. Surface-level homogeneous groups perceived their information to be less unique and spent less time on the task than surface-level diverse groups. When the groups were given the opportunity to learn about their deep-level similarities prior to t...

LevelScheme: A level scheme drawing and scientific figure preparation system for Mathematica

Science.gov (United States)

Caprio, M. A.

2005-09-01

LevelScheme is a scientific figure preparation system for Mathematica. The main emphasis is upon the construction of level schemes, or level energy diagrams, as used in nuclear, atomic, molecular, and hadronic physics. LevelScheme also provides a general infrastructure for the preparation of publication-quality figures, including support for multipanel and inset plotting, customizable tick mark generation, and various drawing and labeling tasks. Coupled with Mathematica's plotting functions and powerful programming language, LevelScheme provides a flexible system for the creation of figures combining diagrams, mathematical plots, and data plots. Program summaryTitle of program:LevelScheme Catalogue identifier:ADVZ Program obtainable from: CPC Program Library, Queen's University of Belfast, N. Ireland Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADVZ Operating systems:Any which supports Mathematica; tested under Microsoft Windows XP, Macintosh OS X, and Linux Programming language used:Mathematica 4 Number of bytes in distributed program, including test and documentation:3 051 807 Distribution format:tar.gz Nature of problem:Creation of level scheme diagrams. Creation of publication-quality multipart figures incorporating diagrams and plots. Method of solution:A set of Mathematica packages has been developed, providing a library of level scheme drawing objects, tools for figure construction and labeling, and control code for producing the graphics.

Levels of organization in biology: on the nature and nomenclature of ecology's fourth level.

Science.gov (United States)

Lidicker, William Z

2008-02-01

Viewing the universe as being composed of hierarchically arranged systems is widely accepted as a useful model of reality. In ecology, three levels of organization are generally recognized: organisms, populations, and communities (biocoenoses). For half a century increasing numbers of ecologists have concluded that recognition of a fourth level would facilitate increased understanding of ecological phenomena. Sometimes the word "ecosystem" is used for this level, but this is arguably inappropriate. Since 1986, I and others have argued that the term "landscape" would be a suitable term for a level of organization defined as an ecological system containing more than one community type. However, "landscape" and "landscape level" continue to be used extensively by ecologists in the popular sense of a large expanse of space. I therefore now propose that the term "ecoscape" be used instead for this fourth level of organization. A clearly defined fourth level for ecology would focus attention on the emergent properties of this level, and maintain the spatial and temporal scale-free nature inherent in this hierarchy of organizational levels for living entities.

Coupling of sea level and tidal range changes, with implications for future water levels.

Science.gov (United States)

Devlin, Adam T; Jay, David A; Talke, Stefan A; Zaron, Edward D; Pan, Jiayi; Lin, Hui

2017-12-05

Are perturbations to ocean tides correlated with changing sea-level and climate, and how will this affect high water levels? Here, we survey 152 tide gauges in the Pacific Ocean and South China Sea and statistically evaluate how the sum of the four largest tidal constituents, a proxy for the highest astronomical tide (HAT), changes over seasonal and interannual time scales. We find that the variability in HAT is significantly correlated with sea-level variability; approximately 35% of stations exhibit a greater than ±50 mm tidal change per meter sea-level fluctuation. Focusing on a subset of three stations with long records, probability density function (PDF) analyses of the 95% percentile exceedance of total sea level (TSL) show long-term changes of this high-water metric. At Hong Kong, the increase in tides significantly amplifies the risk caused by sea-level rise. Regions of tidal decrease and/or amplification highlight the non-linear response to sea-level variations, with the potential to amplify or mitigate against the increased flood risk caused by sea-level rise. Overall, our analysis suggests that in many regions, local flood level determinations should consider the joint effects of non-stationary tides and mean sea level (MSL) at multiple time scales.

Reactor water level control device

International Nuclear Information System (INIS)

Hiramatsu, Yohei.

1980-01-01

Purpose: To increase the rapid response of the waterlevel control converting a reactor water level signal into a non-linear type, when the water level is near to a set value, to stabilize the water level reducting correlatively the reactor water level variation signal to stabilize greatly from the set value, and increasing the variation signal. Constitution: A main vapor flow quality transmitter detects the vapor flow generated in a reactor and introduced into a turbine. A feed water flow transmitter detects the quantity of a feed water flow from the turbine to the reactor, this detected value is sent to an addition operating apparatus. On the other hand, the power signal of the reactor water level transmitter is sent to the addition operating apparatus through a non-linear water level signal converter. The addition operation apparatus generates a signal for requesting the feed water flow quantity from both signals. Upon this occasion, the reactor water level signal converter makes small the reactor water level variation when the reactor level is close the set value, and when the water level deviates greatly from the set value, the reactor water level variation is made large thereby to improve the rapid response of the reactor coater level control. (Yoshino, Y.)

24 CFR 990.180 - Utilities expense level: Computation of the rolling base consumption level.

Science.gov (United States)

2010-04-01

...: Computation of the rolling base consumption level. 990.180 Section 990.180 Housing and Urban Development... Calculating Formula Expenses § 990.180 Utilities expense level: Computation of the rolling base consumption level. (a) General. (1) The rolling base consumption level (RBCL) shall be equal to the average of...

Influence of school-level and family-level variables on Chinese college students' aggression.

Science.gov (United States)

Zhou, Jiawei; Yang, Jiarun; Yu, Yunmiao; Wang, Lin; Han, Dong; Zhu, Xiongzhao; He, Jincai; Qiu, Xiaohui; Yang, Xiuxian; Qiao, Zhengxue; Sui, Hong; Yang, Yanjie

2017-08-01

With the frequent occurrence of campus violence, scholars have devoted increasing attention to college students' aggression. This study aims to estimate the prevalence of aggression in Chinese university students and identify factors that could influence their aggression. We can thus find methods to reduce the incidence of college students' aggression in the future. A multi-stage stratified sampling procedure was used to select university students (N = 4565) aged 16-25 years in Harbin. The Aggression Questionnaire, the Adolescent Self-Rating Life Events Checklist and the Social Support Revalued Scale were used to collect data. Females reported lower levels of aggression than males (p aggression, and the model was highly significant (R 2  = .233, Ad R 2  = .230, p aggression is affected by gender, family-level and school-level variables. Aggression scores are significantly correlated with not only family-level or school-level variables independently, but their combination as well. We find that the risk factors for aggression include a dissatisfying profession, higher levels of study pressure, poor parental relationships, poor interpersonal relationships, the presence of siblings, punishment, health maladjustment, less subjective support, and lower levels of utilization of social support.

Relationships between the school-level and classroom-level ...

African Journals Online (AJOL)

education; school-level environment; science education; South Africa. Introduction .... instrument to the primary school students (N = 1,077) of 31 distance-education primary school teachers ..... Centre for Curriculum, Transfer and Technology.

Passive synchronized Q-switching between a quasi-three-level and a four-level laser

DEFF Research Database (Denmark)

Cheng, Haynes Pak Hay; Tidemand-Lichtenberg, Peter; Jensen, Ole Bjarlin

2011-01-01

Synchronized Q-switching between quasi-three-level and four-level lasers is interesting for sum-frequency generation into the blue and ultraviolet. We report, for the first time, stable synchronized Q-switching between a quasi-three-level laser at 946 nm and a four-level laser at 1064 nm in an all...

Postprandial ghrelin responses are associated with the intermeal interval in time-blinded normal weight men, but not in obese men

NARCIS (Netherlands)

G. Stafleu; W. Blom; Gertjan Schaafsma; A. Lluch; C. de Graaf; H. Hendriks

2009-01-01

Ghrelin, a peptide predominantly produced by the stomach [1], appears to play an important role in the regulation of food intake. Intravenous infusion of ghrelin stimulates food intake and enhances appetite in humans [2]. In addition, plasma ghrelin concentrations rise gradually before a meal and

L’intermédialité dans La mémoire amputée de Werewere Liking. Perspectives didactiques au secondaire

Directory of Open Access Journals (Sweden)

Mamadou DRAMÉ

2017-12-01

Full Text Available One of the main reasons of technical redevelopment of the 1995 French programs was visiting "The ICT and educational multimedia, which eventually will disrupt the teaching / learning methods. Now, these media have become more numerous and varied since then. The literature too has been overwhelmed by these media, so much so that the study of this phenomenon has imposed itself. Thus, the integration of media (radio television, newspapers, paintings, songs, Facebook, Watsapp ... in literature is referred intermediality. Indeed, we found it interesting to study this new concept in high schools and even in colleges. The New French Program (2010, which aims to improve the quality of learning in secondary schools and colleges, will have to take these considerations into account. Consequently, that literature undergoes "transformations", it is imperative to "reinvent" new tools to tell and to read this present world. Very useful in the professor's knowledge, the media are also used for the elaboration of various practical exercises (versification, grammar, writing of invention ...

Intermittent sea-level acceleration

Science.gov (United States)

Olivieri, M.; Spada, G.

2013-10-01

Using instrumental observations from the Permanent Service for Mean Sea Level (PSMSL), we provide a new assessment of the global sea-level acceleration for the last ~ 2 centuries (1820-2010). Our results, obtained by a stack of tide gauge time series, confirm the existence of a global sea-level acceleration (GSLA) and, coherently with independent assessments so far, they point to a value close to 0.01 mm/yr2. However, differently from previous studies, we discuss how change points or abrupt inflections in individual sea-level time series have contributed to the GSLA. Our analysis, based on methods borrowed from econometrics, suggests the existence of two distinct driving mechanisms for the GSLA, both involving a minority of tide gauges globally. The first effectively implies a gradual increase in the rate of sea-level rise at individual tide gauges, while the second is manifest through a sequence of catastrophic variations of the sea-level trend. These occurred intermittently since the end of the 19th century and became more frequent during the last four decades.

ENRAF gauge reference level calculations

Energy Technology Data Exchange (ETDEWEB)

Huber, J.H., Fluor Daniel Hanford

1997-02-06

This document describes the method for calculating reference levels for Enraf Series 854 Level Detectors as installed in the tank farms. The reference level calculation for each installed level gauge is contained herein.

Level density of 57Co

International Nuclear Information System (INIS)

Mishra, V.; Boukharouba, N.; Brient, C.E.; Grimes, S.M.; Pedroni, R.S.

1994-01-01

Levels in 57 Co have been studied in the region of resolved levels (E 57 Fe(p,n) 57 Co neutron spectrum with resolution ΔE∼5 keV. Seventeen previously unknown levels are located. Level density parameters in the continuum region are deduced from thick target measurements of the same reaction and additional level density information is deduced from Ericson fluctuation studies of the reaction 56 Fe(p,n) 56 Co. A set of level density parameters is found which describes the level density of 57 Co at energies up to 14 MeV. Efforts to obtain level density information from the 56 Fe(d,n) 57 Co reaction were unsuccessful, but estimates of the fraction of the deuteron absorption cross section corresponding to compound nucleus formation are obtained

Liquid metal level measurement

International Nuclear Information System (INIS)

Hale, J.C.; Leyland, K.S.

1982-01-01

A liquid metal level indicator is described which can be used to measure, in a stainless steel tank, the level of a nuclear reactor coolant such as sodium. The instrument, which is based on the eddy current induction effect, gives readings over substantially the full depth of the tank and indicates the sense of change of level. (U.K.)

Système de PLC pour la supervision de la distribution basse tension des expériences ALICE et LHCb

CERN Document Server

Burdet, G

2004-01-01

Le groupe TS/EL étudie et réalise la distribution électrique basse tension pour alimenter les racks contenant l'électronique associée aux détecteurs dans les zones expérimentales du LHC. La distribution basse tension utilisera des tableaux récupérés des expériences du LEP pour ALICE et LHCb et un système basé sur des gaines CANALIS pour ATLAS et CMS. L'ensemble de la distribution électrique basse tension sera surveillée et contrôlée par l'intermédiaire de systèmes à base de PLC. Ce papier décrit l'infrastructure de supervision proposée pour ALICE et LHCb et son intégration au CERN Electrical Network Supervisor (ENS) et au Detector Control System (DCS).

Savoir gérer le mal

Directory of Open Access Journals (Sweden)

Michel Maffesoli

2015-09-01

Full Text Available Le sens commun, conservatoire immémorial de la sagesse humaine « sait », de savoir incorporé, que le mal, l’ombre, la mort, la douleur sont des caractéristiques essentielles de l’existence en son entièreté. Dès lors les créatures quelles qu’elles soient, sont des manifestations de la vie et, dès lors, méritent une attitude « compassionnelle », fraternelle, parce qu’ensemble elles constituent le flux vital. C’est ainsi que l’on peut comprendre l’utilité sociale de ces divers « mondes intermédiaires » que sont les croyances, religieuses ou philosophiques, au « double », au « daimon », aux esprits et autres figures tutélaires ou effrayantes. Elles aident à vivre, au jour le jour, la souffrance en la communalisant.

Qualité de l’écrit au niveau intermédiaire en immersion française : effet d’un programme intensif et hypothèse d’un effet de plateau

Directory of Open Access Journals (Sweden)

Monique Bournot-Trites

2007-04-01

Full Text Available Abstract Two cohorts of French immersion students in a British Columbia school who were entering Grades 4 and 5 respectively participated in the study and were each tested at the end of Grades 5 and 7. The Grade 4 cohort followed the newly introduced 80% French, 20% English language (high intensity program, while the Grade 5 students followed the 50% French, 50% English language (low intensity program. Compositions written in Grades 5 and 7 by each group were analysed and compared in regard to the lexical, grammatical and discourse development. Results showed an increase in the quality of writing between the beginning of Grade 5 and the end of Grade 7. However, students from the cohort who received a higher intensity of French instruction did not achieve any better in vocabulary, grammar and discourse development than the students in the low intensity group. The results showed a plateau effect between Grades 5 and 7 for only two of the variables investigated: vocabulary diversity and frequency of time markers. Moreover, apart from the percentage of correct prepositions, there was no difference in the writing quality of the two Grade 7 groups based on level of intensity.

Correlation between blood glucose levels and salivary glucose levels with oral ulcer in diabetic patients

Directory of Open Access Journals (Sweden)

Fildzah Rahman

2016-06-01

Full Text Available Diabetes Mellitus (DM is a syndrome in metabolism of carbohydrates which indicated by the increased level of blood glucose and also may increase salivary glucose levels. Oral ulcer has been frequently recognized in diabetic patients, which can be due to increased glucose in oral fluids and immune dysfunction. This study aimed to determine the correlation of blood glucose levels and salivary glucose levels with oral ulcer in diabetic patients. Analytic observational study was carried out through the determination of blood glucose levels just by way of strip using a glucometer and salivary glucose levels with the method "GOD-PAP test enzymatic colorimetric". Oral ulcer was determined in presenting ulcer on 30 patients with DM. The results showed r = 0.228, which is higher salivary glucose levels followed by high levels of blood glucose, and intraoral examination of oral ulcer found in the whole sample and the most location commonly found in buccal mucosa and lingual. It was concluded that there is a correlation between blood glucose levels and salivary glucose levels, and glucose levels affect the occurrence of oral ulcer in patients with DM

[Evaluation of leptin levels in plasma and their reliance on other hormonal factors affecting tissue fat levels in people with various levels of endogenous cotisol].

Science.gov (United States)

Robaczyk, Maciej G

2002-01-01

The discovery of leptin (LEP) shed new light on mechanisms regulating body fat mass (BFM). In this aspect, interactions between LEP and glucocorticoids at hypothalamic level may be of great importance. Factors that influence plasma LEP levels have not been fully recognized and available data on LEP levels are often inconsistent. The aim of this study was to evaluate absolute and BFM-corrected plasma LEP levels and their diurnal variation, as well as to assess the relationship between LEP levels, body fat distribution, and hormones influencing body fat in subjects with various levels of endogenous cortisol and different nutritional status. Group I was composed of 14 women aged 14-58 yrs, BMI of 23.9-37.1 kg/m2, with hypercortisolism due to ACTH-dependent and ACTH-independent Cushing's syndrome (CUS). 17 women with visceral obesity (OTY) and normal or disturbed carbohydrate metabolism, i.e. impaired glucose tolerance (IGT) and diabetes mellitus (DM), aged 24 do 50 yrs, BMI 30.0-46.1 kg/m2, were included in group II. Group III consisted of 14 women with Addison's disease (AD), aged 18 do 63 yrs, BMI 15.4-31.6 kg/m2. The control group IV (KON) included 17 healthy women with normal BMI. BMI, WHR, body composition, and body fat distribution (DEXA method) were assessed in all subjects. Basal plasma levels of LEP, beta-endorphin (B-EP), cortisol (F), insulin-like growth factor-1 (IGF-1) were measured with RIA test kits. Plasma adrenocorticotrophin (ACTH) levels, serum levels of insulin (IRI) and growth hormone (GH) were measured with IRMA test kits. Blood glucose (G) concentration was determined with an enzymatic method. Adiposity-corrected LEP levels were expressed as LEP/BFM and LEP/%BF indices. Fasting insulin resistance index (FIRI) was also calculated. Higher BFM and %BF values were found in the OTY group as compared with CUS KON and AD groups. BFM distribution did not differ in KON and AD groups whereas CUS subjects exhibited a higher accumulation of fat in the trunk

Translation of a High-Level Temporal Model into Lower Level Models: Impact of Modelling at Different Description Levels

DEFF Research Database (Denmark)

Kraft, Peter; Sørensen, Jens Otto

2001-01-01

The paper attempts theoretically to clarify the interrelation between various levels of descriptions used in the modelling and the programming of information systems. We suggest an analysis where we characterise the description levels with respect to how precisely they may handle information abou...... and other textual models. We also consider the aptness of models that include procedural mechanisms such as active and object databases...

Sea level ~400 000 years ago (MIS 11: analogue for present and future sea-level?

Directory of Open Access Journals (Sweden)

D. Q. Bowen

2010-01-01

Full Text Available Comparison of the sea-level today with that of 400 000 years ago (MIS 11, when the Earth's orbital characteristics were similar may provide, under conditions of natural variability, indications of future sea-level during the present interglacial. Then, as now, orbital eccentricity was low and precession dampened. Evidence for MIS 11 sea-level occurs on uplifting coastlines where shorelines with geochronological ages have been preserved. The sea-level term and the uplift term may be separated with an "uplift correction" formula. This discovers the original sea-level at which the now uplifted shoreline was fashioned. Estimates are based on average uplift rates of the "last interglacial" sea-level (MIS 5.5 using a range of estimates for sea-level and age at that time at different locations. These, with varying secular tectonic regimes in different ocean basins, provide a band of estimates for the MIS 11 sea-level. They do not support the hypothesis of an MIS 11 sea-level at ~20 m, and instead show that it was closer to its present level.

State-Level Reforms That Support College-Level Program Changes in North Carolina

Science.gov (United States)

Bowling, R. Edward; Morrissey, Sharon; Fouts, George M.

2014-01-01

This chapter describes the concurrent reforms occurring in North Carolina--both campus-level changes focused on such issues as developing structured programs of study and state-level reforms aimed at supporting the campus efforts.

Groundwater Level Monitoring using Levelogger and the Importance of Long-Term Groundwater Level Data

International Nuclear Information System (INIS)

Nazran Harun; Ahmad Hasnulhadi Che Kamaruddin

2016-01-01

This review paper is focused on groundwater level monitoring using levelogger and the importance of long-term groundwater level data. The levelogger provides an inexpensive and convenient method to measure level, temperature and conductivity all in one probe. It can provide real time view as data is being recorded by the connected data logger. Water-level measurements from observation wells are the principal source of information about the hydrologic stresses acting on aquifers and how these stresses affect ground-water recharge, storage, and discharge. Long-term and systematic measurements of water levels provide essential data needed to evaluate changes in the resource over time to develop ground-water models, forecast trends and monitor the effectiveness of groundwater management. A significant advantage of this method of data collection and reporting are the groundwater level data can be updated real time. The accessibility of water level data is greatly enhanced by the Geographic Information System (GIS) to visually illustrate the locations of observation wells relative to relevant topographic, geologic, or hydrologic features. GIS and internet greatly enhance the capability for retrieval and transmittal of water-level data to potential users. (author)

Propagation & Level: Factors Influencing in the ICT Composite Index at the School Level

Science.gov (United States)

Aoki, Hiroyuki; Kim, JaMee; Lee, WonGyu

2013-01-01

Many nations are greatly affected by their education policies, and the educational level of different schools is relevant to a nation's ICT policy. In the area of ICT, Korea has achieved quite high levels of competency. This study analyzed the level of ICT competency of 4490 elementary and 2419 middle schools in Korea within the context of the…

Authentication Assurance Levels

International Nuclear Information System (INIS)

Kouzes, Richard T.; Cash, James R.; Devaney, David M.; Geelhood, Bruce D.; Hansen, Randy R.; Melton, Ronald B.; Pitts, W. Karl

2002-01-01

This Common Criteria approach has been applied to create a definition of Authentication Assurance Levels that can quantify the level of assurance reached for a system subject to a set of authentication procedures. The arms-control authentication application of the Common Criteria expands on more typical information security evaluations in that it must contend with information barriers and preclude sophisticated intentional subversion attempts.

Arctic Sea Level Reconstruction

DEFF Research Database (Denmark)

Svendsen, Peter Limkilde

Reconstruction of historical Arctic sea level is very difficult due to the limited coverage and quality of tide gauge and altimetry data in the area. This thesis addresses many of these issues, and discusses strategies to help achieve a stable and plausible reconstruction of Arctic sea level from...... 1950 to today.The primary record of historical sea level, on the order of several decades to a few centuries, is tide gauges. Tide gauge records from around the world are collected in the Permanent Service for Mean Sea Level (PSMSL) database, and includes data along the Arctic coasts. A reasonable...... amount of data is available along the Norwegian and Russian coasts since 1950, and most published research on Arctic sea level extends cautiously from these areas. Very little tide gauge data is available elsewhere in the Arctic, and records of a length of several decades,as generally recommended for sea...

Avaliação da silagem de bagaço de laranja com diferentes aditivos por intermédio dos parâmetros de fermentação ruminal de ovinos e contribuição energética dos ácidos graxos voláteis Evaluation of orange peel silage with different additives by rumen fermentation parameters and energy contribution from volatile fatty acids

Directory of Open Access Journals (Sweden)

Luís Carlos Vinhas Ítavo

2000-10-01

Full Text Available O bagaço de laranja, com aditivo enzimático microbiano, ácidos fórmico e acético, ensilado por 70 dias, em tubos de concreto com capacidade de 700 kg, foi avaliado por intermédio dos parâmetros de fermentação ruminal, em ensaio experimental realizado com ovinos, machos, alojados em gaiolas metabólicas. O alimento fornecido foi feno de aveia (70% e silagem de bagaço de laranja (30%, com base na MS. O fluido ruminal foi coletado por sonda esofagiana nos tempos 2, 5 e 8 horas após o fornecimento do alimento e antes da alimentação, tomado como tempo zero (0. Foram avaliados pH, N amoniacal, ácidos graxos voláteis (acético, propiônico e butírico e contribuição energética desses ácidos em kcal. Não houve diferença entre os tratamentos para os parâmetros avaliados. As equações de regressão apresentaram comportamento quadrático para todas as características estudadas e as médias dos parâmetros foram: pH, 6,97; N amoniacal, 6,78 mg/100 mL de fluido ruminal e dos AGV; e acético, propiônico e butírico, 45,99; 11,16; e 5,50 mM/mL de fluido ruminal, respectivamente. Os aditivos não alteraram o valor nutricional do alimento, quando avaliados os parâmetros de fermentação ruminais. Entretanto, para a produção de AGV, houve melhor eficiência de transformação (kcal de AGV/kcal de glicose, 72,92% para o tratamento sem aditivo (controle.The orange peel with enzymatic microbial additive, formic or acetic acids was ensiled for 70 days, in concrete tubes with 700 kg of volume capacity, was evaluated by rumen fermentation parameters in a experimental trial using males sheep, housed in metabolic cages. The used diet was oat hay (70% and orange silage (30% on DM base. The ruminal fluid was collected with esophageal tube at 2, 5 and 8 hours after, and before feeding that was taken as zero time (0. The pH, N ammonia, volatile fatty acids (acetic, propionic and butyric and the energy contribution of these acid in kcal were

PEP liquid level system

International Nuclear Information System (INIS)

Lauritzen, T.; Sah, R.C.

1981-03-01

A liquid level system has been installed in the accelerator housing of the PEP storage ring. This instrument spans the entire 2.2 km circumference of the PEP project, and over one hundred readouts provide reference elevations which are used for the accurate alignment of accelerator components. The liquid level has proven to be extremely precise (+-0.10 mm) and quick to use, and it has contributed to the accurate alignment of PEP before beam turn-on. Since the liquid level readouts are rigidly attached to the accelerator housing, the liquid level has been a convenient means to monitor the settling of the accelerator housing

Mind the level: problems with two recent nation-level analyses in psychology

OpenAIRE

Kuppens, Toon; Pollet, Thomas V.

2014-01-01

Two recent articles (both published in Psychological Science) rely on nation-level data to address questions about psychological processes: Oishi and Diener (2014), referred to here as “OD,” and Hershfield et al. (2014), referred to as “HBW.” In our opinion, both articles contain problems with regard to the use and interpretation of nation-level data. The problems are (1) the failure to account for the statistical dependence of countries within regions, (2) the use of nation-level data with q...

Competence and regulatory interactions during regeneration in plants

Directory of Open Access Journals (Sweden)

Ajai Joseph Pulianmackal

2014-04-01

Full Text Available The ability to regenerate is widely exploited by multitudes of organisms ranging from unicellular bacteria to multicellular plants for their propagation and repair. But the levels of competence for regeneration vary from species to species. While variety of living cells of a plant display regeneration ability, only a few set of cells maintain their stemness in mammals. This highly pliable nature of plant cells in-terms of regeneration can be attributed to their high developmental plasticity. De novo organ initiation can be relatively easily achieved in plants by proper hormonal regulations. Elevated levels of plant hormone auxin induces the formation of proliferating mass of pluripotent cells called callus, which predominantly express lateral root meristem markers and hence is having an identity similar to lateral root primordia. Organ formation can be induced from the callus by modulating the ratio of hormones. An alternative for de novo organogenesis is by the forced expression of plant specific transcription factors. The mechanisms by which plant cells attain competence for regeneration on hormonal treatment or forced expression remain largely elusive. Recent studies have provided some insight into how the epigenetic modifications in plants affect this competence. In this review we discuss the present understanding of regenerative biology in plants and scrutinize the future prospectives of this topic. While discussing about the regeneration in the sporophyte of angiosperms which is well studied, here we outline the regenerative biology of the gametophytic phase and discuss about various strategies of regeneration that have evolved in the domain of life so that a common consensus on the entire process of regeneration can be made.

Digital Levelling in Subterranean Spaces

Directory of Open Access Journals (Sweden)

Tomáš Jiřikovský

2007-06-01

Full Text Available For precision levelling works are now more often used digital levels and code-scale staffs. Advantages in (and problems with their application to the regular line-levelling are well known and described. However, when using the digital levelling for measurements in specific local geodetic networks, monitoring networks and inside of buildings and underground spaces, new problems appear with the signalisation of the observed points, readability of the code (non-uniform illumination, temperature changes etc. The article informs about the application of two types of digital levels (Sokkia SDL-2, Trimble Zeiss DiNi 12T in the experimental subterranean levelling network for the basement settlement monitoring of a ten-floor building; the solution of marking of the points, field calibration and the system calibration of digital levels.

Gamma spectrometry; level schemes

International Nuclear Information System (INIS)

Blachot, J.; Bocquet, J.P.; Monnand, E.; Schussler, F.

1977-01-01

The research presented dealt with: a new beta emitter, isomer of 131 Sn; the 136 I levels fed through the radioactive decay of 136 Te (20.9s); the A=145 chain (β decay of Ba, La and Ce, and level schemes for 145 La, 145 Ce, 145 Pr); the A=47 chain (La and Ce, β decay, and the level schemes of 147 Ce and 147 Pr) [fr

Contemporary sea level rise.

Science.gov (United States)

Cazenave, Anny; Llovel, William

2010-01-01

Measuring sea level change and understanding its causes has considerably improved in the recent years, essentially because new in situ and remote sensing observations have become available. Here we report on most recent results on contemporary sea level rise. We first present sea level observations from tide gauges over the twentieth century and from satellite altimetry since the early 1990s. We next discuss the most recent progress made in quantifying the processes causing sea level change on timescales ranging from years to decades, i.e., thermal expansion of the oceans, land ice mass loss, and land water-storage change. We show that for the 1993-2007 time span, the sum of climate-related contributions (2.85 +/- 0.35 mm year(-1)) is only slightly less than altimetry-based sea level rise (3.3 +/- 0.4 mm year(-1)): approximately 30% of the observed rate of rise is due to ocean thermal expansion and approximately 55% results from land ice melt. Recent acceleration in glacier melting and ice mass loss from the ice sheets increases the latter contribution up to 80% for the past five years. We also review the main causes of regional variability in sea level trends: The dominant contribution results from nonuniform changes in ocean thermal expansion.

Analysis of Cyberbullying Sensitivity Levels of High School Students and Their Perceived Social Support Levels

Science.gov (United States)

Akturk, Ahmet Oguz

2015-01-01

Purpose: The purpose of this paper is to determine the cyberbullying sensitivity levels of high school students and their perceived social supports levels, and analyze the variables that predict cyberbullying sensitivity. In addition, whether cyberbullying sensitivity levels and social support levels differed according to gender was also…

Modulation of radiosensitivity of biological systems by medicinal herbs

Energy Technology Data Exchange (ETDEWEB)

Goyal, P.K., E-mail: pkgoyal2002@gmail.com [Radiation and Cancer Biology Laboratory, Department of Zoology, University of Rajasthan, Jaipur (India)

2012-07-01

The global environmental pollution is responsible for the exposure of living beings to the influence of various technogenic factors, including ionizing radiation. Exposure to such radiation represents a genuine, increasing threat to mankind and our environment. The steadily increasing applications of radiation in clinical practice, industrial and agricultural activities, residual radio-activity resulting from nuclear test explosions, have a measurable impact contributing to significant radiation hazards in humans. Further, the proliferation of terrorism and asymmetric warfare in the 21st century has rendered the modern world a dangerous place to live and work. With the realization of deleterious effects of ionizing radiation, a need was felt to protect human beings against these harmful effects by using physical and/or chemical means. Many chemical compounds have been tested for radio protective action but their practical applicability remained limited owing to their inherent toxicity at the optimum dose level. Various plants have been used for various ailments in humans since time immemorial, and herbal preparations have usually been considered safe and less toxic than the synthetic compounds. Therefore, screening of natural products present a major avenue for the discovery of new radio protective drugs and such products have drawn the attention of investigators during the last two decades. The Indian system of medicine employs a large number of plants and some of these herbals viz. The extracts of certain medicinal plant like Amla (Emblica officinalis), Rosemary (Rosemary officinalis), Methi (Trigonella foenum graecum) sapthaparna (Alstonia scholaris), Bael (Aegle inarmelos), Bhumi amla (Phyllanthus niruri), Jamun (Syzgium cumini), Gloe (Tinospora cordifolia) have been trialed in this laboratory for their radio protective action in various biological systems of mammals. The extracts of various parts of such plants have appreciable DRF on the basis of survival

Modulation of radiosensitivity of biological systems by medicinal herbs

International Nuclear Information System (INIS)

Goyal, P.K.

2012-01-01

The global environmental pollution is responsible for the exposure of living beings to the influence of various technogenic factors, including ionizing radiation. Exposure to such radiation represents a genuine, increasing threat to mankind and our environment. The steadily increasing applications of radiation in clinical practice, industrial and agricultural activities, residual radio-activity resulting from nuclear test explosions, have a measurable impact contributing to significant radiation hazards in humans. Further, the proliferation of terrorism and asymmetric warfare in the 21st century has rendered the modern world a dangerous place to live and work. With the realization of deleterious effects of ionizing radiation, a need was felt to protect human beings against these harmful effects by using physical and/or chemical means. Many chemical compounds have been tested for radio protective action but their practical applicability remained limited owing to their inherent toxicity at the optimum dose level. Various plants have been used for various ailments in humans since time immemorial, and herbal preparations have usually been considered safe and less toxic than the synthetic compounds. Therefore, screening of natural products present a major avenue for the discovery of new radio protective drugs and such products have drawn the attention of investigators during the last two decades. The Indian system of medicine employs a large number of plants and some of these herbals viz. The extracts of certain medicinal plant like Amla (Emblica officinalis), Rosemary (Rosemary officinalis), Methi (Trigonella foenum graecum) sapthaparna (Alstonia scholaris), Bael (Aegle inarmelos), Bhumi amla (Phyllanthus niruri), Jamun (Syzgium cumini), Gloe (Tinospora cordifolia) have been trialed in this laboratory for their radio protective action in various biological systems of mammals. The extracts of various parts of such plants have appreciable DRF on the basis of survival

Dietary medicinal plant extracts improve growth, immune activity and survival of tilapia Oreochromis mossambicus.

Science.gov (United States)

Immanuel, G; Uma, R P; Iyapparaj, P; Citarasu, T; Peter, S M Punitha; Babu, M Michael; Palavesam, A

2009-05-01

The effects of supplementing diets with acetone extract (1% w/w) from four medicinal plants (Bermuda grass Cynodon dactylon, H(1), beal Aegle marmelos, H(2), winter cherry Withania somnifera, H(3) and ginger Zingiber officinale, H(4)) on growth, the non-specific immune response and ability to resist pathogen infection in tilapia Oreochromis mossambicus were assessed. In addition, the antimicrobial properties of the extract were assessed against Vibrio alginolyticus, Vibrioparahaemolyticus, Vibrio mimicus, Vibrio campbelli, Vibrio vulnificus, Vibrio harveyi and Photobacterium damselae. Oreochromis mossambicus were fed 5% of their body mass per day for 45 days, and those fed the experimental diets showed a greater increase in mass (111-139%) over the 45 days compared to those that received the control diet (98%). The specific growth rate of O. mossambicus fed the four diets was also significantly greater (1.66-1.93%) than control (1.52%) diet-fed fish. The blood plasma chemistry analysis revealed that protein, albumin, globulin, cholesterol, glucose and triglyceride levels of experimental fish were significantly higher than that of control fish. Packed cell volume of the blood samples of experimental diet-fed fish was also significantly higher (34.16-37.95%) than control fish (33.0%). Leucocrit value, phagocytic index and lysozyme activity were enhanced in fish fed the plant extract-supplemented diets. The acetone extract of the plants inhibited growth of Vibrio spp. and P. damselae with extracts from W. somnifera showing maximum growth inhibition. A challenge test with V. vulnificus showed 100% mortality in O. mossambicus fed the control diet by day 15, whereas the fish fed the experimental diets registered only 63-80% mortality at the end of challenge experiment (30 days). The cumulative mortality index for the control group was 12,000, which was equated to 1.0% mortality, and accordingly, the lowest mortality of 0.35% was registered in H(4)-diet-fed group.

Ethnopharmacological survey about medicinal plants utilized by herbalists and traditional practitioner healers for treatments of diarrhea in the West Bank/Palestine.

Science.gov (United States)

Jaradat, Nidal Amin; Ayesh, Ola Ibrahim; Anderson, Cynthia

2016-04-22

Folk herbal medicine knowledge and its utilization by aboriginal cultures are not only useful for conservation of cultural traditions and biodiversity, but also useful for community healthcare and drug discovery in the present and in the future. Using a semi-structured questionnaire, an ethnopharmacological survey of medicinal plants used for treatment of diarrhea in the West Bank/Palestine was investigated. Information about fifty medicinal plants used for treatment of diarrhea, including the names of plants, parts used, mode and methods of preparation was obtained from 100 traditional healers and herbalists. This research is the first scientific work in the Middle East to collect data about plants used by traditional healers for treatments of diarrhea and their evidence based effects against this disease. The fidelity levels were 97% for Salvia fruticosa, Teucrium polium and Musa paradisiaca, 95% for Camellia sinensis and Aegle marmelos, 79% for Oryza sativa and Solanum tuberosum, 77% for Quercus boissieri, 66% for Psidium guajava, 56% for Anthemis palestina, 54% for Solanum nigrum and 52% for Juglans regia while the highest use and choice values were for S. fruticosa, T. polium and M. paradisiaca as well as the factor of informant's consensus for medicinal plants used for treatment of diarrhea was 0.505.The leaves were the most commonly used parts, followed by fruits, roots and rhizomes, while decoctions and infusions are the preferred methods of preparation. The Palestinian traditional medicine is rich with herbal remedies for treatment of diarrhea in comparison with other countries, but most of these herbal remedies lack standard in-vitro and in-vivo evaluations to establish their antidiarrheal effects. Therefore, the information obtained can serve as a basis for further phytochemical and pharmacological studies to determine their efficacy and safety which might contribute to a better integration of Palestinian traditional medicine into the national health

Usage of link-level performance indicators for HSDPA network-level simulations in E-UMTS

NARCIS (Netherlands)

Brouwer, Frank; de Bruin, I.C.C.; Silva, João Carlos; Souto, Nuno; Cercas, Francisco; Correia, Américo

2004-01-01

The paper describes integration of HSDPA (high-speed downlink packet access) link-level simulation results into network-level simulations for enhanced UMTS. The link-level simulations model all physical layer features depicted in the 3GPP standards. These include: generation of transport blocks;

Area-Level and Individual-Level Factors for Teenage Motherhood: A Multilevel Analysis in Japan.

Science.gov (United States)

Baba, Sachiko; Iso, Hiroyasu; Fujiwara, Takeo

2016-01-01

Teenage motherhood is strongly associated with a range of disadvantages for both the mother and the child. No epidemiological studies have examined related factors for teenage motherhood at both area and individual levels among Japanese women. Therefore, we performed a multilevel analysis of nationwide data in Japan to explore the association of area- and individual-level factors with teenage motherhood. The study population comprised 21,177 mothers living in 47 prefectures who had their first, singleton baby between 10 and 17 January or between 10 and 17 July, 2001. Information on the prefecture in which the mothers resided was linked to prefecture-level variables. Primary outcomes were area-level characteristics (single-mother households, three-generation households, college enrollment, abortions, juvenile crime, and per capita income) and individual-level characteristics, and divided into tertiles or quintiles based on their variable distributions. Multilevel logistic regression analysis was then performed. There were 440 teenage mothers (2.1%) in this study. In addition to individual low level of education [adjusted odds ratio (OR), 7.40; 95% confidence interval (CI), 5.59-9.78], low income [4.23 (2.95-6.08)], and smoking [1.65 (1.31-2.07)], high proportions of single-mother households [1.72 (1.05-2.80)] and three-generation household [1.81 (1.17-2.78)], and per capita income [2.19 (1.06-3.81)] at an area level were positively associated, and high level of college enrollment [0.46 (0.25-0.83)] and lower crime rate [0.62 (0.40-0.98)] at area level were inversely associated with teenage motherhood compared with the corresponding women living in prefectures with the lowest levels of these variables. Our findings suggest that encouraging the completion of higher education and reducing the number of single-mother household at an area level may be important public health strategies to reduce teenage motherhood.

The future for the Global Sea Level Observing System (GLOSS) Sea Level Data Rescue

Science.gov (United States)

Bradshaw, Elizabeth; Matthews, Andrew; Rickards, Lesley; Aarup, Thorkild

2016-04-01

Historical sea level data are rare and unrepeatable measurements with a number of applications in climate studies (sea level rise), oceanography (ocean currents, tides, surges), geodesy (national datum), geophysics and geology (coastal land movements) and other disciplines. However, long-term time series are concentrated in the northern hemisphere and there are no records at the Permanent Service for Mean Sea Level (PSMSL) global data bank longer than 100 years in the Arctic, Africa, South America or Antarctica. Data archaeology activities will help fill in the gaps in the global dataset and improve global sea level reconstruction. The Global Sea Level Observing System (GLOSS) is an international programme conducted under the auspices of the WMO-IOC Joint Technical Commission for Oceanography and Marine Meteorology. It was set up in 1985 to collect long-term tide gauge observations and to develop systems and standards "for ocean monitoring and flood warning purposes". At the GLOSS-GE-XIV Meeting in 2015, GLOSS agreed on a number of action items to be developed in the next two years. These were: 1. To explore mareogram digitisation applications, including NUNIEAU (more information available at: http://www.mediterranee.cerema.fr/logiciel-de-numerisation-des-enregistrements-r57.html) and other recent developments in scanning/digitisation software, such as IEDRO's Weather Wizards program, to see if they could be used via a browser. 2. To publicise sea level data archaeology and rescue by: • maintaining and regularly updating the Sea Level Data Archaeology page on the GLOSS website • strengthening links to the GLOSS data centres and data rescue organisations e.g. linking to IEDRO, ACRE, RDA • restarting the sea level data rescue blog with monthly posts. 3. Investigate sources of funding for data archaeology and rescue projects. 4. Propose "Guidelines" for rescuing sea level data. These action items will aid the discovery, scanning, digitising and quality control

Float level indicator

International Nuclear Information System (INIS)

Grishchuk, M.Kh.; Laptev, A.G.; Pashkov, V.A.

1980-01-01

Specially developed level indicator is suggested with differential to-transformer converter of the float motion, operating in line with a movable electronic block, intended for indicating the level of the dissociating nitrogen tetroxide liquid phase. On the basis of the indicator elements the device is realized to measure the time of calibrated volume fillino. in by liquid nitrogen tetroxide in steady state operation of the experimental bench-marks [ru

Macro-level gender equality and alcohol consumption: a multi-level analysis across U.S. States.

Science.gov (United States)

Roberts, Sarah C M

2012-07-01

Higher levels of women's alcohol consumption have long been attributed to increases in gender equality. However, only limited research examines the relationship between gender equality and alcohol consumption. This study examined associations between five measures of state-level gender equality and five alcohol consumption measures in the United States. Survey data regarding men's and women's alcohol consumption from the 2005 Behavioral Risk Factor Surveillance System were linked to state-level indicators of gender equality. Gender equality indicators included state-level women's socioeconomic status, gender equality in socioeconomic status, reproductive rights, policies relating to violence against women, and women's political participation. Alcohol consumption measures included past 30-day drinker status, drinking frequency, binge drinking, volume, and risky drinking. Other than drinker status, consumption is measured for drinkers only. Multi-level linear and logistic regression models adjusted for individual demographics as well as state-level income inequality, median income, and % Evangelical Protestant/Mormon. All gender equality indicators were positively associated with both women's and men's drinker status in models adjusting only for individual-level covariates; associations were not significant in models adjusting for other state-level characteristics. All other associations between gender equality and alcohol consumption were either negative or non-significant for both women and men in models adjusting for other state-level factors. Findings do not support the hypothesis that higher levels of gender equality are associated with higher levels of alcohol consumption by women or by men. In fact, most significant findings suggest that higher levels of equality are associated with less alcohol consumption overall. Copyright © 2012 Elsevier Ltd. All rights reserved.

Science Curriculum Guide, Level 4.

Science.gov (United States)

Newark School District, DE.

The fourth of four levels in a K-12 science curriculum is outlined. In Level 4 (grades 9-12), science areas include earth science, biology, chemistry, and physics. Six major themes provide the basis for study in all levels (K-12). These are: Change, Continuity, Diversity, Interaction, Limitation, and Organization. In Level 4, all six themes are…

PSA Level 2:Scope And Method Of PSA Level 2 For Nuclear Power Plant

International Nuclear Information System (INIS)

Widodo, Surip; Antariksawan, Anhar R.

2001-01-01

A study of scope and method of PSA Level 2 had been conducted. The background of the study is the need to gain the capability to well perform PSA Level 2 for nuclear facilities. This study is a literature survey. The scope of PSA Level 2 consists of generating plant damage states, accident progression analysis, and grouping source terms. Concerning accident progression analysis, several methods are used, among others event tree method, named accident progression event tree (APET) or containment event tree (CET), and fault tree method. The end result of PSA Level 2 is release end states which is grouped into release bins. The results will be used for PSA Level 3

Quantification of the level descriptors for the standard EQ-5D three-level system and a five-level version according to two methods

NARCIS (Netherlands)

M.F. Janssen (Bas); E. Birnie (Erwin); G.J. Bonsel (Gouke)

2008-01-01

textabstractObjectives: Our aim was to compare the quantitative position of the level descriptors of the standard EQ-5D three-level system (3L) and a newly developed, experimental five-level version (5L) using a direct and a vignette-based indirect method. Methods: Eighty-two respondents took part

Levels of valence

Directory of Open Access Journals (Sweden)

Vera eShuman

2013-05-01

Full Text Available The distinction between the positive and the negative is fundamental in our emotional life. In appraisal theories, in particular in the component process model of emotion (Scherer, 1984, 2010, qualitatively different types of valence are proposed based on appraisals of (unpleasantness, goal obstructiveness/conduciveness, low or high power, self- (incongruence, and moral badness/goodness. This multifaceted conceptualization of valence is highly compatible with the frequent observation of mixed feelings in real life. However, it seems to contradict the one-dimensional conceptualization of valence often encountered in psychological theories, and the notion of valence as a common currency used to explain choice behavior. Here, we propose a framework to integrate the seemingly disparate conceptualizations of multifaceted valence and one-dimensional valence by suggesting that valence should be conceived at different levels, micro and macro. Micro-valences correspond to qualitatively different types of evaluations, potentially resulting in mixed feelings, whereas one-dimensional macro-valence corresponds to an integrative common currency to compare alternatives for choices. We propose that conceptualizing levels of valence may focus research attention on the mechanisms that relate valence at one level (micro to valence at another level (macro, leading to new hypotheses and addressing various concerns that have been raised about the valence concept, such as the valence-emotion relation.

Operational intervention levels (OILs): a tool to overcome differences in intervention levels?

International Nuclear Information System (INIS)

Kirchner, Gerald; Wirth, Erich

2008-01-01

The intervention levels for evacuation, sheltering and iodine blockade still differ in many countries, although international organisation like IAEA, NEA or ICRP aspire to harmonise them on an international level. Even if the dose values of the limits are in agreement, they are not necessarily comparable because the type of dose (projected dose, averted dose), the respected exposure pathways (external dose, inhalation, ingestion) or the integration time might differ significantly. The question is raised, how can harmonisation being achieved? International organisations recommend 'operational intervention levels' (OILs) for promptly assessing the results of environmental monitoring and to decide on protective actions. OILs are measurable values derived from dose limits. Best examples are the derived intervention levels for food and feed in the codex alimentarius or by the EC, which limit the ingestion dose to about 5 mSv/a. This paper discusses the properties and potential use of OILs, identifies and derives useful OILs and addresses their benefit in practise both for early and later countermeasures. Furthermore it is discussed whether OILs might be a useful tool to overcome national differences in intervention levels because an OIL value covers a relative wide range of the projected dose due to the uncertainty of the parameters needed for derivation. (author)

Comparison of norovirus RNA levels in outbreak-related oysters with background environmental levels.

Science.gov (United States)

Lowther, James A; Gustar, Nicole E; Hartnell, Rachel E; Lees, David N

2012-02-01

Norovirus is the principal agent of bivalve shellfish-associated gastroenteric illness worldwide. Numerous studies using PCR have demonstrated norovirus contamination in a significant proportion of both oyster and other bivalve shellfish production areas and ready-to-eat products. By comparison, the number of epidemiologically confirmed shellfish-associated outbreaks is relatively low. This suggests that factors other than the simple presence or absence of virus RNA are important contributors to the amount of illness reported. This study compares norovirus RNA levels in oyster samples strongly linked to norovirus or norovirus-type illness with the levels typically found in commercial production areas (non-outbreak-related samples). A statistically significant difference between norovirus levels in the two sets of samples was observed. The geometric mean of the levels in outbreak samples (1,048 copies per g) was almost one order of magnitude higher than for positive non-outbreak-related samples (121 copies per g). Further, while none of the outbreak-related samples contained fewer than 152 copies per g, the majority of positive results for non-outbreak-related samples was below this level. These observations support the concept of a dose-response for norovirus RNA levels in shellfish and could help inform the establishment of threshold criteria for risk management.

Quantification of the level descriptors for the standard EQ-5D three-level system and a five-level version according to two methods

NARCIS (Netherlands)

Janssen, M. F.; Birnie, E.; Bonsel, G. J.

2008-01-01

OBJECTIVES: Our aim was to compare the quantitative position of the level descriptors of the standard EQ-5D three-level system (3L) and a newly developed, experimental five-level version (5L) using a direct and a vignette-based indirect method. METHODS: Eighty-two respondents took part in the study.

Fasting and nonfasting lipid levels

DEFF Research Database (Denmark)

Langsted, Anne; Freiberg, Jacob J; Nordestgaard, Børge G

2008-01-01

Lipid profiles are usually measured after fasting. We tested the hypotheses that these levels change only minimally in response to normal food intake and that nonfasting levels predict cardiovascular events.......Lipid profiles are usually measured after fasting. We tested the hypotheses that these levels change only minimally in response to normal food intake and that nonfasting levels predict cardiovascular events....

Levels of licury oil [“Syagrus coronata” (Martius Beccari] in crossbred Boer kids diet Níveis de óleo de licuri ["Syagrus coronata" (Martius Beccari] na dieta de cabritos ¾ Boer

Directory of Open Access Journals (Sweden)

Felicidade Margarida Macome

2010-12-01

Full Text Available The aim of this study was to determine the best level of licury oil in the diet, feed intake, digestibility, blood parameters and performance of ¾ Boer goats. 20 male goats were used, with an initial weight of 10.8kg/LW. The animals were fed with hay and concentrated mix supplemented with licury oil. The experiment lasted 70 days. Feed and feces samples were collected for determination of feed intake and digestibility. The intake of dry matter, ether extract, non fiber carbohydrates and total digestible nutrient presented quadratic effect with the addition of the oil. The plasma parameters were not affected with oil inclusion as well the intake of fiber fractions. Dry matter and crude protein digestibility were increased with the oil inclusion, although ether extract digestibility presented quadratic effect. The average daily gain and feed conversion of dry matter and ether extract showed a quadratic effect of adding oil. Based on performance and nutrient intake using this oil is not advantageous for feeding growing goats. However based on the other parameters, licury oil can be used up to 4.5% of the diet.Objetivou-se determinar o melhor nível de óleo de licuri na dieta de caprinos por intermédio do desempenho, consumo, digestibilidade, e parâmetros sanguíneos. Vinte cabritos, foram alimentados com proporções iguais de volumoso e concentrado e 0; 1,5; 3,0 e 4,5% de óleo de licuri (esses níveis consistiram nos tratamentos. O experimento durou 70 dias. Os animais foram pesados no inicio e no fim do experimento. Foram coletadas amostras do alimento, sobras, e das fezes, para determinação do consumo e digestibilidade. O consumo de matéria seca, extrato etéreo, carboidratos não-fibrosos e nutrientes digestíveis totais, tiveram efeito quadrático com a adição do óleo. Os parâmetros sanguíneos não foram influenciados pelos tratamentos, bem como o consumo das frações fibrosas. Os coeficientes de digestibilidade da matéria seca

Changing Sea Levels

Science.gov (United States)

Pugh, David

2004-04-01

Flooding of coastal communities is one of the major causes of environmental disasters world-wide. This textbook explains how sea levels are affected by astronomical tides, weather effects, ocean circulation and climate trends. Based on courses taught by the author in the U.K. and the U.S., it is aimed at undergraduate students at all levels, with non-basic mathematics being confined to Appendices and a website http://publishing.cambridge.org/resources/0521532183/.

The influence of feeding and fasting on plasma metabolites in the dogfish shark (Squalus acanthias).

Science.gov (United States)

Wood, Chris M; Walsh, Patrick J; Kajimura, Makiko; McClelland, Grant B; Chew, Shit F

2010-04-01

Dogfish sharks are opportunistic predators, eating large meals at irregular intervals. Here we present a synthesis of data from several previous studies on responses in plasma metabolites after natural feeding and during prolonged fasting (up to 56days), together with new data on changes in plasma concentrations of amino acids and non-esterified fatty acids. Post-prandial and long-term fasting responses were compared to control sharks fasted for 7days, a typical inter-meal interval. A feeding frenzy was created in which dogfish were allowed to feed naturally on dead teleosts at two consumed ration levels, 2.6% and 5.5% of body weight. Most responses were more pronounced at the higher ration level. These included increases in urea and TMAO concentrations at 20h, followed by stability through to 56days of fasting. Ammonia levels were low and exhibited little short-term response to feeding, but declined to very low values during the extended fast. Glucose and beta-hydroxybutyrate both fell after feeding, the latter to a greater and more prolonged extent (up to 60h), whereas acetoacetate did not change. During prolonged fasting, glucose concentrations were well regulated, but beta-hydroxybutyrate increased to 2-3-fold control levels. Total plasma amino acid concentrations increased in a biphasic fashion, with peaks at 6-20h, and 48-60h after the meal, followed by homeostasis during the extended fast. Essential and non-essential amino acids generally followed this same pattern, though some exhibited different trends after feeding: taurine, beta-alanine, and glycine (decreases or stability), alanine and glutamine (modest prolonged increases), and threonine, serine, asparagine, and valine (much larger short-term increases). Plasma non-esterified fatty acid concentrations declined markedly through 48h after the 2.6% meal. These data are interpreted in light of companion studies showing elevations in aerobic metabolic rate, urea production, rectal gland function, metabolic

Prediction of groundwater levels from lake levels and climate data using ANN approach

OpenAIRE

Dogan, Ahmet; Demirpence, Husnu; Cobaner, Murat

2008-01-01

There are many environmental concerns relating to the quality and quantity of surface and groundwater. It is very important to estimate the quantity of water by using readily available climate data for managing water resources of the natural environment. As a case study an artificial neural network (ANN) methodology is developed for estimating the groundwater levels (upper Floridan aquifer levels) as a function of monthly averaged precipitation, evaporation, and measured levels of Magnolia an...

Balanced Physical Exercise Increase Physical Fitness, Optimize Endorphin Levels, and Decrease Malondialdehyde Levels

Directory of Open Access Journals (Sweden)

Erwin Adams Pangkahila

2016-10-01

Full Text Available Background: Physical fitness determines the level of human health. A good physical fitness can be achieved if conducted with a balance and active physical fitness. The aims of this study was to elucidate the effect of balanced physical exercise on physical fitness, endorphin levels, and malondialdehyde (MDA levels. Methods: This study was a true experimental with pretest-posttest control group design using 24 students of IKIP PGRI Denpasar. Selected samples divided into two groups: the control group given conventional physical training (P0 and the treatment group given balanced physical training (P1. Physical fitness tests was performed using Cooper method and blood sampling was done to evaluate the level of endorphins and MDA before (pre test and after (post test treatment of 8 weeks. The data of endorphin and MDA levels were analyzed using independent T test. Whereas, the physical fitness was analyzed using Mann-Whitney U test. Results: Physical fitness of the group given a balanced physical training was significantly higher compare to the group given a conventional physical training (p < 0.05. Balanced physical training was proven to enhance physical fitness as measured by the Cooper method better than conventional physical training. In contrast, the levels of endorphins of the balanced physical training group did not different with the conventional physical training group (p > 0.05. Levels of MDA of balanced physical training group also did not different with the conventional physical training group (p > 0.05. Conclusions: balanced physical training can maintain physical fitness of people and improve the health and quality of life. 

Caribbean Sea Level Network

Science.gov (United States)

von Hillebrandt-Andrade, C.; Crespo Jones, H.

2012-12-01

Over the past 500 years almost 100 tsunamis have been observed in the Caribbean and Western Atlantic, with at least 3510 people having lost their lives to this hazard since 1842. Furthermore, with the dramatic increase in population and infrastructure along the Caribbean coasts, today, millions of coastal residents, workers and visitors are vulnerable to tsunamis. The UNESCO IOC Intergovernmental Coordination Group for Tsunamis and other Coastal Hazards for the Caribbean and Adjacent Regions (CARIBE EWS) was established in 2005 to coordinate and advance the regional tsunami warning system. The CARIBE EWS focuses on four areas/working groups: (1) Monitoring and Warning, (2) Hazard and Risk Assessment, (3) Communication and (4) Education, Preparedness and Readiness. The sea level monitoring component is under Working Group 1. Although in the current system, it's the seismic data and information that generate the initial tsunami bulletins, it is the data from deep ocean buoys (DARTS) and the coastal sea level gauges that are critical for the actual detection and forecasting of tsunamis impact. Despite multiple efforts and investments in the installation of sea level stations in the region, in 2004 there were only a handful of sea level stations operational in the region (Puerto Rico, US Virgin Islands, Bermuda, Bahamas). Over the past 5 years there has been a steady increase in the number of stations operating in the Caribbean region. As of mid 2012 there were 7 DARTS and 37 coastal gauges with additional ones being installed or funded. In order to reach the goal of 100 operational coastal sea level stations in the Caribbean, the CARIBE EWS recognizes also the importance of maintaining the current stations. For this, a trained workforce in the region for the installation, operation and data analysis and quality control is considered to be critical. Since 2008, three training courses have been offered to the sea level station operators and data analysts. Other

Controlling low-level radioactive waste

International Nuclear Information System (INIS)

1990-01-01

This series of information sheets describes at a popular level the sources of low-level radioactive wastes, their associated hazards, methods of storage, transportation and disposal, and the Canadian regulations that cover low-level wastes

Effect of Crude Protein Levels in Concentrate and Concentrate Levels in Diet on Fermentation

Directory of Open Access Journals (Sweden)

Dinh Van Dung

2014-06-01

Full Text Available The effect of concentrate mixtures with crude protein (CP levels 10%, 13%, 16%, and 19% and diets with roughage to concentrate ratios 80:20, 60:40, 40:60, and 20:80 (w/w were determined on dry matter (DM and organic matter (OM digestibility, and fermentation metabolites using an in vitro fermentation technique. In vitro fermented attributes were measured after 4, 24, and 48 h of incubation respectively. The digestibility of DM and OM, and total volatile fatty acid (VFA increased whereas pH decreased with the increased amount of concentrate in the diet (p<0.001, however CP levels of concentrate did not have any influence on these attributes. Gas production reduced with increased CP levels, while it increased with increasing concentrate levels. Ammonia nitrogen (NH3-N concentration and microbial CP production increased significantly (p<0.05 by increasing CP levels and with increasing concentrate levels in diet as well, however, no significant difference was found between 16% and 19% CP levels. Therefore, 16% CP in concentrate and increasing proportion of concentrate up to 80% in diet all had improved digestibility of DM and organic matter, and higher microbial protein production, with improved fermentation characteristics.

Policy and technical considerations for intermediate-level and low-level radioactive waste

International Nuclear Information System (INIS)

Anon.

1977-01-01

This section has addressed issues, topics, and considerations related to low-level and intermediate-level wastes that are basic to developing and establishing environmental radiation protection criteria for radioactive wastes. Applicability of criteria, criteria considerations for sites, control of radiological impact to the population, and long-term considerations are discussed

Partitioning of high level liquid waste: experiences in plant level adoption

International Nuclear Information System (INIS)

Manohar, Smitha; Kaushik, C.P.

2016-01-01

High Level Radioactive Wastes are presently vitrified in borosilicate matrices in all our back end facilities in our country. This is in accordance with internationally endorsed methodology for the safe management of high level radioactive wastes. Recent advancements in the field of partitioning technology in our group, has presented us with an opportunity to have a fresh perspective on management of high level liquid radioactive wastes streams, that emanate from reprocessing operations. This paper will highlight our experiences with respect to both partitioning studies and vitrification practices, with a focus on waste volume reduction for final disposal. Incorporation of this technique has led to the implementation of the concept of recovering wealth from waste, a marked decrease on the load of disposal in deep geological repositories and serve as a step towards the vision of transmutation of long lived radionuclides

Monitoring Your Blood Sugar Level

Science.gov (United States)

... and NutritionHealth Insurance: Understanding What It CoversHigh Homocysteine Level: How It Affects Your Blood VesselsUnderstanding Your Medical ... Health Resources Healthcare Management Monitoring Your Blood Sugar Level Monitoring Your Blood Sugar Level Share Print What ...

Levels of Valence

Science.gov (United States)

Shuman, Vera; Sander, David; Scherer, Klaus R.

2013-01-01

The distinction between the positive and the negative is fundamental in our emotional life. In appraisal theories, in particular in the component process model of emotion (Scherer, 1984, 2010), qualitatively different types of valence are proposed based on appraisals of (un)pleasantness, goal obstructiveness/conduciveness, low or high power, self-(in)congruence, and moral badness/goodness. This multifaceted conceptualization of valence is highly compatible with the frequent observation of mixed feelings in real life. However, it seems to contradict the one-dimensional conceptualization of valence often encountered in psychological theories, and the notion of valence as a common currency used to explain choice behavior. Here, we propose a framework to integrate the seemingly disparate conceptualizations of multifaceted valence and one-dimensional valence by suggesting that valence should be conceived at different levels, micro and macro. Micro-valences correspond to qualitatively different types of evaluations, potentially resulting in mixed feelings, whereas one-dimensional macro-valence corresponds to an integrative “common currency” to compare alternatives for choices. We propose that conceptualizing levels of valence may focus research attention on the mechanisms that relate valence at one level (micro) to valence at another level (macro), leading to new hypotheses, and addressing various concerns that have been raised about the valence concept, such as the valence-emotion relation. PMID:23717292

Predictors of Placement in Lower Level versus Higher Level High School Mathematics

Science.gov (United States)

Archbald, Doug; Farley-Ripple, Elizabeth N.

2012-01-01

Educators and researchers have long been interested in determinants of access to honors level and college prep courses in high school. Factors influencing access to upper level mathematics courses are particularly important because of the hierarchical and sequential nature of this subject and because students who finish high school with only lower…

Convolutional Neural Networks for Text Categorization: Shallow Word-level vs. Deep Character-level

OpenAIRE

Johnson, Rie; Zhang, Tong

2016-01-01

This paper reports the performances of shallow word-level convolutional neural networks (CNN), our earlier work (2015), on the eight datasets with relatively large training data that were used for testing the very deep character-level CNN in Conneau et al. (2016). Our findings are as follows. The shallow word-level CNNs achieve better error rates than the error rates reported in Conneau et al., though the results should be interpreted with some consideration due to the unique pre-processing o...

Three Levels of Semiosis

DEFF Research Database (Denmark)

Alrøe, Hugo Fjelsted

2016-01-01

This paper presents a second-order semiotic framework for ontological levels, which is based on the structure of semiosis in a more fundamental way than other existing approaches to semiotic levels. Building on the key semiotic concept of representation, three levels are posited: (1) non- or proto......-semiotic processes, without representation, such as physical or causal processes, (2) semiotic processes, with representation, such as the processes of life and cognition, and (3) second-order semiotic processes, with representation of representation, such as self-conscious and self-reflexive communicative processes....... This semiotic framework for ontological levels is compared with recent discussions of different ontological kinds of kinds such as indifferent and interactive kinds. This leads to the distinction between not two, but three kinds of kinds: indifferent, adaptive and reflexive kinds, of which the last two hitherto...

Specified assurance level sampling procedure

International Nuclear Information System (INIS)

Willner, O.

1980-11-01

In the nuclear industry design specifications for certain quality characteristics require that the final product be inspected by a sampling plan which can demonstrate product conformance to stated assurance levels. The Specified Assurance Level (SAL) Sampling Procedure has been developed to permit the direct selection of attribute sampling plans which can meet commonly used assurance levels. The SAL procedure contains sampling plans which yield the minimum sample size at stated assurance levels. The SAL procedure also provides sampling plans with acceptance numbers ranging from 0 to 10, thus, making available to the user a wide choice of plans all designed to comply with a stated assurance level

Combinatorial nuclear level-density model

International Nuclear Information System (INIS)

Uhrenholt, H.; Åberg, S.; Dobrowolski, A.; Døssing, Th.; Ichikawa, T.; Möller, P.

2013-01-01

A microscopic nuclear level-density model is presented. The model is a completely combinatorial (micro-canonical) model based on the folded-Yukawa single-particle potential and includes explicit treatment of pairing, rotational and vibrational states. The microscopic character of all states enables extraction of level-distribution functions with respect to pairing gaps, parity and angular momentum. The results of the model are compared to available experimental data: level spacings at neutron separation energy, data on total level-density functions from the Oslo method, cumulative level densities from low-lying discrete states, and data on parity ratios. Spherical and deformed nuclei follow basically different coupling schemes, and we focus on deformed nuclei

Application of Adjusted Canonical Correlation Analysis (ACCA) to study the association between mathematics in Level 1 and Level 2 and performance of engineering disciplines in Level 2

Science.gov (United States)

Peiris, T. S. G.; Nanayakkara, K. A. D. S. A.

2017-09-01

Mathematics plays a key role in engineering sciences as it assists to develop the intellectual maturity and analytical thinking of engineering students and exploring the student academic performance has received great attention recently. The lack of control over covariates motivates the need for their adjustment when measuring the degree of association between two sets of variables in Canonical Correlation Analysis (CCA). Thus to examine the individual effects of mathematics in Level 1 and Level 2 on engineering performance in Level 2, two adjusted analyses in CCA: Part CCA and Partial CCA were applied for the raw marks of engineering undergraduates for three different disciplines, at the Faculty of Engineering, University of Moratuwa, Sri Lanka. The joint influence of mathematics in Level 1 and Level 2 is significant on engineering performance in Level 2 irrespective of the engineering disciplines. The individual effect of mathematics in Level 2 is significantly higher compared to the individual effect of mathematics in Level 1 on engineering performance in Level 2. Furthermore, the individual effect of mathematics in Level 1 can be negligible. But, there would be a notable indirect effect of mathematics in Level 1 on engineering performance in Level 2. It can be concluded that the joint effect of mathematics in both Level 1 and Level 2 is immensely beneficial to improve the overall academic performance at the end of Level 2 of the engineering students. Furthermore, it was found that the impact mathematics varies among engineering disciplines. As partial CCA and partial CCA are not widely explored in applied work, it is recommended to use these techniques for various applications.

Journalism, database and the construction of a connected public sphere NEOFLUXO: Jornalismo, base de dados e a construção da esfera pública interconectada

Directory of Open Access Journals (Sweden)

Walter Teixeira Lima Junior

2011-07-01

Full Text Available The paper aims to reveal the results of researched project research project applied in Conected Social Media Observatory, called Neofluxo. It was approved by the National Council for Scientific and Technological Development (CNPq and its main objective is to identify the behavior of informational flow in social networks during the majority electoral processs in Brazil, in 2010 and demonstrate the possibility to produce Journalism through the intersection and data visualization using APIs. The project stored more than 20,2 million of mentions of candidates, and keywords defined by the researchers. For this, it was elaborated a specific computer program based on an open source that is able to track entries from Twitter users from keywords, collecting and storing them in the database. The Neofluxo also recorded data from official social networks of candidates Jose Serra, Dilma Rousseff and Marina Silva, in order to identify –by these starting points - the informational flows until they have reached Twitter.O presente trabalho visa expor os resultados preliminares do projeto de pesquisa aplicada Observatório de Mídias Sociais Conectadas, batizado de Neofluxo. Aprovado em edital do CNPq, o projeto possui a duração de dois anos, devendo desenvolver-se até junho de 2012. O objetivo principal é identificar o comportamento do fluxo informacional nas redes sociais durante o processo eleitoral majoritário no Brasil, em 2010, e demonstrar a possibilidade de produzir Jornalismo por intermédio do cruzamento e visualização de dados utilizando APIs. O projeto armazenou mais de 20,2 milhões de menções aos candidatos e palavras-chave definidas pelos pesquisadores. Para isso foi elaborado um programa computacional espe¬cífico, baseado em software aberto, capaz de rastrear participações de usuários do Twitter segundo palavras-chave, coletando-as e armazenando-as em banco de dados. Também foram gravados dados das redes sociais oficiais dos

La médiation identitaire

Directory of Open Access Journals (Sweden)

Louise Merzeau

2012-09-01

Full Text Available La crise des médiations unanimement observée dans la montée en puissance des pratiques numériques est ici réexaminée comme la mise en œuvre d'une nouvelle forme d'intermédiation centrée sur l'identité. Tout en revenant sur les grandes étapes qui ont conduit à la disqualification des intermédiaires traditionnels, l'article décrit l'avènement d'une forme inédite de régulation économique, technique et cognitive, où l'individu grammatisé sert d'agent de légitimation et d'orientation. La mise en évidence de cette médiation identitaire cherche d'abord à dénoncer les impostures d'une idéologie de l'immédiation propre à déstructurer le corps social. Elle vise ensuite à critiquer la réduction de la problématique de l'identité numérique à des enjeux de réputation individuelle, là où il est en réalité question de la maintenance d'un espace commun. L'objectif est enfin d'alerter sur les risques de contraction que pourrait signifier une personnalisation mal réfléchie des processus informationnels.The crisis of mediations unanimously observed in the rise of digital pratices is re-examined here as a new form of intermediation centered on identity. Reviewing the great stages which led to the disqualification of traditional intermediaries, the article describes the advent of a new form of economic, technical and cognitive regulation, where grammatized individual acts as the agent of legitimation and orientation. The description of this "identity mediation" first seeks to denounce impostures of an immediation ideology, which is a threat to the social fabric. It then aims at criticizing the reduction of the digital identity problems to issues of individual reputation, when it actually concerns the maintenance of common space. The purpose is finally to alert on the risks of contraction which personalization of the informational processes could mean.

Anoplastie périnéale simple pour le traitement des malformations anorectales basses chez l'adulte, à propos de deux cas

Science.gov (United States)

Echchaoui, Abdelmoughit; Benyachou, Malika; Hafidi, Jawad; Fathi, Nahed; Mohammadine, Elhamid; ELmazouz, Samir; Gharib, Nour-eddine; Abbassi, Abdellah

2014-01-01

Les malformations anorectales chez l'adulte sont des anomalies congénitales rares du tube digestif qui prédominent chez le sexe féminin. Notre étude porte sur deux observations de malformation anorectale basses vues et traitées au stade adulte par les 2 équipes (plasticiens et viscéralistes) à l'Hôpital Avicenne à Rabat. Il s'agit d'un homme de 24 ans avec une dyschésie anale l'autre cas est une femme de 18 ans avec une malformation anovulvaire Les caractéristiques cliniques combinées avec les imageries radiologiques (lavement baryté, et la manométrie anorectale) ont confirmé qu'il s'agit d'une malfomation anorectale basse. Les deux cas sont corrigés par une reconstruction sphinctérienne, réimplantation anale avec anoplastie périnéale. Les suites opératoires étaient simples, pas de souffrance cutanée ou nécrose, avec changement de pansement gras chaque jour. Le résultat fonctionnel (la continence) était favorable pour les 2 patients. La présentation des MAR à l’âge adulte est rare, d’étiologie mal connu, elles apparaissent selon le mode sporadique. Les caractéristiques cliniques, couplées à l'imagerie (lavement baryté, IRM pelvienne), l'endoscopie et la manométrie anorectale, permettent de confirmer le diagnostic et classer ces anomalies en 3 types: basses, intermédiaires, et hautes. Les formes basses sont traités d'emblée par une réimplantation anale et anoplastie périnéale simple tels nos deux cas, elles peuvent être traités dans certains cas par un abaissement anorectale associé à une plastie V-Y permettant ainsi un emplacement anatomique correct de l'anus; alors que les formes hautes ou intermédiaires relèvent d'une chirurgie complexe avec souvent une dérivation digestive transitoire. Contrairement aux autres formes, Les formes basses ont un pronostic fonctionnel favorable. PMID:25667689

Modification of booming level for higher correlation with booming sensation; Booming level no koseidoka

Energy Technology Data Exchange (ETDEWEB)

Hatano, S; Hashimoto, T [Seikei University, Tokyo (Japan)

1997-10-01

In our previous study, we proposed a objective measure, i.e., Booming Level for quantifying booming sensation caused by car interior noise. In this paper, Booming Level was modified with its weighting function and within the process of calculation 1/3 octave band level was modified for the best match with subjective result. These modifications were conducted through a subjective experiment rating booming sensation with sounds having much lower frequency contents below 63Hz. With this modified Booming Level, we have obtained higher correlation for rating booming sensation with sounds having prominent low frequency components. 1 ref., 10 figs.

Multi-level spondylolysis.

Science.gov (United States)

Hersh, David S; Kim, Yong H; Razi, Afshin

2011-01-01

The incidence of isthmic spondylolysis is approximately 3% to 6% in the general population. Spondylolytic defects involving multiple vertebral levels, on the other hand, are extremely rare. Only a handful of reports have examined the outcomes of surgical treatment of multi-level spondylolysis. Here, we present one case of bilateral pars defects at L3, L4, and L5. The patient, a 46-year-old female, presented with lower back pain radiating into the left lower extremity. Radiographs and CT scans of the lumbar spine revealed bilateral pars defects at L3-L5. The patient underwent lumbar discectomy and interbody fusion of L4-S1 as well as direct repair of the pars defect at L3. There were no postoperative complications, and by seven months the patient had improved clinically. While previous reports describe the use of either direct repair or fusion in the treatment of spondylolysis, we are unaware of reports describing the use of both techniques at adjacent levels.

Enhancement of the FDOT's project level and network level bridge management analysis tools

Science.gov (United States)

2011-02-01

Over several years, the Florida Department of Transportation (FDOT) has been implementing the AASHTO Pontis Bridge Management System to support network-level and project-level decision making in the headquarters and district offices. Pontis is an int...

A Study of Army Civilian Entry Level and Mid-Level Program Management Leadership Development

Science.gov (United States)

2016-05-08

and mid-grade level positions is an important responsibility for senior leaders. Mentoring and coaching entry level and mid-grade level...Program Management Leadership Development Craig J. Maurice Defense Acquisition University Senior Service College Fellowship 2015-2016 Huntsville...requirements for the Army’s Senior Service College Fellowship (SSCF) under the direction of SSCF Director, Mr. John Daniels and Research Advisor, Mr. Van

Levels of Literary Meaning

DEFF Research Database (Denmark)

Klausen, Søren Harnow

2017-01-01

I argue that intentionalist theories of meaning and interpretation, like those of Hirsch and Juhl, have been insufficiently attentive to the different levels of authorial intention that are operative in literary works. By countenancing intentions on different levels – ranging from simple semantic...

Evaluations of average level spacings

International Nuclear Information System (INIS)

Liou, H.I.

1980-01-01

The average level spacing for highly excited nuclei is a key parameter in cross section formulas based on statistical nuclear models, and also plays an important role in determining many physics quantities. Various methods to evaluate average level spacings are reviewed. Because of the finite experimental resolution, to detect a complete sequence of levels without mixing other parities is extremely difficult, if not totally impossible. Most methods derive the average level spacings by applying a fit, with different degrees of generality, to the truncated Porter-Thomas distribution for reduced neutron widths. A method that tests both distributions of level widths and positions is discussed extensivey with an example of 168 Er data. 19 figures, 2 tables

Lead, cadmium and mercury levels in pregnancy: the need for international consensus on levels of concern.

Science.gov (United States)

Taylor, C M; Golding, J; Emond, A M

2014-02-01

For heavy metals that have any degree of transfer though the placenta to the fetus, it is unlikely that there are safe limits for maternal blood levels. The only means of reducing fetal exposure is to minimise maternal exposure. There are few recommendations for levels of concern. With the exception of US recommendations for maternal Pb levels, but there are no international levels of concern or cut-off levels specifically for pregnancy for heavy metals, so that comparisons can generally only be made with national reference values relating to similar physiological statuses or age groups. These include recommendations for Cd levels by Germany (reference value for non-smoking adults aged 18-69 years, 1 µg/l) and for Hg by Germany (reference value for adults age 18-60 years with fish intake concern and recommended cut-off values. We also compare the levels with those found in other groups of pregnant women worldwide to strengthen the database for the development of levels of concern in pregnancy. The need for clarity of terminology in describing levels of concern is discussed. There is a pressing need for international consensus on levels of concern for all age groups and physiological statuses, particularly for pregnancy.

Preliminary investigation of the effects of sea-level rise on groundwater levels in New Haven, Connecticut

Science.gov (United States)

Bjerklie, David M.; Mullaney, John R.; Stone, Janet R.; Skinner, Brian J.; Ramlow, Matthew A.

2012-01-01

Global sea level rose about 0.56 feet (ft) (170 millimeters (mm)) during the 20th century. Since the 1960s, sea level has risen at Bridgeport, Connecticut, about 0.38 ft (115 mm), at a rate of 0.008 ft (2.56 mm + or - 0.58 mm) per year. With regional subsidence, and with predicted global climate change, sea level is expected to continue to rise along the northeast coast of the United States through the 21st century. Increasing sea levels will cause groundwater levels in coastal areas to rise in order to adjust to the new conditions. Some regional climate models predict wetter climate in the northeastern United States under some scenarios. Scenarios for the resulting higher groundwater levels have the potential to inundate underground infrastructure in lowlying coastal cities. New Haven is a coastal city in Connecticut surrounded and bisected by tidally affected waters. Monitoring of water levels in wells in New Haven from August 2009 to July 2010 indicates the complex effects of urban influence on groundwater levels. The response of groundwater levels to recharge and season varied considerably from well to well. Groundwater temperatures varied seasonally, but were warmer than what was typical for Connecticut, and they seem to reflect the influence of the urban setting, including the effects of conduits for underground utilities. Specific conductance was elevated in many of the wells, indicating the influence of urban activities or seawater in Long Island Sound. A preliminary steady-state model of groundwater flow for part of New Haven was constructed using MODFLOW to simulate current groundwater levels (2009-2010) and future groundwater levels based on scenarios with a rise of 3 ft (0.91 meters (m)) in sea level, which is predicted for the end of the 21st century. An additional simulation was run assuming a 3-ft rise in sea level combined with a 12-percent increase in groundwater recharge. The model was constructed from existing hydrogeologic information for the

A brief review of salient factors influencing adult eating behaviour.

Science.gov (United States)

Emilien, Christine; Hollis, James H

2017-12-01

A better understanding of the factors that influence eating behaviour is of importance as our food choices are associated with the risk of developing chronic diseases such as obesity, CVD, type 2 diabetes or some forms of cancer. In addition, accumulating evidence suggests that the industrial food production system is a major contributor to greenhouse gas emission and may be unsustainable. Therefore, our food choices may also contribute to climate change. By identifying the factors that influence eating behaviour new interventions may be developed, at the individual or population level, to modify eating behaviour and contribute to society's health and environmental goals. Research indicates that eating behaviour is dictated by a complex interaction between physiology, environment, psychology, culture, socio-economics and genetics that is not fully understood. While a growing body of research has identified how several single factors influence eating behaviour, a better understanding of how these factors interact is required to facilitate the developing new models of eating behaviour. Due to the diversity of influences on eating behaviour this would probably necessitate a greater focus on multi-disciplinary research. In the present review, the influence of several salient physiological and environmental factors (largely related to food characteristics) on meal initiation, satiation (meal size) and satiety (inter-meal interval) are briefly discussed. Due to the large literature this review is not exhaustive but illustrates the complexity of eating behaviour. The present review will also highlight several limitations that apply to eating behaviour research.

A situational analysis of priority disaster hazards in Uganda: findings from a hazard and vulnerability analysis.

Science.gov (United States)

Mayega, R W; Wafula, M R; Musenero, M; Omale, A; Kiguli, J; Orach, G C; Kabagambe, G; Bazeyo, W

2013-06-01

Most countries in sub-Saharan Africa have not conducted a disaster risk analysis. Hazards and vulnerability analyses provide vital information that can be used for development of risk reduction and disaster response plans. The purpose of this study was to rank disaster hazards for Uganda, as a basis for identifying the priority hazards to guide disaster management planning. The study as conducted in Uganda, as part of a multi-country assessment. A hazard, vulnerability and capacity analysis was conducted in a focus group discussion of 7 experts representing key stakeholder agencies in disaster management in Uganda. A simple ranking method was used to rank the probability of occurance of 11 top hazards, their potential impact and the level vulnerability of people and infrastructure. In-terms of likelihood of occurance and potential impact, the top ranked disaster hazards in Uganda are: 1) Epidemics of infectious diseases, 2) Drought/famine, 3) Conflict and environmental degradation in that order. In terms of vulnerability, the top priority hazards to which people and infrastructure were vulnerable were: 1) Conflicts, 2) Epidemics, 3) Drought/famine and, 4) Environmental degradation in that order. Poverty, gender, lack of information, and lack of resilience measures were some of the factors promoting vulnerability to disasters. As Uganda develops a disaster risk reduction and response plan, it ought to prioritize epidemics of infectious diseases, drought/famine, conflics and environmental degradation as the priority disaster hazards.

Definition of Virtual Levels.

Science.gov (United States)

Shore, Bruce W.

1979-01-01

Presents an examination of graphical displays of solutions to time-dependent Schrodinger equation modeling a laser-excited three-level atom. It suggests that an energy level may be regarded as virtual when it is detuned from resonance by more than two Rabi frequencies. (Author/HM)

Low level waste repositories

International Nuclear Information System (INIS)

Hill, P.R.H.; Wilson, M.A.

1983-11-01

Factors in selecting a site for low-level radioactive waste disposal are discussed. South Australia has used a former tailings dam in a remote, arid location as a llw repository. There are also low-level waste disposal procedures at the Olympic Dam copper/uranium project

2nd International Multidisciplinary Microscopy and Microanalysis Congress

CERN Document Server

Oral, Ahmet; Ozer, Mehmet

2015-01-01

The 2nd International Multidisciplinary Microscopy and Microanalysis Congress & Exhibition (InterM 2014) was held on 16–19 October 2014 in Oludeniz, Fethiye/ Mugla, Turkey. The aim of the congress was to gather scientists from various branches and discuss the latest improvements in the field of microscopy. The focus of the congress has been widened in an "interdisciplinary" manner, so as to allow all scientists working on several related subjects to participate and present their work. These proceedings include 33 peer-reviewed technical papers, submitted by leading academic and research institutions from over 17 countries and representing some of the most cutting-edge research available. The papers were presented at the congress in the following sessions: ·         Applications of Microscopy in the Physical Sciences ·         Applications of Microscopy in the Biological Sciences.

A intimidade em tempos de rede social digital – O Facebook e a midiatização do íntimo

Directory of Open Access Journals (Sweden)

José Antonio Martinuzzo

2015-07-01

Full Text Available Este artigo consiste de uma investigação sobre o conceito de intimidade no âmbito da rede social digital Facebook. As perguntas iniciais foram constituídas para saber qual a visão que os usuários da rede social têm acerca dessa esfera da vida cotidiana, e quais são os critérios para a publicação de conteúdos íntimos na era do Facebook. A metodologia utilizada inclui revisão de literatura específica, abordando temas como intimidade, tecnologia, sociedade em rede, redes sociais na internet, entre outros; e aplicação de uma pesquisa on-line junto aos usuários da rede social digital por intermédio de um questionário. Os resultados obtidos evidenciam que o conceito de intimidade mudou com o surgimento de redes sociais digitais.

Espaces scolaires de la rentrée

DEFF Research Database (Denmark)

Reeh, Henrik

2013-01-01

Bien que dominé par les espaces d’apprentissage et les espaces de représentation, le cadre spatial du lycée moderne comporte une situation intermédiare qui se manifeste à l’accueil des élèves après les vacances d’été. Dans les trois lycées à Copenhague étudiés, cette cérémonie interne a lieu dans...... la salle des fêtes; ensemble, la forme de l’espace et le déroulement de l’accueil résument la particularité pédagogique de chaque établissement. L’étude explore trois architectures scolaires du 20e et du début du 21e siècles, à savoir l’aula du lycée Øregaard (1924), la salle de concert du lycée...

Learning Methodology for Early Child Education Education (Paud) in the Recognition of Legal Capitals based on Android

Science.gov (United States)

Siswanto, Didik

2017-12-01

School as a place to study require a medium of learning. Instructional media containinginformation about the lessons that will be used by teachers to convey a lesson. School early childhood education Al-Kindy Pekanbaru interms of learning the letter hijaiyah still use conventional learning media. But with the conventionalmedia is not very attractive to use, so the need for an exciting learning medium that can make childrenbecome interested in learningThe purpose of this study was to create a Media Learning Introduction Letter Hijaiyahmultimedia form and benefit from the introduction of letters Hijaiyah Learning Media is a renewal of themedium of learning in School early childhood education Al-Kindy Pekanbaru.In this study the authors tried to make the learning application that contains the basicknowledge of letters hijaiyah dsertai with animation, audio and explanation how to read the letters inorder to complete the learning media letters hijaiyah more interactive.

Genetic and Quantitative Trait Locus Analysis for Bio-Oil Compounds after Fast Pyrolysis in Maize Cobs.

Directory of Open Access Journals (Sweden)

Brandon Jeffrey

Full Text Available Fast pyrolysis has been identified as one of the biorenewable conversion platforms that could be a part of an alternative energy future, but it has not yet received the same attention as cellulosic ethanol in the analysis of genetic inheritance within potential feedstocks such as maize. Ten bio-oil compounds were measured via pyrolysis/gas chromatography-mass spectrometry (Py/GC-MS in maize cobs. 184 recombinant inbred lines (RILs of the intermated B73 x Mo17 (IBM Syn4 population were analyzed in two environments, using 1339 markers, for quantitative trait locus (QTL mapping. QTL mapping was performed using composite interval mapping with significance thresholds established by 1000 permutations at α = 0.05. 50 QTL were found in total across those ten traits with R2 values ranging from 1.7 to 5.8%, indicating a complex quantitative inheritance of these traits.

Doenças das crianças goianas no século XIX. Os registros de óbitos do Hospital de Caridade São Pedro de Alcântara

Directory of Open Access Journals (Sweden)

Sônia Maria de Magalhães

2013-08-01

Full Text Available Recuperar a história da infância no Brasil constitui-se numa tarefa árdua empreendida pelos historiadores desde as últimas décadas do século XX. As pesquisas desenvolvidas buscam dar voz aos meninos e meninas por intermédio da pesquisa e da revalorização do documento histórico. Apesar dos grandes avanços, pouco se conhece sobre os jogos e brincadeiras, a literatura infantil, a saúde e a educação. Deste modo, este estudo propende a municiar subsídios sobre as doenças e a alimentação das crianças do interior do Brasil no século XIX, a partir dos registros de óbitos emitidos pelo Hospital de Caridade São Pedro de Alcântara da cidade de Goiás.

Macroeconomics in develpoing countries

Directory of Open Access Journals (Sweden)

Deepak Nayyar

2007-09-01

Full Text Available This essay analyzes the differences between the economies of industrialized countriesand developing countries, which have important implications for macroeconomics interms of theory and policy. It considers the differences in macroeconomic objectives andexamines why the reach of macroeconomic policies is different in the two sets ofcountries. It argues that the distinction between short-run macroeconomic models andlong-term growth models is not quite appropriate for developing countries, wheremacroeconomic constraints on growth straddle time horizons and short-term policieshave long-term consequences. The essential hypothesis is that the nature of relationshipsand the direction of causation in macroeconomics, which shape analysis, diagnosis andprescription, depend on the institutional setting and not the analytical structure of models.And even if some laws of economics are universal, the functioning of economies can bemarkedly different. Therefore, economic theory and policy analysis should recognize,rather than ignore, such myriad differences.

GESTÃO COM PESSOAS E SUBJETIVIDADE

Directory of Open Access Journals (Sweden)

Leila do Nascimento Chiodi

2015-09-01

No mundo atual, vemos convergir vários processos econômicos, sociais, políticos e culturais que afetam as relações humanas. A economia globalizada mistura-se ao contexto e ideologias que se destacaram em momentos socioeconômicos específicos. A organização taylorista do trabalho que sustenta o controle/prescrição não dá conta da necessidade de inovação para manter a competitividade. A globalização da economia vem exigindo o desenvolvimento de potencialidades no trabalhador que são inerentes à sua subjetividade, porém é possível sentir os reflexos da negação da subjetividade, na tentativa de suprimir a interioridade do homem, por intermédio da exigência de frieza e racionalidade na resolução dos problemas nas organizações contemporâneas.

Un homme, deux cultures: Charles de Villers entre France et Allemagne, 1765-1815

Directory of Open Access Journals (Sweden)

Monique Bernard

2016-03-01

Full Text Available Les 25 et 26 juin 2015 s’est tenu à l’université de Lorraine à Metz un colloque international réunissant des universitaires français et allemands autour de la figure de Charles de Villers, intermédiaire culturel souvent méconnu entre la France et l’Allemagne, né en 1765 à Boulay, Lorraine, et décédé en 1815 à Göttingen, où il fut professeur dans les dernières années de sa vie. Le bicentenaire de sa mort – ainsi que le 250e anniversaire de sa naissance – furent l’occasion de cette rencontre franco-allemande, organisée conjointement par Nicolas Brucker, initiateur de ce projet, de l’Université de Lorraine à Metz, et Franziska Meier, de la Georg-August-Universität à Göttingen.

High-level language computer architecture

CERN Document Server

Chu, Yaohan

1975-01-01

High-Level Language Computer Architecture offers a tutorial on high-level language computer architecture, including von Neumann architecture and syntax-oriented architecture as well as direct and indirect execution architecture. Design concepts of Japanese-language data processing systems are discussed, along with the architecture of stack machines and the SYMBOL computer system. The conceptual design of a direct high-level language processor is also described.Comprised of seven chapters, this book first presents a classification of high-level language computer architecture according to the pr

Nucleonic level control in industries

International Nuclear Information System (INIS)

Eapen, A.C.; Rao, S.S.; Nair, R.S.

1979-01-01

The paper elicits the particular advantages of nucleonic level control methods in certain applications. The technique used is described briefly. Normal radioactive sources used and their selection for any application based on their characteristic emissions is explained. Level controller developed by the Bhabha Atomic Research Centre, Bombay, is described including details regarding electronic circuitry and the radiation detector used. Its application in zinc powder plant to measure powder level in a hopper is described. Some of the typical applications of gamma-ray level controllers are mentioned. (auth.)

Other-than-high-level waste

International Nuclear Information System (INIS)

Bray, G.R.

1976-01-01

The main emphasis of the work in the area of partitioning transuranic elements from waste has been in the area of high-level liquid waste. But there are ''other-than-high-level wastes'' generated by the back end of the nuclear fuel cycle that are both large in volume and contaminated with significant quantities of transuranic elements. The combined volume of these other wastes is approximately 50 times that of the solidified high-level waste. These other wastes also contain up to 75% of the transuranic elements associated with waste generated by the back end of the fuel cycle. Therefore, any detailed evaluation of partitioning as a viable waste management option must address both high-level wastes and ''other-than-high-level wastes.''

Street level society

DEFF Research Database (Denmark)

Vinum, Christine; Nissen, Morten

2006-01-01

This paper aims to reflect on research findings from different empirical studies of social work with young drug users and socially excluded young people in Copenhagen. In the paper we account for historical changes in social policy and interventions into young people's drug taking in Copenhagen......, and partly from the decentralizing and specializing efforts characteristic of the Danish welfare state and its institutions. We discuss a general turn towards street level interventions to address the problems of social exclusion, as well as different attempts to create what we term street level heterotopias...

Low level waste disposal

International Nuclear Information System (INIS)

Barthoux, A.

1985-01-01

Final disposal of low level wastes has been carried out for 15 years on the shallow land disposal of the Manche in the north west of France. Final participant in the nuclear energy cycle, ANDRA has set up a new waste management system from the production center (organization of the waste collection) to the disposal site including the setting up of a transport network, the development of assessment, additional conditioning, interim storage, the management of the disposal center, records of the location and characteristics of the disposed wastes, site selection surveys for future disposals and a public information Department. 80 000 waste packages representing a volume of 20 000 m 3 are thus managed and disposed of each year on the shallow land disposal. The disposal of low level wastes is carried out according to their category and activity level: - in tumuli for very low level wastes, - in monoliths, a concrete structure, of the packaging does not provide enough protection against radioactivity [fr

GGDC Productivity Level Database : International Comparisons of Output, Inputs and Productivity at the Industry Level

NARCIS (Netherlands)

Inklaar, Robert; Timmer, Marcel P.

2008-01-01

In this paper we introduce the GGDC Productivity Level database. This database provides comparisons of output, inputs and productivity at a detailed industry level for a set of thirty OECD countries. It complements the EU KLEMS growth and productivity accounts by providing comparative levels and

Sea Level Rise Data Discovery

Science.gov (United States)

Quach, N.; Huang, T.; Boening, C.; Gill, K. M.

2016-12-01

Research related to sea level rise crosses multiple disciplines from sea ice to land hydrology. The NASA Sea Level Change Portal (SLCP) is a one-stop source for current sea level change information and data, including interactive tools for accessing and viewing regional data, a virtual dashboard of sea level indicators, and ongoing updates through a suite of editorial products that include content articles, graphics, videos, and animations. The architecture behind the SLCP makes it possible to integrate web content and data relevant to sea level change that are archived across various data centers as well as new data generated by sea level change principal investigators. The Extensible Data Gateway Environment (EDGE) is incorporated into the SLCP architecture to provide a unified platform for web content and science data discovery. EDGE is a data integration platform designed to facilitate high-performance geospatial data discovery and access with the ability to support multi-metadata standard specifications. EDGE has the capability to retrieve data from one or more sources and package the resulting sets into a single response to the requestor. With this unified endpoint, the Data Analysis Tool that is available on the SLCP can retrieve dataset and granule level metadata as well as perform geospatial search on the data. This talk focuses on the architecture that makes it possible to seamlessly integrate and enable discovery of disparate data relevant to sea level rise.

Tile-Level Annotation of Satellite Images Using Multi-Level Max-Margin Discriminative Random Field

Directory of Open Access Journals (Sweden)

Hong Sun

2013-05-01

Full Text Available This paper proposes a multi-level max-margin discriminative analysis (M3DA framework, which takes both coarse and fine semantics into consideration, for the annotation of high-resolution satellite images. In order to generate more discriminative topic-level features, the M3DA uses the maximum entropy discrimination latent Dirichlet Allocation (MedLDA model. Moreover, for improving the spatial coherence of visual words neglected by M3DA, conditional random field (CRF is employed to optimize the soft label field composed of multiple label posteriors. The framework of M3DA enables one to combine word-level features (generated by support vector machines and topic-level features (generated by MedLDA via the bag-of-words representation. The experimental results on high-resolution satellite images have demonstrated that, using the proposed method can not only obtain suitable semantic interpretation, but also improve the annotation performance by taking into account the multi-level semantics and the contextual information.

Achievement Level and Sex Differences in Levels of Interests and the Interest-Educational Choice Relationship

Science.gov (United States)

Schmitt, Neal

1978-01-01

The prediction of level of post-high-school educational choice was investigated using the theme scores of the Strong Vocational Interest Blank, sex and achievement level as predictors. Results indicated significant relationships between interests and educational choice, moderated in some cases by sex and achievement level. (Author)

The Circuit-Level Decoupling Modulation Strategy for Three-Level Neutral-Point-Clamped (TL-NPC) Inverter

DEFF Research Database (Denmark)

Zhang, Zhe; Thomsen, Ole Cornelius; Andersen, Michael A. E.

2011-01-01

In this paper, a circuit-level decoupling modulation strategy is proposed for the three-level (TL) neutral-point-clamped (NPC) inverters. With the proposed modulation scheme, the TL-NPC inverter can be decoupled into two three-level Buck converters in each defined operating section, which makes...

The Sugawara generators at arbitrary level

International Nuclear Information System (INIS)

Gebert, R.W.; Koepsell, K.; Nicolai, H.

1996-04-01

We construct an explicit representation of the Sugawara generators for arbitrary level in terms of the homogeneous Heisenberg subalgebra, which generalizes the well-known expression at level 1. This is achieved by employing a physical vertex operator realization of the affine algebra at arbitrary level, in contrast to the Frenkel-Kac-Segal construction which uses unphysical oscillators and is restricted to level 1. At higher level, the new operators are transcendental functions of DDF oscillators unlike the quadratic expressions for the level-1 generators. An essential new feature of our construction is the appearance, beyond level 1, of new types of poles in the operator product expansions in addition to the ones at coincident points, which entail (controllable) non-localities in our formulas. We demonstrate the utility of the new formalism by explicitly working out some higher-level examples. Our results have important implications for the problem of constructing explicit representations for higher-level root spaces of hyperbolic Kac-Moody algebras, and E 10 in particular. (orig.)

Radioprotection

Energy Technology Data Exchange (ETDEWEB)

Sharma, Rashmi; Tiwari, Ajay [Department of Zoology, Govt. College, Ajmer (India)

2012-07-01

A major feature of all higher eukaryotes is the defined life span of the organism. Radioprotections are substances that protect the cells against Radiation induced damage. Over the past decade interest in evaluating oriental medicinal herbs and edible phytoproducts for use in Cancer preventing strategies is encouraging and emerging as an acceptable approach for controlling the Cancer incidence in many developing countries as well as developed countries. Several experimental evidence has indicated that intake of fruit and vegetables and a number of other dietary items are associated with decreased Cancer incidence. These potential agents either abolish or delay the development of Cancer by interfering with one or more steps in the process of carcinogenesis, such as preventing the activation of carcinogen by increasing detoxification or by blocking the interaction of ultimate carcinogen with cellular macromolecules or suppressing the clonal expansion of neoplastic cells. The potential of using medicinal herbs as Cancer chemo preventive neutraceuticals and functional food is promising. Radioprotective potential of extracts of certain dietary botanicals including Mentha arvensi (field mint), Syzyzium cumini (Jamun), Zingiber officinale (Ginger), Aegle marmelos (Bael), Emblica officianalis (Amla), Aloe vera (Gwar patha), Moringa oleifera (Moringa, Horse Radish Tree), Grewia asiatica (Phalsa), Rosemarinus officinalis (Rosemary), Trigonella foenum-graecum, Ocirnurn sanctum, Phylanthus niruri, Vetiveria zizanioides (vetivergrass), Delbergia sisso oil (Sesame oil) was evaluated. All botanicals tested had shown a very low toxicity. Administration of these botanicals increased the survival of whole body irradiated mice and reduced the symptoms of radiation sickness. (author)

Radioprotection

International Nuclear Information System (INIS)

Sharma, Rashmi; Tiwari, Ajay

2012-01-01

A major feature of all higher eukaryotes is the defined life span of the organism. Radioprotections are substances that protect the cells against Radiation induced damage. Over the past decade interest in evaluating oriental medicinal herbs and edible phytoproducts for use in Cancer preventing strategies is encouraging and emerging as an acceptable approach for controlling the Cancer incidence in many developing countries as well as developed countries. Several experimental evidence has indicated that intake of fruit and vegetables and a number of other dietary items are associated with decreased Cancer incidence. These potential agents either abolish or delay the development of Cancer by interfering with one or more steps in the process of carcinogenesis, such as preventing the activation of carcinogen by increasing detoxification or by blocking the interaction of ultimate carcinogen with cellular macromolecules or suppressing the clonal expansion of neoplastic cells. The potential of using medicinal herbs as Cancer chemo preventive neutraceuticals and functional food is promising. Radioprotective potential of extracts of certain dietary botanicals including Mentha arvensi (field mint), Syzyzium cumini (Jamun), Zingiber officinale (Ginger), Aegle marmelos (Bael), Emblica officianalis (Amla), Aloe vera (Gwar patha), Moringa oleifera (Moringa, Horse Radish Tree), Grewia asiatica (Phalsa), Rosemarinus officinalis (Rosemary), Trigonella foenum-graecum, Ocirnurn sanctum, Phylanthus niruri, Vetiveria zizanioides (vetivergrass), Delbergia sisso oil (Sesame oil) was evaluated. All botanicals tested had shown a very low toxicity. Administration of these botanicals increased the survival of whole body irradiated mice and reduced the symptoms of radiation sickness. (author)