WorldWideScience

Sample records for leaves glycine max

  1. Diversity of endophytic fungi in Glycine max.

    Science.gov (United States)

    Fernandes, Elio Gomes; Pereira, Olinto Liparini; da Silva, Cynthia Cânedo; Bento, Claudia Braga Pereira; de Queiroz, Marisa Vieira

    2015-12-01

    Endophytic fungi are microorganisms that live within plant tissues without causing disease during part of their life cycle. With the isolation and identification of these fungi, new species are being discovered, and ecological relationships with their hosts have also been studied. In Glycine max, limited studies have investigated the isolation and distribution of endophytic fungi throughout leaves and roots. The distribution of these fungi in various plant organs differs in diversity and abundance, even when analyzed using molecular techniques that can evaluate fungal communities in different parts of the plants, such as denaturing gradient gel electrophoresis (DGGE). Our results show there is greater species richness of culturable endophytic filamentous fungi in the leaves G. max as compared to roots. Additionally, the leaves had high values for diversity indices, i.e. Simpsons, Shannon and Equitability. Conversely, dominance index was higher in roots as compared to leaves. The fungi Ampelomyces sp., Cladosporium cladosporioides, Colletotrichum gloeosporioides, Diaporthe helianthi, Guignardia mangiferae and Phoma sp. were more frequently isolated from the leaves, whereas the fungi Fusarium oxysporum, Fusarium solani and Fusarium sp. were prevalent in the roots. However, by evaluating the two communities by DGGE, we concluded that the species richness was higher in the roots than in the leaves. UPGMA analysis showed consistent clustering of isolates; however, the fungus Leptospora rubella, which belongs to the order Dothideales, was grouped among species of the order Pleosporales. The presence of endophytic Fusarium species in G. max roots is unsurprising, since Fusarium spp. isolates have been previously described as endophyte in other reports. However, it remains to be determined whether the G. max Fusarium endophytes are latent pathogens or non-pathogenic forms that benefit the plant. This study provides a broader knowledge of the distribution of the fungal

  2. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial

    OpenAIRE

    Kim, Ji-Eun; Jeon, Seon-Min; Park, Ki Hun; Lee, Woo Song; Jeong, Tae-Sook; McGregor, Robin A; Choi, Myung-Sook

    2011-01-01

    Abstract Background Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML) or Garcinia cambogia extract (GCE) to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial...

  3. Gamma radiation effect on the anatomical structure of soybean (Glycine max. Merr)

    International Nuclear Information System (INIS)

    Bhikuningputra, W.

    1976-01-01

    Gamma radiation effects on soybean plant (Glycine max. Merr) have been studied by using radiation doses of 0, 20, 25, 30, and 35 Krad. Investigation is carried out after each treatment. It proves that each treatment causes different morphological changes on leaves, stems, roots, and fibres of the treated plants. (SMN)

  4. Comparative mapping of the wild perennial Glycine latifolia and soybean (G. max reveals extensive chromosome rearrangements in the genus Glycine.

    Directory of Open Access Journals (Sweden)

    Sungyul Chang

    Full Text Available Soybean (Glycine max L. Mer., like many cultivated crops, has a relatively narrow genetic base and lacks diversity for some economically important traits. Glycine latifolia (Benth. Newell & Hymowitz, one of the 26 perennial wild Glycine species related to soybean in the subgenus Glycine Willd., shows high levels of resistance to multiple soybean pathogens and pests including Alfalfa mosaic virus, Heterodera glycines Ichinohe and Sclerotinia sclerotiorum (Lib. de Bary. However, limited information is available on the genomes of these perennial Glycine species. To generate molecular resources for gene mapping and identification, high-density linkage maps were constructed for G. latifolia using single nucleotide polymorphism (SNP markers generated by genotyping by sequencing and evaluated in an F2 population and confirmed in an F5 population. In each population, greater than 2,300 SNP markers were selected for analysis and segregated to form 20 large linkage groups. Marker orders were similar in the F2 and F5 populations. The relationships between G. latifolia linkage groups and G. max and common bean (Phaseolus vulgaris L. chromosomes were examined by aligning SNP-containing sequences from G. latifolia to the genome sequences of G. max and P. vulgaris. Twelve of the 20 G. latifolia linkage groups were nearly collinear with G. max chromosomes. The remaining eight G. latifolia linkage groups appeared to be products of multiple interchromosomal translocations relative to G. max. Large syntenic blocks also were observed between G. latifolia and P. vulgaris. These experiments are the first to compare genome organizations among annual and perennial Glycine species and common bean. The development of molecular resources for species closely related to G. max provides information into the evolution of genomes within the genus Glycine and tools to identify genes within perennial wild relatives of cultivated soybean that could be beneficial to soybean

  5. Sulphur dioxide metabolism in soy-bean, Glycine max var. biloxi

    International Nuclear Information System (INIS)

    Garsed, S.G.; Read, D.J.

    1977-01-01

    First-trifoliate leaves of soybeans Glycine max (L.) Merr. were exposed to 35 SO 2 in the light or dark, and the chemical distribution of the radioactivity in the source leaves and in the remainder of the plant was determined after 1.5 and 24 h. Only 35 SO 4 2- was found in leachates in the light but substantial quantities of 35 SO 3 2- were present in the dark. Radioactivity was present in all fractions of the source leaves examined (insoluble, centrifuge pellet, soluble protein, chloroform-soluble and water-soluble). The main water-soluble compounds labelled were sulphate >glutathione >cysteine. Small quantities of sulphite were also recovered in the dark but not in the light. The ratio of soluble: insoluble radioactivity in the sink tissues was influenced more by leaf age than by light treatment. Sulphate, glutathione and cysteine were labelled in the petioles of the source leaves and 35 SO 4 2- was found in the nutrient solution after 1.5 h in both treatments. It is concluded that light is not necessary for the reduction of internal 35 SO 2 products. The results are discussed in relation to current knowledge of SO 2 metabolism. (author)

  6. Efficient production of transgenic soybean (Glycine max [L] Merrill ...

    African Journals Online (AJOL)

    Efficient production of transgenic soybean (Glycine max [L] Merrill) plants mediated via whisker-supersonic (WSS) method. MM Khalafalla, HA El-Shemy, SM Rahman, M Teraishi, H Hasegawa, T Terakawa, M Ishimoto ...

  7. Soybean ( Glycine max ) as a versatile biocatalyst for organic ...

    African Journals Online (AJOL)

    A series of aliphatic and aromatic aldehydes and ketones were reduced using plant cell preparations of Glycine max seeds (soybean). The biotransformation of five aromatic aldehydes in water, at room temperature afforded the corresponding alcohols in excellent yields varying from 89 to 100%. Two prochiral aromatic ...

  8. Induced mutation in soybean (Glycine max L.) breeding

    International Nuclear Information System (INIS)

    Tulmann Neto, A.; Menten, J.O.M.; Ando, A.

    1984-01-01

    The induced mutation in soybean (Glycine max, L.) breeding is studied. Seed treatment with gamma-rays or methanesulfonic acid ethyl ester (EMs) is used in the following varieties: Parana, Santa Rosa, UFV-1, Foscarin 31 and IAC-8. The study to obtain resistance to the soybean bud blight virus and mutants resistant to rust was done. Early mutants are also researched. (M.A.C.) [pt

  9. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial

    Directory of Open Access Journals (Sweden)

    Jeong Tae-Sook

    2011-09-01

    Full Text Available Abstract Background Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML or Garcinia cambogia extract (GCE to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial effect on lipid, adipocytokine or antioxidant profiles. Methods Eighty-six overweight subjects (Male:Female = 46:40, age: 20~50 yr, BMI > 23 Results EGML and GCE supplementation failed to promote weight-loss or any clinically significant change in %body fat. The EGML group had lower total cholesterol after 10 weeks compared to the placebo group (p Conclusions Ten weeks of EGML or GCE supplementation did not promote weight-loss or lower total cholesterol in overweight individuals consuming their habitual diet. Although, EGML did increase plasma HDL-C levels which is associated with a lower risk of atherosclerosis.

  10. Reaction of some selected soybean varieties ( Glycine max (L) Merril)

    African Journals Online (AJOL)

    In nematode endemic ecological zones, TGX-1985 – 8F is therefore recommended as it proved to contain some specialized genes that conferred a higher level of tolerance against root- knot nematode, Meloidogyne incognita. Key Words: Glycine max, root – knot nematode, Dominant loci, Mi – 1.2, leucine zipper and R ...

  11. Growth and nitrogen dynamics of glycine max inoculated with bradyrhizobium japonicum and exposed to elevated atmospheric carbon dioxide

    International Nuclear Information System (INIS)

    Rehman, A.; Hamid, N.; Jawaid, F.

    2010-01-01

    Seeds of Glycine max (soybean) were inoculated with N-fixing bacterium Bradyrhizobium japonicum and grown in growth chamber to investigate interactive effects of atmospheric CO/sub 2/ and plants Nitrogen status on root and shoot length and biomass, nodule formation and Nitrogen concentration. Plants were grown with CO/sub 2/ at 3500 and 1000 ppm with or without Bradyrhizobium japonicum inoculation. Root and shoot length and dry mass of Glycine max increased significantly with CO/sub 2/ enrichment provided with Bradyrhizobium japonicum as compared to deficient Nitrogen fixing bacterium. While ambient and enriched CO/sub 2/ levels resulted in increased Nitrogen concentration of Glycine max shoot and root which is inoculated with N-fixing bacterium. Nodule formation was also enhanced in plants supplied with Bradyrhizobium japonicum as compared to plants which is Bradyrhizobium japonicum deficient at both CO/sub 2/ concentrations. (author)

  12. 31P-Nuclear Magnetic Resonance Determination of Phosphate Compartmentation in Leaves of Reproductive Soybeans (Glycine max L.) as Affected by Phosphate Nutrition 1

    Science.gov (United States)

    Lauer, Michael J.; Blevins, Dale G.; Sierzputowska-Gracz, Hanna

    1989-01-01

    Most leaf phosphorus is remobilized to the seed during reproductive development in soybean. We determined, using 31P-NMR, the effect phosphorus remobilization has on vacuolar inorganic phosphate pool size in soybean (Glycine max [L.] Merr.) leaves with respect to phosphorus nutrition and plant development. Phosphate compartmentation between cytoplasmic and vacuolar pools was observed and followed in intact tissue grown hydroponically, at the R2, R4, and R6 growth stages. As phosphorus in the nutrient solution decreased from 0.45 to 0.05 millimolar, the vacuolar phosphate peak became less prominent relative to cytoplasmic phosphate and hexose monophosphate peaks. At a nutrient phosphate concentration of 0.05 millimolar, the vacuolar phosphate peak was not detectable. At higher levels of nutrient phosphate, as plants progressed from the R2 to the R6 growth stage, the vacuolar phosphate peak was the first to disappear, suggesting that storage phosphate was remobilized to a greater extent than metabolic phosphate. Under suboptimal phosphate nutrition (≤ 0.20 millimolar), the hexose monophosphate and cytoplasmic phosphate peaks declined earlier in reproductive development than when phosphate was present in optimal amounts. Under low phosphate concentrations (0.05 millimolar) cytoplasmic phosphate was greatly reduced. Carbon metabolism was coincidently disrupted under low phosphate nutrition as shown by the appearance of large, prominent starch grains in the leaves. Cytoplasmic phosphate, and leaf carbon metabolism dependent on it, are buffered by vacuolar phosphate until late stages of reproductive growth. Images Figure 4 PMID:16666705

  13. Protective effect of Mn(III)-desferrioxamine B upon oxidative stress caused by ozone and acid rain in the Brazilian soybean cultivar Glycine max "Sambaiba".

    Science.gov (United States)

    Esposito, Jéssica Bordotti Nobre; Esposito, Breno Pannia; Azevedo, Ricardo Antunes; Cruz, Luciano Soares; da Silva, Luzimar Campos; de Souza, Silvia Ribeiro

    2015-04-01

    This study aimed to investigate the effects of the Mn complex (Mn(III)-desferrioxamine B (MnDFB)) on oxidative stress in the Brazilian soybean cultivar Glycine max "Sambaiba" following exposure to ozone and acid rain. We determined the suitable dose of MnDFB to apply to G. max seedlings using a dose-response curve. The highest superoxide dismutase (SOD) activity and Mn content in leaves were found upon the application of 8 μM MnDFB. Thus, G. max seedlings pretreated with 8 μM MnDFB were individually exposed to ozone and acid rain simulated. Pretreatment with MnDFB reduced lipid peroxidation upon ozone exposure and increased SOD activity in leaves; it did not alter the metal content in any part of the plant. Conversely, following acid rain exposure, neither the metal content in leaves nor SOD enzyme activity were directly affected by MnDFB, unlike pH. Our findings demonstrated that exogenous MnDFB application before ozone exposure may modulate the MnSOD, Cu/ZnSOD, and FeSOD activities to combat the ROS excess in the cell. Here, we demonstrated that the applied dose of MnDFB enhances antioxidative defenses in soybean following exposure to acid rain and especially to ozone.

  14. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial.

    Science.gov (United States)

    Kim, Ji-Eun; Jeon, Seon-Min; Park, Ki Hun; Lee, Woo Song; Jeong, Tae-Sook; McGregor, Robin A; Choi, Myung-Sook

    2011-09-21

    Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML) or Garcinia cambogia extract (GCE) to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial effect on lipid, adipocytokine or antioxidant profiles. Eighty-six overweight subjects (Male:Female = 46:40, age: 20~50 yr, BMI > 23 GCE (2 g/day) or placebo (starch, 2 g/day) for 10 weeks. At baseline and after 10 weeks, body composition, plasma cholesterol and diet were assessed. Blood analysis was also conducted to examine plasma lipoproteins, triglycerides, adipocytokines and antioxidants. EGML and GCE supplementation failed to promote weight-loss or any clinically significant change in %body fat. The EGML group had lower total cholesterol after 10 weeks compared to the placebo group (p GCE had no effect on triglycerides, non-HDL-C, adipocytokines or antioxidants when compared to placebo supplementation. However, HDL-C was higher in the EGML group (p GCE supplementation did not promote weight-loss or lower total cholesterol in overweight individuals consuming their habitual diet. Although, EGML did increase plasma HDL-C levels which is associated with a lower risk of atherosclerosis.

  15. Distinct transcriptional profiles of ozone stress in soybean (Glycine max) flowers and pods

    Science.gov (United States)

    Tropospheric ozone (O3) is a secondary air pollutant and anthropogenic greenhouse gas. Concentrations of tropospheric O3 ([O3] have more than doubled since the Industrial Revolution, and are high enough to damage plant productivity. Soybean (Glycine max L. Merr.) is the world's most important legume...

  16. Effects of long-term storage on the quality of soybean, Glycine max ...

    African Journals Online (AJOL)

    Soybean, Glycine max (L.) Merrill, is one of the five most important legumes in the tropics and provides the protein eaten by most people in the region. One of the major constraints to soybean production is that the seed quality deteriorates rapidly during storage. This study was undertaken to assess the effect of some storage ...

  17. Sur quelques aspects de la production du soja (Glycine max L. au Congo : essais préliminaires

    Directory of Open Access Journals (Sweden)

    Mandimba, GR.

    1991-01-01

    Full Text Available About some cropping systems of soybean (Glycine max. L. in Congo : first results. Field experiments were conducted to assess the response of soybean Glycine max cv. FN3 to N fertilization and inoculation respectively. In the first experiment, the effects of different levels of N fertilizer (0 ; 20 ; 40 and 80 kg N/ha with or without liming were studied. Soybean podyield were related to N fertilization only when liming was added to the soil In the second one, the effects of four Bradyrhizobium japonicum strains F A3 ; 3-40 ; SA 1 and G3S on nodulation and yields were also studied. Inoculation has significant effect on nodulation and plant top dry weight at full bloom, and seed yield at harvest when compared to the control. However, the Bradyrhizobium japonicum strains tested had various symbiotic effectiveness on Glycine max cv. FN3. In addition, soybean plants inoculated with G3S strain and those fertilized with 100 kg N/ha produced similar seed yield. Our study illustrated that G3S strain had the better adaptability in environmental conditions of Congo soil.

  18. Direct growth of vertically aligned carbon nanotubes on silicon substrate by spray pyrolysis of Glycine max oil

    Directory of Open Access Journals (Sweden)

    K. T. Karthikeyan

    2017-11-01

    Full Text Available Vertically aligned carbon nanotubes have been synthesized by spray pyrolysis from Glycine max oil on silicon substrate using ferrocene as catalyst at 650 °C. Glycine max oil, a plant-based hydrocarbon precursor was used as a source of carbon and argon as a carrier gas. The as-grown vertically aligned carbon nanotubes were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, X-ray diffraction, thermogravimetric analysis, and Raman spectroscopy. Scanning electron microscopic images reveal that the dense bundles of aligned carbon nanotubes. High resolution transmission electron microscopy and Raman spectroscopy observations indicate that as-grown aligned carbon nanotubes are well graphitized.

  19. The antioxidative response system in Glycine max (L.) Merr. exposed to Deltamethrin, a synthetic pyrethroid insecticide

    International Nuclear Information System (INIS)

    Bashir, Fozia; Mahmooduzzafar; Siddiqi, T.O.; Iqbal, Muhammad

    2007-01-01

    Forty-five-day-old plants of Glycine max (soybean) were exposed to several Deltamethrin (synthetic pyrethroid insecticide) concentrations (0.00 %, 0.05 %, 0.10 %, 0.15 % and 0.20 %) through foliar spray in the field conditions. In the treated plants, as observed at the pre-flowering (10 DAT), flowering (45 DAT) and post-flowering (70 DAT) stages, lipid peroxidation, proline content and total glutathione content increased, whereas the total ascorbate content decreased, as compared with the control. Among the enzymatic antioxidants, activity of superoxide dismutase, ascorbate peroxidase and glutathione reductase increased significantly whereas that of catalase declined markedly in relation to increasing concentration of Deltamethrin applied. The changes observed were dose-dependent, showing a strong correlation with the degree of treatment. - The Deltamethrin-induced oxidative stress alters the ascorbate-glutathione cycle in Glycine max

  20. Manganese (Mn) stress toward hyperaccumulators plants combination (HPC) using Jatropha curcas and lamtoro gung (L. leucocephala) in mychorrizal addition on soybean (Glycine max) seedling stage

    Science.gov (United States)

    Darmawan, Tania Sylviana; Zahroh, Tata Taqiyyatuz; Merindasya, Mirza; Masfaridah, Ririn; Hartanti, Dyah Ayu Sri; Arum, Sekar; Nurhatika, Sri; Muhibuddin, Anton; Surtiningsih, Tini; Arifiyanto, Achmad

    2017-06-01

    Heavy metals were a metal bracket which had a specific gravity greater than 5 g / cm3. Manganese was one of them because it has a specific gravity of 7.4 g / cm3. Together with widespread cases of soil contamination caused by heavy metals as well as increased development of the science of breeding ground rapidly, then the alternative rehabilitation techniques were relatively cheap and effective it needs to be developed and even some cases of contaminated management soil using a combination of plants with microorganisms to be more effective. Thus it was necessary to develop research on plants that were able to accumulate heavy metals and other toxic materials, such as Mn so that the land becomes safe for health and the environment. Based on above reason this research aimed to see the influence of hyperaccumulators combination of plants using Jatropha curcas and lamtoro gung (L. leucocephala) in mychorrizal addition to stressed by manganese (Mn) on soybean (Glycine max). Observations of growth, chlorophyll content and heavy metals analysis performed on nine treatments (P1-P9) and one control (P0). The results showed a combination of hyperaccumulators under mychorrizal helped overcome the stress of manganese (Mn) in the leaves of soybean (G. max). It gave an influence on the number of leaves and chlorophyll content of soybean (G. max), but no effect performed on the height and the roots of soybean (G. max). The use of plants in small amounts hyperaccumulators (P1;1 jatropha and 1 lamtoro) was sufficient to cope with stress of Mn in the leaves of soybean (G. max).

  1. Effects of glyphosate on the mineral content of glyphosate-resistant soybeans (Glycine max).

    Science.gov (United States)

    Duke, Stephen O; Reddy, Krishna N; Bu, Kaixuan; Cizdziel, James V

    2012-07-11

    There are conflicting claims as to whether treatment with glyphosate adversely affects mineral nutrition of glyphosate-resistant (GR) crops. Those who have made claims of adverse effects have argued links between reduced Mn and diseases in these crops. This article describes experiments designed to determine the effects of a recommended rate (0.86 kg ha(-1)) of glyphosate applied once or twice on the mineral content of young and mature leaves, as well as in seeds produced by GR soybeans (Glycine max) in both the greenhouse and field using inductively coupled plasma mass spectrometry (ICP-MS). In the greenhouse, there were no effects of either one application (at 3 weeks after planting, WAP) or two applications (at 3 and 6 WAP) of glyphosate on Ca, Mg, Mn, Zn, Fe, Cu, Sr, Ba, Al, Cd, Cr, Co, or Ni content of young or old leaves sampled at 6, 9, and 12 WAP and in harvested seed. Se concentrations were too low for accurate detection in leaves, but there was also no effect of glyphosate applications on Se in the seeds. In the field study, there were no effects of two applications (at 3 and 6 WAP) of glyphosate on Ca, Mg, Mn, Zn, Fe, Cu, Sr, Ba, Al, Cd, Cr, Co, or Ni content of young or old leaves at either 9 or 12 WAP. There was also no effect on Se in the seeds. There was no difference in yield between control and glyphosate-treated GR soybeans in the field. The results indicate that glyphosate does not influence mineral nutrition of GR soybean at recommended rates for weed management in the field. Furthermore, the field studies confirm the results of greenhouse studies.

  2. Redox markers for drought-induced nodule senescence, a process occurring after drought-induced senescence of the lowest leaves in soybean (Glycine max).

    Science.gov (United States)

    Marquez-Garcia, Belén; Shaw, Daniel; Cooper, James William; Karpinska, Barbara; Quain, Marian Dorcas; Makgopa, Eugene Matome; Kunert, Karl; Foyer, Christine Helen

    2015-09-01

    Water is an increasingly scarce resource that limits crop productivity in many parts of the world, and the frequency and severity of drought are predicted to increase as a result of climate change. Improving tolerance to drought stress is therefore important for maximizing future crop yields. The aim of this study was to compare the effects of drought on soybean (Glycine max) leaves and nodules in order to define phenotypic markers and changes in cellular redox state that characterize the stress response in different organs, and to characterize the relationships between leaf and nodule senescence during drought. Leaf and crown nodule metabolite pools were measured together with leaf and soil water contents, and leaf chlorophyll, total protein contents and chlorophyll a fluorescence quenching parameters in nodulated soybeans that were grown under either well-watered conditions or deprived of water for up to 21 d. Ureides, ascorbate, protein, chlorophyll and the ratios of variable chlorophyll a fluorescence (Fv') to maximal chlorophyll a fluorescence (Fm') fell to levels below detection in the oldest leaves after 21 d of drought. While these drought-induced responses were not observed in the youngest leaf ranks, the Fv'/Fm' ratios, pyridine nucleotide levels and the reduction state of the ascorbate pool were lower in all leaf ranks after 21 d of drought. In contrast to leaves, total nodule protein, pyridine nucleotides, ureides, ascorbate and glutathione contents increased as a result of the drought treatment. However, the nodule ascorbate pool was significantly less reduced as a result of drought. Higher levels of transcripts encoding two peroxiredoxins were detected in nodules exposed to drought stress but senescence-associated transcripts and other mRNAs encoding redox-related proteins were similar under both conditions. While the physiological impact of the drought was perceived throughout the shoot, stress-induced senescence occurred only in the oldest

  3. Genetic Analysis of Seed Isoflavones, Protein, and Oil Contents in Soybean [Glycine max (L.) Merr.

    Science.gov (United States)

    2014-09-13

    and My Abdelmajid Kassem. Effect of Two Row Spaces on Several Agronomic Traits in Soy - bean [Glycine max (L.) Merr.], Atlas Journal of Plant Biology... SoyS - NP6K Illumina Infinium BeadChip Genotyping Array , Journal of Plant Genome Sciences (09 2013) Masum Akond1, Shiming Liu2, Melanie Boney1

  4. Growth enhancement of soybean (Glycine max) upon exclusion of UV-B and UV-B/A components of solar radiation: characterization of photosynthetic parameters in leaves.

    Science.gov (United States)

    Guruprasad, Kadur; Kadur, Guruprasad; Bhattacharjee, Swapan; Swapan, Bhattacharjee; Kataria, Sunita; Sunita, Kataria; Yadav, Sanjeev; Sanjeev, Yadav; Tiwari, Arjun; Arjun, Tiwari; Baroniya, Sanjay; Sanjay, Baroniya; Rajiv, Abhinav; Abhinav, Rajiv; Mohanty, Prasanna

    2007-01-01

    Exclusion of UV (280-380 nm) radiation from the solar spectrum can be an important tool to assess the impact of ambient UV radiation on plant growth and performance of crop plants. The effect of exclusion of UV-B and UV-A from solar radiation on the growth and photosynthetic components in soybean (Glycine max) leaves were investigated. Exclusion of solar UV-B and UV-B/A radiation, enhanced the fresh weight, dry weight, leaf area as well as induced a dramatic increase in plant height, which reflected a net increase in biomass. Dry weight increase per unit leaf area was quite significant upon both UV-B and UV-B/A exclusion from the solar spectrum. However, no changes in chlorophyll a and b contents were observed by exclusion of solar UV radiation but the content of carotenoids was significantly (34-46%) lowered. Analysis of chlorophyll (Chl) fluorescence transient parameters of leaf segments suggested no change in the F v/F m value due to UV-B or UV-B/A exclusion. Only a small reduction in photo-oxidized signal I (P700+)/unit Chl was noted. Interestingly the total soluble protein content per unit leaf area increased by 18% in UV-B/A and 40% in UV-B excluded samples, suggesting a unique upregulation of biosynthesis and accumulation of biomass. Solar UV radiation thus seems to primarily affect the photomorphogenic regulatory system that leads to an enhanced growth of leaves and an enhanced rate of net photosynthesis in soybean, a crop plant of economic importance. The presence of ultra-violet components in sunlight seems to arrest carbon sequestration in plants.

  5. Ulex europaeus I and glycine max bind to the human olfactory bulb.

    Science.gov (United States)

    Nagao, M; Oka, N; Kamo, H; Akiguchi, I; Kimura, J

    1993-12-24

    The distribution of binding sites for the fucose-selective lectin Ulex europaeus I and the terminal N-acetylgalactosamine-selective lectin glycine max in the human olfactory bulb were studied. These lectins bound to primary olfactory axons in the olfactory nerve layer and the glomerular layer. They also bound to fibers located in the deeper layers such as the external plexiform layer and the granular layer. Furthermore they projected to the olfactory stalk but not in the cerebrum. The deeper projections of the lectin binding fibers may affect the function of the olfactory bulb in humans.

  6. Soyasaponin Bh, a Triterpene Saponin Containing a Unique Hemiacetal-Functional Five-Membered Ring from Glycine max (Soybeans)

    Science.gov (United States)

    Soybeans (Glycine max L. Merill) and soy-based food products are major dietary sources of saponins. An oleanane triterpenoid saponin, soyasaponin Bh (1) containing a unique five-membered ring with a hemiacetal functionality together with seven known saponins were isolated from soybeans. Their struct...

  7. Enteromorpha intestinalis Derived Seaweed Liquid Fertilizers as Prospective Biostimulant for Glycine max

    Directory of Open Access Journals (Sweden)

    Chetna Mathur

    2015-12-01

    Full Text Available ABSTRACT In the present study, the potential of seaweed liquid fertilizer (SLF of marine algae Enteromorpha intestinalis was evaluated for its effect on seed germination, yield, biochemical parameters and pigment characteristics of Glycine maxE. intestinalis was collected form Mandapam coast of Gulf of Mannar, Tamil Nadu, and the dried seaweeds were used for the preparation of SLF. G. max seeds were germinated with four different concentrations (20, 40, 60, and 100% of SLF; its growth and yield parameters were evaluated and compared with chemical fertilizer and control. The morphological and bio-chemical parameters such as seed germination (100%, root (6.6cm and shoot length (5.4 cm, carbohydrates (0.098 mg/g, protein (0.56 mg/g, pigment (0.444 mg/g chl a; 1.073 mg/g chl b; 3.70 mg/g carotenoids of the plant was found maximum at a concentration of 60% SLF. The phenol content (3.25 mg/g was maximum in 40% SLF. The GC-MS analysis of SLF revealed the presence of notable benzoic compounds involved in plant growth promotion. Results showed thatE. intestinalis derived SLF was potential biostimulant forG. max. Thus, marine algae based fertilizer could be an effective and alternate to the chemical fertilizers emphasizing the need for systematic evaluation programme for SLF on various crops.

  8. Soybean [Glycine max (L.) Merrill] rhizobial diversity in Brazilian oxisols under various soil, cropping, and inoculation managements

    NARCIS (Netherlands)

    Loureiro, M.D.; Kaschuk, G.; Alberton, O.; Hungria, M.

    2007-01-01

    In this study, soybean nodules were collected from 12 sites in the State of Mato Grosso, in the Brazilian Cerrados, where both exotic soybean [Glycine max (L.) Merrill] and bradyrhizobial strains have been introduced from 1 to 18 years before. All soils were originally devoid of rhizobia capable of

  9. RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

    Directory of Open Access Journals (Sweden)

    Severin Andrew J

    2010-08-01

    Full Text Available Abstract Background Next generation sequencing is transforming our understanding of transcriptomes. It can determine the expression level of transcripts with a dynamic range of over six orders of magnitude from multiple tissues, developmental stages or conditions. Patterns of gene expression provide insight into functions of genes with unknown annotation. Results The RNA Seq-Atlas presented here provides a record of high-resolution gene expression in a set of fourteen diverse tissues. Hierarchical clustering of transcriptional profiles for these tissues suggests three clades with similar profiles: aerial, underground and seed tissues. We also investigate the relationship between gene structure and gene expression and find a correlation between gene length and expression. Additionally, we find dramatic tissue-specific gene expression of both the most highly-expressed genes and the genes specific to legumes in seed development and nodule tissues. Analysis of the gene expression profiles of over 2,000 genes with preferential gene expression in seed suggests there are more than 177 genes with functional roles that are involved in the economically important seed filling process. Finally, the Seq-atlas also provides a means of evaluating existing gene model annotations for the Glycine max genome. Conclusions This RNA-Seq atlas extends the analyses of previous gene expression atlases performed using Affymetrix GeneChip technology and provides an example of new methods to accommodate the increase in transcriptome data obtained from next generation sequencing. Data contained within this RNA-Seq atlas of Glycine max can be explored at http://www.soybase.org/soyseq.

  10. Effect of gamma irradiation on microbial load, physicochemical and sensory characteristics of soybeans (Glycine max L. Merrill)

    Science.gov (United States)

    Gamma irradiation is highly effective in inactivating microorganisms in various foods and offers a safe alternative method of food decontamination. In the present study, soybeans (Glycine max L. Merrill) were treated with 0, 1.0, 3.0, 5.0 and 10.0 KGy of gamma irradiation. Microbial populations on s...

  11. Elevated carbon dioxide increases salicylic acid in Glycine max.

    Science.gov (United States)

    Casteel, Clare L; Segal, Lauren M; Niziolek, Olivia K; Berenbaum, May R; DeLucia, Evan H

    2012-12-01

    Concentrations of carbon dioxide (CO(2)) are increasing in the atmosphere, affecting soybean (Glycine max L.) phytohormone signaling and herbivore resistance. Whether the impact of elevated CO(2) on phytohormones and induced defenses is a generalized response within this species is an open question. We examined jasmonic acid (JA) and salicylic acid (SA) under ambient and elevated CO(2) concentrations with and without Japanese beetle (Popillia japonica Newman) damage and artificial damage across six soybean cultivars (HS93-4118, Pana, IA 3010, Loda, LN97-15076, and Dwight). Elevated CO(2) reduced constitutive levels of JA and related transcripts in some but not all soybean cultivars. In contrast to the variation in JA, constitutive levels of salicylic were increased universally among soybean cultivars grown under elevated CO(2). Variation in hormonal signaling may underpin observed variation in the response of insect herbivores and pathogens to plants grown under elevated CO(2).

  12. Intersubgeneric hybridization between Glycine max and G. tomentella: Production of F1, amphidiploid, BC1, BC2 BC3 and fertile soybean plants

    Science.gov (United States)

    The genetic resources of the 26 species of the subgenus Glycine have not been exploited to broaden the genetic base of soybean (Glycine max; 2n = 40). Initially, we hybridized eight soybean cultivars with six accessions of 78- and one accession of 40-chromosome G. tomentella. One accession of G. arg...

  13. Pengaruh Pemberian Pyraclotrobin Terhadap Efisiensi Penyerapan Nitrogen Dan Kualitas Hasil Tanaman Kedelai (Glycine Max L. Merr.)

    OpenAIRE

    Mansur, Mansur; Ashari, Sumeru; Kuswanto, Kuswanto

    2015-01-01

    Kedelai (Glycine max (L.) Merr.) adalah tanaman kacang-kacangan (Leguminosae) yang menjadi komoditas tanaman pangan penting karena tingginya kandungan protein. Penelitian ini dilakukan untuk mengetahui pengaruh pemberian pyraclostrobin terhadap efisiensi penyerapan nitrogen, pertumbuhan tanaman dan hasil tanaman kedelai. Bahan penelitian yang digunakan adalah benih kedelai varietas wilis, pyraclostrobin dan pupuk urea 46% N. Rancangan yang digunakan adalah rancangan tersarang yang terdiri da...

  14. The Effectiveness of Biofertilizer on Plant Growth Soyb Ea N “Edam Am E” (Glycin Max)

    OpenAIRE

    Sudiarti, Diah

    2017-01-01

    This study aimed at determining the effectiveness of biofertilizer with different concentrations on plant growth of soybean “edamame” (glycin max). Biofertilizer in this study consists of microbial consortia (lactobacillus, pseudomonas, bacillus, saccharomyces, rhizobium, azotobacter, azospirillum, and cellulomonas). The treatment consists of 3 biofertilizer concentrations (25%, 50%, dan 75%), as well as the negative control and positive control (100% chemical fertilizer equivalent 5g/plant)....

  15. EFFECTS OF ZEOLITE AND CADMIUM ON GROWTH AND CHEMICAL COMPOSITION OF SOYBEAN (Glycine max L.)

    OpenAIRE

    Mohammad Reza Mahmoodabadi; Abdol-majid Ronaghi; Mehdi Khayyat; Gholamreza Hadarbadi

    2009-01-01

      There are areas in the world which are polluted by trace metals some of which may not be degraded by biotic process. Some of these metals might enter into surface and/or underground water resources thus causing serious human and animal health problems. In recent years, natural amendments, such as the use of zeolite, have been widely used to address trace metals contamination. In the present study the effect of zeolite on the growth and nodulation of soybean (Glycine max L.) was evaluat...

  16. THE EFFECT OF SOME RHIZOBACTERIAN STRAINS ON SOLUBLE PROTEINS CONTENT IN SOYBEANS (GLYCINE MAX L. MERR.

    Directory of Open Access Journals (Sweden)

    Marius Stefan

    2007-08-01

    Full Text Available Now it is an accepted fact that plant growth-promoting rhizobacteria (PGPR can increase the productivity of several crops. The main objective of the present study was to find if there are any differences in protein content in the seeds of soybean (Glycine max L. MERR.. Using spectrophotometric methods for analyzing the protein contents and electrophoretic methods for qualitative analysis it was observed that no major modifications occur in protein spectrum. Looking at the quantitative side there was a small improvement in protein quantity.

  17. High-quality permanent draft genome sequence of the Bradyrhizobium elkanii type strain USDA 76T, isolated from Glycine max (L.) Merr

    Science.gov (United States)

    Bradyrhizobium elkanii USDA 76T (INSCD = ARAG00000000), the type strain for Bradyrhizobium elkanii, is an aerobic, motile, Gram-negative, non-spore-forming rod that was isolated from an effective nitrogen-fixing root nodule of Glycine max (L. Merr) grown in the USA. Because of its significance as a ...

  18. Genome analysis methods: Glycine max [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Glycine max Finished 2n=40 1,115 Mb 2010 Sanger (WGS) 7.53 Gb 937.32 Mb 8.04x Arac... from Arabidopsis, rice and grapevine 46,430 SoyBase; http://soybase.org Gm1.01 Gm1.01 10.1038/nature08670 20075913 ...

  19. Inoculation with Bradyrhizobium japonicum enhances the organic and fatty acids content of soybean (Glycine max (L.) Merrill) seeds.

    Science.gov (United States)

    Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B

    2013-12-15

    Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Biofertilisasi bakteri rhizobium pada tanaman kedelai (Glycine max (L MERR.

    Directory of Open Access Journals (Sweden)

    Tini Surtiningsih

    2012-02-01

    Full Text Available The aim of this research want to know the influence of the addition Rhizobium bacteria species, dose and combination both ofthem, on growth and production of soybean plant (Glycine max (L Merr.. The experimental design of this research was factorial design4×2, 4 species of Rhizobium are R1 = Rhizobium japonicum, R2 = R. phaseoli, R3 = R. leguminosarum, R4 = mixture of R1, R2 andR3, and 2 dose of inoculan Rhizobium (D1 = 5 m/plant, and D2 = 10 ml/plant with 1010 sel bacteria/ml and 5 replications. Independentvariable is species of Rhizobium, dose of inoculan Rhizobium and combination both of them. Dependent variable is dry matter, weightof nodules and dry weight of seeds. The harvest data was analyzed by Kruskal-Wallis Test using 5% level (a = 0.05 followed by Mann-Whitney Test. The result of this research show that species of Rhizobium, dose of inoculan Rhizobium and combination both of thempresent insignificant result (a > 0.05 on soybean growth and production, but the mixture of Rhizobium species with high level doseof bacteria, present better result than single species with low dose of bacteria.

  1. Estudo de competição inter e intraespecífica envolvendo Glycine max (L. Merril e Cyperus rotundus (L., em condições de casa de vegetação Inter and intraspecific competitions studies in Glycine max (L. merril and Cyperus rotundus L., in greenhouse conditions

    Directory of Open Access Journals (Sweden)

    R.A. Pitelli

    1983-12-01

    Full Text Available O presente experimento teve por objetivo estudar os efeitos da competição inter e intraespecífica envolvendo Glycine max (L. Merril e Cyperus rotundus L. sobre as características das plantas e acúmulos de N, P, K, Ca e Mg pelas espécies envolvidas. Para tanto, estipulou-se um tratamento em que se desenvolveram três plantas de Glycine max e outro em que se desenvolveram 3 tubérculos de Cyperus rotundus por vaso. Para estudar os efeitos da competição intraespecífica, em dois outros tratamentos dobraram-se as populações por vaso. No estudo da competição interespecífica permitiu-se o desenvolvimento de três plantas de Glycine max e de três tubérculos de Cyperus rotundus num mesmo vaso. De uma maneira geral, pôde-se observar que principalmente devido às diferenças no hábito de crescimento das duas espécies, a expressão da competição inter e intraespecífica, em cada uma delas, assume aspectos distintos. No caso de Cyperus rotundus, o efeito do dobro da densidade pôde ser compensado, em parte, pela maior produção de manifestações epígeas e de tubérculos, aliados ao maior desenvolvimento dos tubérculos na menor densidade de plantio. No caso da competição interespecífica, os resultados sugerem um efeito decisivo do sombreamento de Leguminosae sobre o comportamento da Cyperaceae. Os padrões de efeitos da competição pelos nutrientes foi determinado também pelas diferenças no recrutamento dos elementos do solo pelas espécies envolvidas.Inter and intraspecific competition studies envolving Glycine max (L. Merril and Cyperus rotundus L. were performed by measuring the effects on the growth and accumulation of N, P, K, Ca and Mg in the plants. The standard number of the plants per pot was three. In the interspecific competition plots three shoots of purple nutsedge and three plants of soybeans were cultivated per pot. In the intraspecific competition studies six shoots or plants per pot of C. rotundus or G. max were

  2. Effects of soil tillage on the energy budget of soybean (Glycine max (L.) Merr.)

    International Nuclear Information System (INIS)

    Casa, R.; Cascio, B. lo

    1997-01-01

    The different terms of the energy budget were measured by the Bowen ratio method on soybean (Glycine max (L.) Merr.) grown on a conventional tillage and a direct drilling system. The differences found in the energy budgets varied according to the degree of fractional ground cover and of soil water availability. Soil heat flux was greater for the direct drilling treatment, although soil heating was slower as compared to the conventional tillage. Comparisons for well watered and dry conditions revealed that the conventional tillage system used as latent heat a fraction of net radiation greater than the direct drilling treatment only in well watered conditions. In dry conditions the differences in latent heat fluxes and canopy resistances between the two tillage systems were smaller [it

  3. Anatomical Study of Somatic Embryogenesis in Glycine max (L. Merrill

    Directory of Open Access Journals (Sweden)

    Juliana Aparecida Fernando

    2002-09-01

    Full Text Available A comparative anatomical analysis of somatic embryogenesis in two soybean (Glycine max (L. Merrill genotypes was carried out. The somatic embryos were originated from cotyledonary explants obtained from immature zygotic embryos. The medium used for somatic embryogenesis induction was Murashige and Skoog, 1962, salts and Gamborg et al., 1968, vitamins (MSB supplemented with 0.8 mg.L-1 of 2,4-D for genotype PI 123439 and 40 mg.L-1 of 2,4-D for ‘Williams 82’. Globular structures, constituted by meristematic cells, originated from subepidermal cell divisions of the cotyledonary mesophyll. In PI 123439, the globular structures presented tracheary differentiation among meristematic cells and they could follow distinct morphogenetic process depending on their location along the explant. For ‘Williams 82’ it was observed globular structures along the cotyledonary explant surface. They gave rise to somatic embryos. These embryos showed different morphologies and they were classified based on their shape and number of cotyledons. The ability of these morphological types to convert to plantlets was discussed.Realizou-se uma análise anatômica comparativa da embriogênese somática em dois genótipos de soja (Glycine max (L. Merrill. Os embriões somáticos foram obtidos a partir de explantes cotiledonares excisados de embriões zigóticos imaturos do genótipo PI 123439, adaptado às condições tropicais, e ‘Williams 82’. O meio utilizado para indução da embriogênese somática constituiu-se de sais de Murashige e Skoog,1962, e vitaminas de Gamborg et al., 1968 (MSB suplementado com 0,8 mg.L-1 de 2,4-D (PI 123439 e 40 mg.L-1 (‘Williams 82’. Estruturas globulares originaram-se a partir de divisões celulares nas camadas subepidérmicas do mesofilo cotiledonar e foram constituídas por células meristemáticas. No genótipo PI 123439, as estruturas globulares apresentaram diferenciação traqueal entre as células meristemáticas e

  4. Identification and colonization of endophytic fungi from soybean (Glycine max (L. Merril under different environmental conditions

    Directory of Open Access Journals (Sweden)

    Ida Chapaval Pimentel

    2006-09-01

    Full Text Available A total of 297 endophytic fungi were isolated from 1728 leaf and stem fragments collected about twenty and forty days after germination from soybean (Glycine max (L. Merril plants grown in the field and a greenhouse. The fungi belonged to eight groups, six dematiaceous genera (Alternaria, Cladosporium, Chaetomium, Curvularia, Drechslera and Scopulariopsis and the non-dematiaceous genera Acremonium, Aspergillus, Colletotrichum, Fusarium, Paecilomyces and Penicillium along with some Mycelia sterilia.. There were qualitative and quantitative differences in the type and number of isolates obtained from greenhouse and field-grown plants, with more isolates being obtained from the latter. No difference was found in the number of fungi isolated from leaves and stems irrespective of where the plants was grown. For was field-grown plants, the number of isolates decreased as the plants aged and more fungi were found in tissues near the soil, while for greenhouse-grown plants the number of isolates increased as the plants aged but in this case no more fungi were isolated from those tissues nearer the soil. These results could have biotechnological relevance for the biological control of pests or plant growth promotion.A partir de 1728 fragmentos de hastes e folhas de soja (Glycine max (L. Merril. provenientes de plantas do campo e de casa de vegetação, coletadas cerca de 20 e 40 dias após a germinação das sementes, 297 fungos endofíticos foram isolados. Os gêneros encontrados foram: Alternaria, Cladosporium, Curvularia, Chaetomium, Scopulariopsis, Drechslera (todos dematiáceos além de Colletotrichum, Fusarium, Acremonium, Aspergillus, Penicillium, Paecilomyces e Mycelia sterilia. Foram detectadas diferenças qualitativas e quantitativas entre os isolados, em relação a micobiota de hospedeiros provenientes do campo e de casa de vegetação com maior frequência de fungos isolados de plantas no campo em comparação com as de casa de vegeta

  5. Metabolic and Transcriptional Reprogramming in Developing Soybean (Glycine max Embryos

    Directory of Open Access Journals (Sweden)

    Ruth Grene

    2013-05-01

    Full Text Available Soybean (Glycine max seeds are an important source of seed storage compounds, including protein, oil, and sugar used for food, feed, chemical, and biofuel production. We assessed detailed temporal transcriptional and metabolic changes in developing soybean embryos to gain a systems biology view of developmental and metabolic changes and to identify potential targets for metabolic engineering. Two major developmental and metabolic transitions were captured enabling identification of potential metabolic engineering targets specific to seed filling and to desiccation. The first transition involved a switch between different types of metabolism in dividing and elongating cells. The second transition involved the onset of maturation and desiccation tolerance during seed filling and a switch from photoheterotrophic to heterotrophic metabolism. Clustering analyses of metabolite and transcript data revealed clusters of functionally related metabolites and transcripts active in these different developmental and metabolic programs. The gene clusters provide a resource to generate predictions about the associations and interactions of unknown regulators with their targets based on “guilt-by-association” relationships. The inferred regulators also represent potential targets for future metabolic engineering of relevant pathways and steps in central carbon and nitrogen metabolism in soybean embryos and drought and desiccation tolerance in plants.

  6. Genome-wide identification and evolution of the PIN-FORMED (PIN) gene family in Glycine max.

    Science.gov (United States)

    Liu, Yuan; Wei, Haichao

    2017-07-01

    Soybean (Glycine max) is one of the most important crop plants. Wild and cultivated soybean varieties have significant differences worth further investigation, such as plant morphology, seed size, and seed coat development; these characters may be related to auxin biology. The PIN gene family encodes essential transport proteins in cell-to-cell auxin transport, but little research on soybean PIN genes (GmPIN genes) has been done, especially with respect to the evolution and differences between wild and cultivated soybean. In this study, we retrieved 23 GmPIN genes from the latest updated G. max genome database; six GmPIN protein sequences were changed compared with the previous database. Based on the Plant Genome Duplication Database, 18 GmPIN genes have been involved in segment duplication. Three pairs of GmPIN genes arose after the second soybean genome duplication, and six occurred after the first genome duplication. The duplicated GmPIN genes retained similar expression patterns. All the duplicated GmPIN genes experienced purifying selection (K a /K s genome sequence of 17 wild and 14 cultivated soybean varieties. Our research provides useful and comprehensive basic information for understanding GmPIN genes.

  7. KARAKTER FENOTIP KEDELAI (Glycine max (L. Merr. HASIL POLIPLOIDISASI DENGAN KOLKISIN

    Directory of Open Access Journals (Sweden)

    Irma Nofitahesti

    2016-12-01

    Full Text Available Abstract - Soybean (Glycine max (L. Merr is one of the most important food commodity to fulfill the protein necessity in Indonesia. Although Indonesia has many prime soybean seeds, it cannot fulfill the whole need of soybean and always rely on soybean import. This problem can be solved by increasing the quality and productivity of prime soybean seed by polyploidization with colchicine. This research aimed to study ploidy level and phenotype characters of Anjasmoro soybean which was induced by colchicine. The phenotype characters in this research were stomata size, plant height, total pod in one plant, total seed in one plant, weight of 100 seeds, flowering time, and ripening time of soybean. The ploidy level was analyzed with flow cytometry methode. The data was analyzed with one way ANOVA and Duncan test in SPSS 22 program. The result of this research showed that Anjasmoro soybean did not successfully induced by colchicine using concentration 0.01%, 0.02%, 0.025%, 0.05%, 0.075%, 0.1%, 0.15%, 0.2%, and 0.25% with duration of treatment 6, 8, 10, 12, 16, 18, and 24 hours. The treatment with colchicine concentration 0.01% and 0.02% with duration of treatment 10 hours effected the increasing of stomata size, the plant height, and the weight of 100 seeds.Key words : Soybean, polyploidization, colchicine, phenotypeAbstrak - Kedelai (Glycine max (L. Merr merupakan salah satu komoditas pangan penting sebagai sumber protein nabati yang kebutuhannya selalu mengalami peningkatan di Indonesia. Meskipun saat ini Indonesia memiliki banyak varietas kedelai unggul, namun Indonesia masih belum mampu mencukupi kebutuhan kedelai nasional sehingga terus bergantung pada impor kedelai. Permasalahan ini dapat diatasi dengan meningkatkan kualitas dan produktivitas varietas kedelai unggul yang sudah ada melalui teknik poliploidisasi dengan kolkisin. Penelitian ini bertujuan untuk mengetahui derajat ploidi dan karakter fenotip pada kedelai Anjasmoro yang diinduksi dengan

  8. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress

    OpenAIRE

    Bilal, Saqib; Khan, Abdul L.; Shahzad, Raheem; Asaf, Sajjad; Kang, Sang-Mo; Lee, In-Jung

    2017-01-01

    This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum, Paecilomyces formosus, Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean) in response to dose-dependent increases in soil Ni (0.5, 1.0, and ...

  9. Assessing the effects of cultivating genetically modified glyphosate-tolerant varieties of soybeans (Glycine max (L.) Merr.) on populations of field arthropods.

    Science.gov (United States)

    Imura, Osamu; Shi, Kun; Iimura, Keiji; Takamizo, Tadashi

    2010-01-01

    We assessed the effects of cultivating two genetically modified (GM) glyphosate-tolerant soybean varieties (Glycine max (L.) Merr.) derived from Event 40-3-2 and a Japanese conventional variety on arthropods under field conditions, with weed control using glyphosate and conventional weed control for two years. Plant height and dry weight of the conventional variety were significantly larger than those of the GM varieties, but the GM varieties bore more pods than the conventional variety. We found arthropods of nine taxonomic orders (Araneae, Acari, Thysanoptera, Homoptera, Heteroptera, Coleoptera, Diptera, Lepidoptera, and Hymenoptera) on the plants. The arthropod incidence (number per plant unit weight pooled for each taxonomic order) on the soybean stems and leaves generally did not differ significantly between the GM and conventional varieties. However, the incidence of Thysanoptera and total incidence (all orders combined) were greater on the GM variety in the second year. The weed control regimes had no significant influence on the arthropod incidence on the soybean stems and leaves. The number of flower-inhabiting Thysanoptera (the dominant arthropod in the flowers) was not significantly different between the GM and conventional varieties. Asphondylia yushimai (Diptera, Cecidomyiidae) was more numerous on the pods of the GM variety in both years. Neither the soybean variety nor the weed control regime significantly affected the density of soil macro-organisms. However, the glyphosate weed control affected arthropods between the rows of plants by decreasing the abundances of Homoptera, Heteroptera, Coleoptera and Lepidoptera, and diversity of arthropods. © ISBR, EDP Sciences, 2011.

  10. Effects of rotation of cotton (Gossypium hirsutum L.) and soybean [Glycine max (L.) Merr.] crops on soil fertility in Elizabeth, Mississippi, USA

    OpenAIRE

    H.A., Reddy, K. and Pettigrew, W.T.

    2018-01-01

    The effects of cotton (Gossypium hirsutum L.): soybean [Glycine max (L.) Merr.] rotation on the soil fertility levels are limited. An irrigated soybean: cotton rotation experiment was conducted from 2012 through 2015 near Elizabeth, Mississippi, USA. The crop rotation sequences were included continuous cotton (CCCC), continuous soybean (SSSS), cotton-soybean-cotton-soybean (CSCS), cotton-soybean-soybean-cotton (CSSC), soybean-cotton-cotton-soybean (SCCS), soybean-cotton-soybean-cotton (SCSC)....

  11. Impact of elevated levels of atmospheric CO2 and herbivory on flavonoids of soybean (Glycine max Linnaeus).

    Science.gov (United States)

    O'Neill, Bridget F; Zangerl, Arthur R; Dermody, Orla; Bilgin, Damla D; Casteel, Clare L; Zavala, Jorge A; DeLucia, Evan H; Berenbaum, May R

    2010-01-01

    Atmospheric levels of carbon dioxide (CO2) have been increasing steadily over the last century. Plants grown under elevated CO2 conditions experience physiological changes, particularly in phytochemical content, that can influence their suitability as food for insects. Flavonoids are important plant defense compounds and antioxidants that can have a large effect on leaf palatability and herbivore longevity. In this study, flavonoid content was examined in foliage of soybean (Glycine max Linnaeus) grown under ambient and elevated levels of CO2 and subjected to damage by herbivores in three feeding guilds: leaf skeletonizer (Popillia japonica Newman), leaf chewer (Vanessa cardui Linnaeus), and phloem feeder (Aphis glycines Matsumura). Flavonoid content also was examined in foliage of soybean grown under ambient and elevated levels of O3 and subjected to damage by the leaf skeletonizer P. japonica. The presence of the isoflavones genistein and daidzein and the flavonols quercetin and kaempferol was confirmed in all plants examined, as were their glycosides. All compounds significantly increased in concentration as the growing season progressed. Concentrations of quercetin glycosides were higher in plants grown under elevated levels of CO2. The majority of compounds in foliage were induced in response to leaf skeletonization damage but remained unchanged in response to non-skeletonizing feeding or phloem-feeding. Most compounds increased in concentration in plants grown under elevated levels of O3. Insects feeding on G. max foliage growing under elevated levels of CO2 may derive additional antioxidant benefits from their host plants as a consequence of the change in ratios of flavonoid classes. This nutritional benefit could lead to increased herbivore longevity and increased damage to soybean (and perhaps other crop plants) in the future.

  12. Physicochemical characteristics and functional properties of vitabosa (mucuna deeringiana and soybean (glycine max

    Directory of Open Access Journals (Sweden)

    Sandra Patricia Chaparro Acuña

    2012-03-01

    Full Text Available Physicochemical characteristics and functional properties of vitabosa flour (Mucuna deeringiana and soybean flour (Glycine max were determined. Oil absorption capacity was higher in vitabosa. Water absorption capacity was higher in soy and it was affected by the change in the ionic strength of the medium. Emulsifying Activity (EA decreased with increasing concentration of flour, while Emulsifying Stability (ES showed an increased. EA and ES of flours have more ionic strength in the range between 0.0 and 0.4 M, but it is reduced afterwards with the higher concentration of NaCl. Foaming stability varied with the concentration of flour solution reaching maximum values of 39 and 33% for vitabosa and soybean, respectively at 10% flour concentration.Vitabosa had the best foaming capacity (56% to 0.6 M compared with soybeans (47% to 0.4 M. Maximum capacity of gelation was observed in vitabosa at 10% flour concentration. Increases in ionic strength of the flour solution, at low salt concentrations (<0.4 M, improved the gelation of flours.

  13. The Effect of using Quail Litter Biochar on Soybean (Glycine max L. Merr. Production Efecto del uso de Biocarbón de Lecho de Codorniz en la Producción de Soya (Glycine max L. Merr.

    Directory of Open Access Journals (Sweden)

    Tawadchai Suppadit

    2012-06-01

    Full Text Available Biochars can be used as soil amendments for improving soil properties and crop yield. The objective of this research was to study the plant growth, yield, yield components, and seed quality, including nutrients and heavy metals (Pb, Cd, and Hg, in the soybean plant (Glycine max L. Merr. and soil. The experiment was conducted from September 2010 to January 2011 in a greenhouse located in the Dan Khun Thot District, Nakhon Ratchasima Province, Thailand. The research comprised six treatments with four replicates in a completely randomized design. Quail litter biochar (QLB at rates of 0, 24.6, 49.2, 73.8, 98.4 and 123 g per pot mixture were provided to soybean cv. Chiang Mai 60. The results showed that QLB could be used as a soil fertility improvement and amendment for soybean production with an optimum rate of 98.4 g per pot mixture, which gave the best performance in terms of the number of nodes, height, DM accumulation, total yield, and seed quality. After the experiment, the nutrient contents in the soil increased as the QLB content increased, but the heavy metal residues in the leaves and seeds did not change. However, QLB at levels higher than 98.4 g per pot mixture is not advisable because QLB is alkaline in nature, which may affect soil pH.El biocarbón puede usarse como enmienda para mejorar las propiedades del suelo y el rendimiento del cultivo. El objetivo de esta investigación fue el estudio del crecimiento de la planta, rendimiento y sus características, así como la calidad de semilla, incluyéndose el estudio de nutrientes y metales pesados (Pb, Cd y Hg en la planta de soya (Glycine max L. Merr. y el suelo. La experimentación se realizó en condiciones de invernadero en el distrito de Dan Khun Thot, provincia de Nakhon Ratchasima, Tailandia, entre septiembre del 2010 y enero del 2011. La investigación constó de seis tratamientos con cuatro repeticiones en un diseño completamente al azar. Se administró biocarbón de lecho de

  14. Aboveground feeding by soybean aphid, Aphis glycines, affects soybean cyst nematode, Heterodera glycines, reproduction belowground.

    Directory of Open Access Journals (Sweden)

    Michael T McCarville

    Full Text Available Heterodera glycines is a cyst nematode that causes significant lost soybean yield in the U.S. Recent studies observed the aphid Aphis glycines and H. glycines interacting via their shared host, soybean, Glycine max. A greenhouse experiment was conducted to discern the effect of A. glycines feeding on H. glycines reproduction. An H. glycines-susceptible cultivar, Kenwood 94, and a resistant cultivar, Dekalb 27-52, were grown in H. glycines-infested soil for 30 and 60 d. Ten days after planting, plants were infested with either zero, five, or ten aphids. At 30 and 60 d, the number of H. glycines females and cysts (dead females and the number of eggs within were counted. In general, H. glycines were less abundant on the resistant than the susceptible cultivar, and H. glycines abundance increased from 30 to 60 d. At 30 d, 33% more H. glycines females and eggs were produced on the resistant cultivar in the ten-aphid treatment compared to the zero-aphid treatment. However, at 30 d the susceptible cultivar had 50% fewer H. glycines females and eggs when infested with ten aphids. At 60 d, numbers of H. glycines females and cysts and numbers of eggs on the resistant cultivar were unaffected by A. glycines feeding, while numbers of both were decreased by A. glycines on the susceptible cultivar. These results indicate that A. glycines feeding improves the quality of soybean as a host for H. glycines, but at higher herbivore population densities, this effect is offset by a decrease in resource quantity.

  15. A Novel Sucrose-Regulatory MADS-Box Transcription Factor GmNMHC5 Promotes Root Development and Nodulation in Soybean (Glycine max [L.] Merr.

    Directory of Open Access Journals (Sweden)

    Wei Liu

    2015-08-01

    Full Text Available The MADS-box protein family includes many transcription factors that have a conserved DNA-binding MADS-box domain. The proteins in this family were originally recognized to play prominent roles in floral development. Recent findings, especially with regard to the regulatory roles of the AGL17 subfamily in root development, have greatly broadened their known functions. In this study, a gene from soybean (Glycine max [L.] Merr., GmNMHC5, was cloned from the Zigongdongdou cultivar and identified as a member of the AGL17 subfamily. Real-time fluorescence quantitative PCR analysis showed that GmNMHC5 was expressed at much higher levels in roots and nodules than in other organs. The activation of expression was first examined in leaves and roots, followed by shoot apexes. GmNMHC5 expression levels rose sharply when the plants were treated under short-day conditions (SD and started to pod, whereas low levels were maintained in non-podding plants under long-day conditions (LD. Furthermore, overexpression of GmNMHC5 in transgenic soybean significantly promoted lateral root development and nodule building. Moreover, GmNMHC5 is upregulated by exogenous sucrose. These results indicate that GmNMHC5 can sense the sucrose signal and plays significant roles in lateral root development and nodule building.

  16. Overexpression of Nictaba-Like Lectin Genes from Glycine max Confers Tolerance towards Pseudomonas syringae Infection, Aphid Infestation and Salt Stress in Transgenic Arabidopsis Plants

    Directory of Open Access Journals (Sweden)

    Sofie Van Holle

    2016-10-01

    Full Text Available Plants have evolved a sophisticated immune system that allows them to recognize invading pathogens by specialized receptors. Carbohydrate-binding proteins or lectins are part of this immune system and especially the lectins that reside in the nucleocytoplasmic compartment are known to be implicated in biotic and abiotic stress responses. The class of Nictaba-like lectins (NLL groups all proteins with homology to the tobacco (Nicotiana tabacum lectin, known as a stress-inducible lectin. Here we focus on two Nictaba homologs from soybean (Glycine max, referred to as GmNLL1 and GmNLL2. Confocal laser scanning microscopy of fusion constructs with the green fluorescent protein either transiently expressed in Nicotiana benthamiana leaves or stably transformed in tobacco BY-2 suspension cells revealed a nucleocytoplasmic localization for the GmNLLs under study. RT-qPCR analysis of the transcript levels for the Nictaba-like lectins in soybean demonstrated that the genes are expressed in several tissues throughout the development of the plant. Furthermore, it was shown that salt treatment, Phytophthora sojae infection and Aphis glycines infestation trigger the expression of particular NLL genes. Stress experiments with Arabidopsis lines overexpressing the NLLs from soybean yielded an enhanced tolerance of the plant towards bacterial infection (Pseudomonas syringae, insect infestation (Myzus persicae and salinity. Our data showed a better performance of the transgenic lines compared to wild type plants, indicating that the NLLs from soybean are implicated in the stress response. These data can help to further elucidate the physiological importance of the Nictaba-like lectins from soybean, which can ultimately lead to the design of crop plants with a better tolerance to changing environmental conditions.

  17. Studying Plant–Insect Interactions with Solid Phase Microextraction: Screening for Airborne Volatile Emissions Response of Soybeans to the Soybean Aphid, Aphis glycines Matsumura (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Lingshuang Cai

    2015-05-01

    Full Text Available Insects trigger plants to release volatile compounds that mediate the interaction with both pest and beneficial insects. Soybean aphids (Aphis glycines induces soybean (Glycine max leaves to produce volatiles that attract predators of the aphid. In this research, we describe the use of solid-phase microextraction (SPME for extraction of volatiles from A. glycines-infested plant. Objectives were to (1 determine if SPME can be used to collect soybean plant volatiles and to (2 use headspace SPME-GC-MS approach to screen compounds associated with A. glycines-infested soybeans, grown in the laboratory and in the field, to identify previously known and potentially novel chemical markers of infestation. A total of 62 plant volatiles were identified, representing 10 chemical classes. 39 compounds had not been found in previous studies of soybean volatile emissions. 3-hexen-1-ol, dimethyl nonatriene, indole, caryophyllene, benzaldehyde, linalool, methyl salicylate (MeSA, benzene ethanol, and farnesene were considered herbivore-induced plant volatiles (HIPVs. For reproductive field-grown soybeans, three compounds were emitted in greater abundance from leaves infested with A. glycines, cis-3-hexen-1-ol acetate, MeSA and farnesene. In summary, SPME can detect the emission of HIPVs from plants infested with insect herbivores.

  18. Timecourse microarray analyses reveal global changes in gene expression of susceptible Glycine max (soybean) roots during infection by Heterodera glycines (soybean cyst nematode).

    Science.gov (United States)

    Alkharouf, Nadim W; Klink, Vincent P; Chouikha, Imed B; Beard, Hunter S; MacDonald, Margaret H; Meyer, Susan; Knap, Halina T; Khan, Rana; Matthews, Benjamin F

    2006-09-01

    Changes in gene expression within roots of Glycine max (soybean), cv. Kent, susceptible to infection by Heterodera glycines (the soybean cyst nematode [SCN]), at 6, 12, and 24 h, and 2, 4, 6, and 8 days post-inoculation were monitored using microarrays containing more than 6,000 cDNA inserts. Replicate, independent biological samples were examined at each time point. Gene expression was analyzed statistically using T-tests, ANOVA, clustering algorithms, and online analytical processing (OLAP). These analyses allow the user to query the data in several ways without importing the data into third-party software. RT-PCR confirmed that WRKY6 transcription factor, trehalose phosphate synthase, EIF4a, Skp1, and CLB1 were differentially induced across most time-points. Other genes induced across most timepoints included lipoxygenase, calmodulin, phospholipase C, metallothionein-like protein, and chalcone reductase. RT-PCR demonstrated enhanced expression during the first 12 h of infection for Kunitz trypsin inhibitor and sucrose synthase. The stress-related gene, SAM-22, phospholipase D and 12-oxophytodienoate reductase were also induced at the early time-points. At 6 and 8 dpi there was an abundance of transcripts expressed that encoded genes involved in transcription and protein synthesis. Some of those genes included ribosomal proteins, and initiation and elongation factors. Several genes involved in carbon metabolism and transport were also more abundant. Those genes included glyceraldehyde 3-phosphate dehydrogenase, fructose-bisphosphate aldolase and sucrose synthase. These results identified specific changes in gene transcript levels triggered by infection of susceptible soybean roots by SCN.

  19. Identification of Alternaria alternata Mycotoxins by LC-SPE-NMR and Their Cytotoxic Effects to Soybean (Glycine max Cell Suspension Culture

    Directory of Open Access Journals (Sweden)

    Edson Rodrigues-Filho

    2013-02-01

    Full Text Available This present work describes the application of liquid chromatograpy-solid phase extraction-nuclear magnetic resonance spectroscopy to analyse Alternaria alternata crude extracts. Altenusin (1, alternariol (2, 3'-hydroxyalternariol monomethyl ether (3, and alternariol monomethyl ether (4, were separated and identified. High-resolution mass spectrometry confirmed the proposed structures. The cytotoxic effects of these compounds towards plants were determined using soybean (Glycine max cell cultures as a model. EC50 values which range from 0.11 (±0.02 to 4.69 (±0.47 μM showed the high cytotoxicity of these compounds.

  20. Interference of Selected Palmer Amaranth (Amaranthus palmeri Biotypes in Soybean (Glycine max

    Directory of Open Access Journals (Sweden)

    Aman Chandi

    2012-01-01

    Full Text Available Palmer amaranth (Amaranthus palmeri S. Wats. has become difficult to control in row crops due to selection for biotypes that are no longer controlled by acetolactate synthase inhibiting herbicides and/or glyphosate. Early season interference in soybean [Glycine max (L. Merr.] for 40 days after emergence by three glyphosate-resistant (GR and three glyphosate-susceptible (GS Palmer amaranth biotypes from Georgia and North Carolina was compared in the greenhouse. A field experiment over 2 years compared season-long interference of these biotypes in soybean. The six Palmer amaranth biotypes reduced soybean height similarly in the greenhouse but did not affect soybean height in the field. Reduction in soybean fresh weight and dry weight in the greenhouse; and soybean yield in the field varied by Palmer amaranth biotypes. Soybean yield was reduced 21% by Palmer amaranth at the established field density of 0.37 plant m−2. When Palmer amaranth biotypes were grouped by response to glyphosate, the GS group reduced fresh weight, dry weight, and yield of soybean more than the GR group. The results indicate a possible small competitive disadvantage associated with glyphosate resistance, but observed differences among biotypes might also be associated with characteristics within and among biotypes other than glyphosate resistance.

  1. Growth and quality of soybean sprouts (Glycine max L. Merrill) as affected by gamma irradiation

    Science.gov (United States)

    Yun, Juan; Li, Xihong; Fan, Xuetong; Li, Weili; Jiang, Yuqian

    2013-01-01

    In this study, soybean seeds and sprouts (Glycine max L. Merrill) were exposed to radiation doses up to 3.0 kGy. The irradiated and non-irradiated seeds were germinated, and then germination rate, sprouts length, vitamin C content, antioxidants and visual and olfactory quality were determined after irradiation. Results indicated that there was no significant difference in the germination rate and sprouts length between the control and 0.3 kGy treated soybeans, however, the reductions in sprouts length of the 1.0 kGy and 3.0 kGy treated samples were quite significant with reductions of 20.4% and 58.8%, respectively. Irradiated sprouts had similar visual and olfactory quality as the non-irradiated one. Therefore, irradiation of seeds alone would have limited value in terms of commercial use due to reduced germination and length of sprouts. However, irradiation of sprouts at doses up to 3.0 kGy was feasible to enhance microbial safety of sprouts.

  2. Effects of fluoride on mitochondrial activity in higher plants. [Glycine max, Zea mays

    Energy Technology Data Exchange (ETDEWEB)

    Miller, J E; Miller, G W

    1974-01-01

    The effects of fluoride on respiration of plant tissue and mitochondria were investigated. Fumigation of young soybean plants (Glycine max Merr. cm. Hawkeye) with 9-12 ..mu..g x m/sup -3/ HF caused a stimulation of respiration at about 2 days of treatment followed by inhibition 2 days later. Mitochondria isolated from the stimulated tissue had higher respiration rates, greater ATPase activity, and lower P/O ratios, while in mitochondria from inhibited tissue, all three were reduced. Treatment of etiolated soybean hypocotyl sections in Hoagland's solution containing KF for 3 to 10 h only resulted in inhibition of respiration. Mitochondria isolated from this tissue elicited increased respiration rates with malate as substrate and inhibited respiration with succinate. With both substrates respiratory control and ADP/O ratios were decreased. Direct treatment of mitochondria from etiolated soybean hypocotyl tissue with fluoride resulted in inhibition of state 3 respiration and lower ADP/O ratios with the substrates succinate, malate, and NADH. Fluoride was also found to increase the amount of osmotically induced swelling and cause a more rapid leakage of protein with mitochondria isolated from etiolated corn shoots (Zea mays L. cv. Golden Cross Bantam). 40 references, 1 figure, 5 tables.

  3. THE EFFECT OF SPRUCE BARK POLYPHENOLS EXTRACT IN COMBINATION WITH DEUTERIUM DEPLETED WATER (DDW ON GLYCINE MAX L. AND HELIANTHUS ANNUUS L. DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Corneliu Tanase

    2010-09-01

    Full Text Available The aim of this study was to evaluate the effect of spruce bark aqueous extract and deuterium depleted water (DDW as bioregulators on the plant growth Glycine max L. and Helianthus annuus. The following specific parameteres were closely monitorised: germination energy and germination capacity, plants vegetative organelles growth and development and photoassimilatory pigments concentrations. The results have shown that DDW presents different effects depending on tested plant species. In the case of soybean, DDW presented stimulatory effects on both germination energy and capacity, radicles elongation, primary leaves growth and development but inhibitory effects on photoassimilatory pigments. Spruce bark extract reduced the germination capacity of soybean seeds, but accelerated the germination process of sunflower seeds and present stimulatory effects on plantlets biomass accumulation. The combination of DDW with Picea abies polyphenolic extract promoted soybean plantlet elongation, especially the rootlets ones and stimulated green biomass accumulation for both soybean and sunflower plantlets. Analyzing the photoassimilatory pigments concentration for sunflower, it can be observed an increasing trend (almost 100% comparing with control when introduce into the growth medium DDW and P. abies polyphenolic extract. DDW and P. abies bark extract have shown an important role in plant growth and development, improving photoassimiliation process.

  4. Molecular docking of Glycine max and Medicago truncatula ureases with urea; bioinformatics approaches.

    Science.gov (United States)

    Filiz, Ertugrul; Vatansever, Recep; Ozyigit, Ibrahim Ilker

    2016-03-01

    Urease (EC 3.5.1.5) is a nickel-dependent metalloenzyme catalyzing the hydrolysis of urea into ammonia and carbon dioxide. It is present in many bacteria, fungi, yeasts and plants. Most species, with few exceptions, use nickel metalloenzyme urease to hydrolyze urea, which is one of the commonly used nitrogen fertilizer in plant growth thus its enzymatic hydrolysis possesses vital importance in agricultural practices. Considering the essentiality and importance of urea and urease activity in most plants, this study aimed to comparatively investigate the ureases of two important legume species such as Glycine max (soybean) and Medicago truncatula (barrel medic) from Fabaceae family. With additional plant species, primary and secondary structures of 37 plant ureases were comparatively analyzed using various bioinformatics tools. A structure based phylogeny was constructed using predicted 3D models of G. max and M. truncatula, whose crystallographic structures are not available, along with three additional solved urease structures from Canavalia ensiformis (PDB: 4GY7), Bacillus pasteurii (PDB: 4UBP) and Klebsiella aerogenes (PDB: 1FWJ). In addition, urease structures of these species were docked with urea to analyze the binding affinities, interacting amino acids and atom distances in urease-urea complexes. Furthermore, mutable amino acids which could potentially affect the protein active site, stability and flexibility as well as overall protein stability were analyzed in urease structures of G. max and M. truncatula. Plant ureases demonstrated similar physico-chemical properties with 833-878 amino acid residues and 89.39-90.91 kDa molecular weight with mainly acidic (5.15-6.10 pI) nature. Four protein domain structures such as urease gamma, urease beta, urease alpha and amidohydro 1 characterized the plant ureases. Secondary structure of plant ureases also demonstrated conserved protein architecture, with predominantly α-helix and random coil structures. In

  5. Efeito de doses de metribuzin no crescimento e na conversão da energia solar em plantas de soja (Glycine max (L . merrill Effect of metribuzin doses on the growth and solar energy conversion in soybean (Glycine max (L. merrill plants

    Directory of Open Access Journals (Sweden)

    P. J. Silva Neto

    1991-01-01

    Full Text Available O crescimento e a eficiência na conversão da energia solar foram estudados em soja (Glycine max (L. Merri ll, cv. 'Uberaba', cultivada em condições de campo, sob quatro doses de metribuzin (0, 0,35; 0,70 e 1,05 kg i.a.ha-1. O valor máximo da conversão da energia solar foi de 0,75%, para as plantas cultiva das na maior dose do herbicida. Os valores da conversão da energia solar média durante o ciclo da cultura foram 0,32 ; 0,31 ; 0,32 e 0,33%. em ordem crescente de dose do metribuzin. De modo geral, na fase vegetativa as plantas controle apresentaram valores inferiores em todos os valores de crescimento determinados, superando as tratadas com metribuzin somente na fase reprodutiva, mostrando que no período crítico de competição o dano causado pelas plantas daninhas é maior que a possível fitotoxicida de causada pelo metribuzin.Growth analysis and evaluation of solar energy conversion in soybean (Glycine max (L. Merrill, Uberaba unver field conditions and four doses of metribuzin (0,0;0,35; 0,70 and 1,05 kg i.a.ha-1 were performed in this study. Maximum solar energy conversion was 0,75% for pla nts tre ate d wit h 1,05 kg i.a.ha -1 metribuzin. The aver age of solar energy conversion throughout the entire crop cycle were 0,32, 0,31 , 0,32 and 0,33% for the increasing metribuzin doses. In general, the control showed lower figures for all growth values studied than the treated during the vegetative phase. During the reproductive phase, however, they surpassed those tre ated with metribuzin, showing that in the critical period of competition weeds were more harmful than the phytotoxicity produced by metribuzin.

  6. Emisiones de óxido nitroso en un cultivo de soja [Glycine max (L. Merrill]: efecto de la inoculación y de la fertilización nitrógenada Nitrous oxide emission during a soybean [Glycine max (L. Merril] culture: inoculation and nitrogen fertilization effects

    Directory of Open Access Journals (Sweden)

    Ignacio A Ciampitti

    2005-12-01

    Full Text Available El óxido nitroso absorbe radiación infrarroja contribuyendo al efecto invernadero; este gas es producido principalmente en el suelo, mediante los procesos de nitrificación y denitrificación. En un estudio a campo, sobre un suelo Argiudol típico, se evaluó el efecto de la fertilización y la inoculación con Bradyrhizobium japonicum en un cultivo de soja [Glycine max (L. Merrill], sobre las emisiones de óxido nitroso. Los gases se extrajeron de cilindros de PVC y la lectura se realizó con cromatografía gaseosa. Las emisiones presentaron valores crecientes desde la siembra hacia madurez fisiológica del cultivo, para todos los tratamientos; este comportamiento fue concomitante con la evolución presentada por la humedad edáfica. La fertilización nitrogenada aumentó significativamente (PNitrous oxide gas absorbs infrared radiation contributing to the greenhouse effect; this gas is produced mainly in soil, by means of the processes of nitrification and denitrification. In a field study at the FAUBA on a typic Argiudol, we evaluated the effect of fertilization and inoculation with Bradyrhizobium japonicum during a soybean culture [Glycine max (L. Merrill], on nitrous oxide emisión. Gases were sampled with PVC cylinders and were read with gaseous chromatography. Emissions presented increasing values from seeding towards physiological maturity for all treatments; this behavior was similar to the evolution presented by nitrate level and soil moisture. Nitrogen fertilization significantly increased (P<0.05 nitrous oxide emissions and inoculation only had a significant effect with the highest level of fertilization (P=0.09. Plots fertilized at highest dose and inoculated gave the greatest nitrous oxide emissions. The variable that better explains the emissions is the nitrate level (r² = 0.1899; P=0.0231.

  7. Initial organic products of fixation of [13N]dinitrogen by root nodules of soybean (Glycine max)

    International Nuclear Information System (INIS)

    Meeks, J.C.; Wolk, C.P.; Schilling, N.; Shaffer, P.W.; Avissar, Y.; Chien, W.S.

    1978-01-01

    When detached soybean Glycine max (L.) Merr. cv. Hark, nodules assimilate ( 13 N)N 2 , the initial organic product of fixation is glutamine; glutamate becomes more highly radioactive than glutamine within 1 minute; 13 N in alanine becomes detectable at 1 minute of fixation and increases rapidly between 1 and 2 minutes. After 15 minutes of fixation, the major 13 N-labeled organic products in both detached and attached nodules are glutamate and alanine, plus, in the case of attached nodules, an unidentified substance, whereas ( 13 N)glutamine comprises only a small fraction of organic 13 N, and very little 13 N is detected in asparagine. The fixation of ( 13 N)N 2 into organic products was inhibited more than 99 percent by C 2 H 2 (10 percent, v/v). The results support the idea that the glutamine synthetase-glutamate synthase pathway is the primary route for assimilation of fixed nitrogen in soybean nodules

  8. Cytokinin biogeochemistry in relation to leaf senescence. II. The metabolism of 6-benzylaminopurine in soybean leaves and the inhibition of its conjugation

    International Nuclear Information System (INIS)

    Zhang, R.; Letham, D.S.; Wong, O.C.; Nooden, L.D.; Parker, C.W.

    1987-01-01

    The metabolism of [ 3 H]6-benzylamino purine was studied in presenescent and early senescent soybean (Glycine max [L.] Merr.) leaves. In both types of leaves, the metabolism was essentially the same. The principal metabolite was identified as β-(6-benzylaminopurin-9-yl)alanine by mass spectral studies, which included discharge ionization-secondary ion mass spectrometry and pulsed positive ion-negative ion-chemical ionization mass spectrometry. Conversion to this alanine conjugate was found to be inhibited 2,4-dichlorophenoxyacetic acid and 5,7-dichloroindoleacetic acid

  9. Qualidade da aplicação aérea líquida com uma aeronave agrícola experimental na cultura da soja (Glycine Max L. Liquid aerial pesticide application quality with an experimental agricultural aircraft in soybean crop (Glycine Max L.

    Directory of Open Access Journals (Sweden)

    Elton F. dos Reis

    2010-10-01

    Full Text Available Os avanços da tecnologia de aplicação aérea de agroquímicos têm-se dado na direção de redução do volume de calda, o que pode ocasionar má distribuição e consequente deposição irregular. O presente trabalho teve como objetivo avaliar a qualidade da aplicação de calda de pulverização em aplicação aérea, na cultura da soja (Glycine Max L.. Para a aplicação, foi utilizada uma aeronave agrícola experimental, aplicando um volume de calda de 20 L ha-1 . Para a determinação dos volumes depositados nas folhas do terço superior, médio e inferior das plantas de soja, foi utilizado corante alimentício azul brilhante adicionado à calda de pulverização. Estas folhas foram lavadas, e o volume determinado por espectrofotometria. Para a obtenção do espectro de gotas, foram utilizados alvos artificiais constituídos por papel hidrossensível, distribuídos no terço superior e médio das plantas. Os dados foram submetidos à análise de variância de fator único, considerando as diferentes posições na planta, e cartas de controle foram feitas a partir dos limites inferior e superior de controle. A aplicação aérea de calda de pulverização na cultura da soja apresentou menores valores de diâmetro da mediana volumétrica, amplitude relativa e cobertura no terço médio em relação ao terço superior da cultura da soja. Houve menor deposição da calda de pulverização no terço inferior. Os indicadores de cobertura da calda de pulverização demonstraram que a aplicação aérea com a aeronave agrícola experimental avaliada não se encontra sob controle estatístico de processo, ou seja, fora do padrão de qualidade.Advances in aerial pesticide application technology of chemicals have been given in the direction of reducing the syrup volume, which can cause poor distribution and consequent irregular deposition. This study aimed to evaluate the quality of the syrup spray on aerial application in soybean crop (Glycine Max

  10. Optimization of ultrasonic assisted extraction of antioxidants from black soybean (Glycine max var) sprouts using response surface methodology.

    Science.gov (United States)

    Lai, Jixiang; Xin, Can; Zhao, Ya; Feng, Bing; He, Congfen; Dong, Yinmao; Fang, Yun; Wei, Shaomin

    2013-01-16

    Response surface methodology (RSM) using a central composite design (CCD) was employed to optimize the conditions for extraction of antioxidants from black soybean (Glycine max var) sprouts. Three influencing factors: liquid-solid ratio, period of ultrasonic assisted extraction and extraction temperature were investigated in the ultrasonic aqueous extraction. Then Response Surface Methodology (RSM) was applied to optimize the extraction process focused on DPPH radical-scavenging capacity of the antioxidants with respect to the above influencing factors. The best combination of each significant factor was determined by RSM design and optimum pretreatment conditions for maximum radical-scavenging capacity were established to be liquid-solid ratio of 29.19:1, extraction time of 32.13 min, and extraction temperature of 30 °C. Under these conditions, 67.60% of DPPH radical-scavenging capacity was observed experimentally, similar to the theoretical prediction of 66.36%.

  11. First report of the Soybean Cyst Nematode, Heterodera glycines, in New York

    Science.gov (United States)

    The soybean cyst nematode (SCN), Heterodera glycines Ichinohe, is the most damaging pathogen of soybean (Glycine max (L.) Merr.), causing more than $1 billion in yield losses annually in the United States (Koenning and Wrather 2010). The SCN distribution map updated in 2014 showed that SCN were dete...

  12. In silico comparison of transcript abundances during Arabidopsis thaliana and Glycine max resistance to Fusarium virguliforme

    Directory of Open Access Journals (Sweden)

    Iqbal M Javed

    2008-09-01

    Full Text Available Abstract Background Sudden death syndrome (SDS of soybean (Glycine max L. Merr. is an economically important disease, caused by the semi-biotrophic fungus Fusarium solani f. sp. glycines, recently renamed Fusarium virguliforme (Fv. Due to the complexity and length of the soybean-Fusarium interaction, the molecular mechanisms underlying plant resistance and susceptibility to the pathogen are not fully understood. F. virguliforme has a very wide host range for the ability to cause root rot and a very narrow host range for the ability to cause a leaf scorch. Arabidopsis thaliana is a host for many types of phytopathogens including bacteria, fungi, viruses and nematodes. Deciphering the variations among transcript abundances (TAs of functional orthologous genes of soybean and A. thaliana involved in the interaction will provide insights into plant resistance to F. viguliforme. Results In this study, we reported the analyses of microarrays measuring TA in whole plants after A. thaliana cv 'Columbia' was challenged with fungal pathogen F. virguliforme. Infection caused significant variations in TAs. The total number of increased transcripts was nearly four times more than that of decreased transcripts in abundance. A putative resistance pathway involved in responding to the pathogen infection in A. thaliana was identified and compared to that reported in soybean. Conclusion Microarray experiments allow the interrogation of tens of thousands of transcripts simultaneously and thus, the identification of plant pathways is likely to be involved in plant resistance to Fusarial pathogens. Dissection of the set functional orthologous genes between soybean and A. thaliana enabled a broad view of the functional relationships and molecular interactions among plant genes involved in F. virguliforme resistance.

  13. Development of a Competent and Trouble Free DNA Isolation Protocol for Downstream Genetic Analyses in Glycine Species

    Directory of Open Access Journals (Sweden)

    Muhammad Amjad Nawaz

    2016-08-01

    Full Text Available Extraction of deoxyribose nucleic acid (DNA from plants is preliminary step in molecular biology. Fast and cost effective genomic DNA isolation from Glycine species for downstream application is a major bottleneck. Here we report a high throughput and trouble free method for genomic DNA extraction from leaf and seeds of Glycine species with high quality and quantity. Protocol reports the optimization by employing different concentrations of CTAB and PVP in extraction buffer. Efficiency of optimized protocol was compared with frequently used DNA extraction methods. Wide adoptability and utility of this protocol was confirmed by DNA extraction from leaves as well as seeds of G. max, G. soja, G. tomentella and G. latifolia. Extracted DNA was successfully subjected to PCR amplification of five microsatellite markers and four putative glycosyltransferase genes. DNA extraction protocol is reproducible, trouble free, rapid and can be adopted for plant molecular biology applications.

  14. Peran Kedelai (Glycine max L. dalam Pencegahan Apoptosis pada Cedera Jaringan Hati

    Directory of Open Access Journals (Sweden)

    Maya Tejasari

    2013-02-01

    Soy (Glycine max L. Prevent Apoptotic Cells in Liver Tissue Injury Abstract In the state of liver injury by any cause there are numerous apoptotic cells influencing metabolic function of the liver.  Soy isoflavone (Glycine max L. known to have effect that inhibit apoptotic cells in follicle and osteoblast.  The aim of this study is to evaluate whether soy has anti apoptotic effect of  CCl4induced liver  injury in mice. This study use 30 male DDY mice 8─10 weeks old, divided into 6 groups.   Group I acted as positive control, received standard pellet for 3 weeks and induced by 0,2 mLCCl4per oral.  Group II, the negative control, received only standard pellet.  Group III─VI received standard pellet and treated by soybean extract 145.6 mg, 218.4 mg, 291.2 mg and 364 mg per day respectively administrated orally for 3 weeks and then induced by 0.2 ml CCl4 per oral.  After 4 days of CCl4 induced, the effect of soybean extract was evaluated using histo-chemistry evaluation Terminal deoxynucleotidyl transferase-mediated dUTP nick end labeling (TUNEL.  The identification and quantification of the apoptotic cells in mice liver tissue were done using light microscopy and showed that the TUNEL immune-histochemical examination. The results showed that the number of cells undergoing apoptosis in the group treated by soybean extract were less than the group that was not treated. The results enhanced by analysis of varians (ANOVA  between the groups showed a significant difference with p<0.05. In conclusion, soy administrated orally could  prevent apoptotic cells in liver tissue. Key words: Apoptotic, CCl4, isoflavone, liver injury, soybean, TUNEL

  15. Comparative study of the anti-oxidant activity of the total polyphenols extracted from Hibiscus Sabdariffa L., Glycine max L. Merr., yellow tea and red wine through reaction with DPPH free radicals

    Directory of Open Access Journals (Sweden)

    T. Andzi Barhé

    2016-01-01

    Full Text Available The present study is part of the evaluation of extracts of Glycine max L. Merr and Hibiscus L. Sabdariffa as antioxidants. A comparative study was performed with extracts of yellow tea and commercial red wine, two foods known for their antioxidant activity. The method applied is free radical scavenging using the 1,1-diphenyl-2-picrylhydrazyl (DPPH°. The antioxidant properties were identified and measured by the determining the anti-radical activity reducing index, expressed in percentage % RSA (Radical Scavenger Activity, and by the determination of the colouring intensity (IC50. All results are compared to those of ascorbic acid as reference antioxidant. The results indicate the following order for the antioxidant power of the extracts tested. % RSA (tea > % RSA (Glycine max % > RSA (red wine % > RSA (Sabdariffa Hibiscus, and colouring intensities (IC50 ranging from 4.62 μM (ascorbic acid to 1.10 μM (Hibiscus sabdariffa correlated with their chemical structure and the content of phenolic compounds.

  16. MDA and Histologic Profile of Pancreatic Diabetic-Rats Model Administered With Extract of Glycine max (L. Merr.

    Directory of Open Access Journals (Sweden)

    Luh Putu Gina

    2016-03-01

    Full Text Available Diabetes Mellitus is characterized by leveling up glucose in human blood and affects increasing of free radicals in body as well as leading to cellular oxidative stress. Experimentally, this condition is able to be characterized by increasing malondialdehyde (MDA level in cell and histological changing in pancreas appearance. Consumption of antioxidant substances was reported able to reduce the MDA quantity as free radicals. Black soybean or Glycine max (L Merr. was reported contains important antioxidant agents such as anthocyanin and isoflavone. This paper discloses recent investigation on application of black soybean water extract to reduce the MDA level on diabetes mellitus-rat model induced by STZ (DM and also reports the pancreas histological changing of the DM rats. Investigation revealed that black soybean water extract significantly affect decreasing of MDA level by 4.9%, 27.1% and 45.7% in three different doses theraphy (500, 750, and 1000 mg/kg BW. Histologically, it also clearly indicates repairing of pancreas tissue of the DM rats.

  17. Purification and characterization of an iron-induced ferritin from soybean (Glycine max) cell suspensions.

    Science.gov (United States)

    Lescure, A M; Massenet, O; Briat, J F

    1990-11-15

    Ferric citrate induces ferritin synthesis and accumulation in soybean (Glycine max) cell suspension cultures [Proudhon, Briat & Lescure (1989) Plant Physiol. 90, 586-590]. This iron-induced ferritin has been purified from cells grown for 72 h in the presence of either 100 microM- or 500 microM-ferric citrate. It has a molecular mass of about 600 kDa and is built up from a 28 kDa subunit which is recognized by antibodies raised against pea (Pisum sativum) seed ferritin and it has the same N-terminal sequence as this latter, except for residue number 3, which is alanine in pea seed ferritin instead of valine in iron-induced soybean cell ferritin. It contains an average of 1800 atoms of iron per molecule whatever the ferric citrate concentration used to induce its synthesis. It is shown that the presence of 100 microM- or 500 microM-ferric citrate in the culture medium leads respectively to an 11- and 28-fold increase in the total intracellular iron concentration and to a 30- and 60-fold increase in the ferritin concentration. However, the percentage of iron stored in the mineral core of ferritin remains constant whatever the ferric citrate concentration used and represents only 5-6% of cellular iron.

  18. Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).

    Science.gov (United States)

    Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R

    2016-03-01

    Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

  19. Growth and quality of soybean sprouts (Glycine max L. Merrill) as affected by gamma irradiation

    International Nuclear Information System (INIS)

    Yun, Juan; Li, Xihong; Fan, Xuetong; Li, Weili; Jiang, Yuqian

    2013-01-01

    In this study, soybean seeds and sprouts (Glycine max L. Merrill) were exposed to radiation doses up to 3.0 kGy. The irradiated and non-irradiated seeds were germinated, and then germination rate, sprouts length, vitamin C content, antioxidants and visual and olfactory quality were determined after irradiation. Results indicated that there was no significant difference in the germination rate and sprouts length between the control and 0.3 kGy treated soybeans, however, the reductions in sprouts length of the 1.0 kGy and 3.0 kGy treated samples were quite significant with reductions of 20.4% and 58.8%, respectively. Irradiated sprouts had similar visual and olfactory quality as the non-irradiated one. Therefore, irradiation of seeds alone would have limited value in terms of commercial use due to reduced germination and length of sprouts. However, irradiation of sprouts at doses up to 3.0 kGy was feasible to enhance microbial safety of sprouts. - Highlights: ► Investigated the germination rate and the sprouts length after irradiation. ► Indicated the effect of irradiation on the antioxidants of the soybean sprouts. ► Evaluated the visual and olfactory quality of irradiated samples.

  20. Biodegradation of glyphosate in rhizospheric soil cultivated with Glycine max, Canavalia ensiformis e Stizolobium aterrimum Biodegradação de glyphosate em solo rizosférico de Glycine max, Canavalia ensiformis e Stizolobium aterrimum

    Directory of Open Access Journals (Sweden)

    J.B. Santos

    2009-01-01

    Full Text Available Biodegradation of glyphosate was evaluated in rhizospheric soil cultivated with Glycine max (soybean, var. BRS245-RR, Canavalia ensiformis and Stizolobium aterrimum. After these species were cultivated for 60 days, soil samples were collected, placed in flasks and treated with 14C-glyphosate. After 30 days of incubation, the total release rate of C-CO2 was determined along with microbial biomass (MBC, metabolic quotient (qCO2, and degradation percentage of the radio-labeled glyphosate released as 14C-CO2. A higher mass of rhizosphere-associated microorganisms was verified in the soil samples from pots cultivated with soybean, regardless of glyphosate addition. However, in the presence of the herbicide, this characteristic was the most negatively affected. Microorganisms from the C. ensiformis rhizosphere released a lower amount of 14C-CO2, while for those originated from S. aterrimum, the amount released reached 1.3% more than the total carbon derived from the respiratory activity. The rhizospheric soil from S. aterrimum also presented higher glyphosate degradation efficiency per microbial biomass unit. However, considering qCO2, the microbiota of the rhizospheric soil cultivated with soybean was more efficient in herbicide degradation.Avaliou-se neste trabalho a degradação de glyphosate em solo rizosférico proveniente do cultivo de Glycine max (soja var. BRS245-RR, Canavalia ensiformis e Stizolobium aterrimum. Para isso, após o cultivo, em vasos, das citadas espécies por 60 dias, coletaram-se amostras de solo, as quais foram acondicionadas em frascos e tratadas com 14C-glyphosate. Após 32 dias de incubação, foram determinados a taxa de desprendimento total de C-CO2, a biomassa microbiana (MBC, o quociente metabólico (qCO2 e a porcentagem de degradação do glyphosate radiomarcado liberado na forma de 14C-CO2. Verificou-se a maior massa de microrganismos associados à rizosfera em amostras de solo proveniente de vasos cultivados com a

  1. Nutrient Management practices for enhancing Soybean (Glycine max L. production

    Directory of Open Access Journals (Sweden)

    FARID A. HELLAL

    2013-05-01

    La soya (Glycine max L., es el cultivo de legumbres más importante en el mundo. La magnitud de las pérdidas en el rendimientode la soya debido a deficiencias varía dependiendo de los nutrientes. Las deficiencias de N, P, Fe, B y S pueden causar pérdidas en rendimiento de hasta 10 %, 29-45 %, 22-90 %, 100 % y 16-30 %, respectivamente, en la soya dependiendo de la fertilidad del suelo, clima y factores intrínsecos a las plantas. La textura de los suelos utilizados en el cultivo de soya varía entre arenosa y arcillosa. La salinidad del suelo es uno de los mayores factores limitantes en la producción del cultivo en regiones semiáridas, y la salinidad por cloro tiene un mayor efecto en la disminución del rendimiento que la salinidad por sulfatos. Los granos de soya son una gran fuente de energía que contienen 40 % de proteína y 19 % de aceite. El éxito del manejo de nutrientes es maximizar la productividad del cultivo mientras se minimizan los impactos ambientales. Las prácticas de manejo de nutrientes balanceadas y reguladas en el tiempo contribuyen a un crecimiento sostenido del rendimiento y la calidad, influencian la salud de las plantas y reducen los riesgos ambientales. Una nutrición balanceada con fertilizantes minerales puede ayudar en el manejo integrado de plagas para reducir los daños causados por las infestaciones de pestes y enfermedades y reducir los insumos requeridos para su control. Una fertilización balanceada genera mayores ganancias para los agricultores, no necesariamente por reducción de los insumos. El papel de la educación y la extensión en la difusión del conocimiento actual sobre manejo de nutrientes es crucial, desafiante y continuo.

  2. Effects of enhanced UVB on growth and yield of alfalfa (Medic ago Sativa L.) and soybean (Glycine max L.) under field conditions

    International Nuclear Information System (INIS)

    Al-Oudat, M.; Baydoun, S.A.; Mohamad, A.

    1997-04-01

    The effects of 20% increase of UVB on growth and yield of alfalfa (Medicago Sativa L.) and two cultivars of soybean (Glycine Max (L.) Mer) under field conditions have been investigated. The increase of UVB dose ranged between 1.746 and 7.112 J/cm 2 during experiment. The results showed that soybean yield decrease by 16% and 31% in A. 3803 and A. 2522 cultivars respectively, under UVB exposure. The dry weight and leaf area were sensitive in the A. 3803 cultivar, while they were tolerant in the A. 2522 cultivar. Alfalfa response to UVB varied during the different stages of growth, whereas the yield was 12% less in the exposed plants. (author). 21 refs., 17 tabs

  3. Comparative phytochemical profiling of different soybean (Glycine max (L. Merr genotypes using GC–MS

    Directory of Open Access Journals (Sweden)

    Salem S. Alghamdi

    2018-01-01

    Full Text Available This study aimed to estimate the proximate, phenolic and flavonoids contents and phytochemicals present in seeds of twenty four soybeans (Glycine max (L. Merr genotypes to explore their nutritional and medicinal values. Crude protein composition ranged between 35.63 and 43.13% in Argentinian and USA (Clark genotypes, respectively. Total phenolic content varied from 1.15 to 1.77 mg GAE/g, whereas flavonoids varied from 0.68 to 2.13 mg QE/g. The GC–MS analysis resulted identification of 88 compounds categorized into aldehydes (5, ketones (13, alcohols (5, carboxylic acids (7, esters (13, alkanes (2, heterocyclic compounds (19, phenolic compound (9, sugar moiety (7 ether (4 and amide (3, one Alkene and one fatty acid ester. Indonesian genotypes (Ijen and Indo-1 had the highest phenolic compounds than others genotype having antioxidant activities, while the Australian genotype contains the maximum in esters compounds. The major phytocompounds identified in majority of genotypes were Phenol, 2,6-dimethoxy-, 2-Methoxy-4-vinylphenol, 3,5-Dimethoxyacetophenone, 1,2-cyclopentanedione and Hexadecanoic acid, methyl ester. The presence of phytochemicals with strong pharmacological actions like antimicrobial and antioxidants activities could be considered as sources of quality raw materials for food and pharmaceutical industries. This study further set a platform for isolating and understanding the characteristics of each compound for it pharmacological properties.

  4. EFFECTS OF ZEOLITE AND CADMIUM ON GROWTH AND CHEMICAL COMPOSITION OF SOYBEAN (Glycine max L.

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Mahmoodabadi

    2009-04-01

    Full Text Available   There are areas in the world which are polluted by trace metals some of which may not be degraded by biotic process. Some of these metals might enter into surface and/or underground water resources thus causing serious human and animal health problems. In recent years, natural amendments, such as the use of zeolite, have been widely used to address trace metals contamination. In the present study the effect of zeolite on the growth and nodulation of soybean (Glycine max L. was evaluated. Treatments consisted on factorial combination of three levels of zeolite (0, 2 and 5 g kg-1 and three levels of cadmium (0, 10 and 50 mg kg-1. Cadmium application significantly decreased shoot and root dry weight while its concentration in plant parts was increased. In addition, cadmium application decreased number and dry weight of nodules, and N, K, and Mn concentrations. On the other hand, zeolite application markedly increased number and dry weight of nodules and N, P, K concentrations in shoot, Mn and Cu concentrations in shoot and root. The results from the present study can be used for predicting the efficiency of zeolite application for the remediation of contaminated soils.

  5. Efecto de la morfología de los embriones somáticos en la regeneración de plantas de soya (Glycine max L. Merrill)

    OpenAIRE

    Pérez-Pérez, Jorge L.; García-Rodríguez, Lourdes; Veitía-Rodríguez, Novisel; Bermúdes-Caraballoso, Idalmis; Collado-López, Raúl; Torres-Rodríguez, Damaris

    2017-01-01

    Los protocolos establecidos para la regeneración de plantas vía embriogénesis somática en soya (Glycine max L. Merrill), son específicos para un número reducido de cultivares, lo que requiere de nuevos estudios que permitan disponer de protocolos más eficientes y reproducibles en un mayor número de genotipos. Este trabajo tuvo como objetivo determinar el efecto del tipo de morfología de los embriones somáticos en la germinación y conversión a planta en soya cultivar ʻIncasoy-27ʼ. Se emplearon...

  6. Replicon-dependent differentiation of symbiosis-related genes in Sinorhizobium strains nodulating Glycine max.

    Science.gov (United States)

    Guo, Hui Juan; Wang, En Tao; Zhang, Xing Xing; Li, Qin Qin; Zhang, Yan Ming; Tian, Chang Fu; Chen, Wen Xin

    2014-02-01

    In order to investigate the genetic differentiation of Sinorhizobium strains nodulating Glycine max and related microevolutionary mechanisms, three housekeeping genes (SMc00019, truA, and thrA) and 16 symbiosis-related genes on the chromosome (7 genes), pSymA (6 genes), and pSymB (3 genes) were analyzed. Five distinct species were identified among the test strains by calculating the average nucleotide identity (ANI) of SMc00019-truA-thrA: Sinorhizobium fredii, Sinorhizobium sojae, Sinorhizobium sp. I, Sinorhizobium sp. II, and Sinorhizobium sp. III. These species assignments were also supported by population genetics and phylogenetic analyses of housekeeping genes and symbiosis-related genes on the chromosome and pSymB. Different levels of genetic differentiation were observed among these species or different replicons. S. sojae was the most divergent from the other test species and was characterized by its low intraspecies diversity and limited geographic distribution. Intergenic recombination dominated the evolution of 19 genes from different replicons. Intraspecies recombination happened frequently in housekeeping genes and symbiosis-related genes on the chromosome and pSymB, whereas pSymA genes showed a clear pattern of lateral-transfer events between different species. Moreover, pSymA genes were characterized by a lower level of polymorphism and recombination than those on the chromosome and pSymB. Taken together, genes from different replicons of rhizobia might be involved in the establishment of symbiosis with legumes, but these symbiosis-related genes might have evolved differently according to their corresponding replicons.

  7. Atração e penetração de Meloidogyne javanica e Heterodera glycines em raízes excisadas de soja Attraction and penetration of Meloidogyne javanica and Heterodera glycines in excised soybean roots

    Directory of Open Access Journals (Sweden)

    Hercules Diniz Campos

    2011-09-01

    Full Text Available Com vista ao estudo de atração e penetração de Meloidogyne javanica (Treub Chitwood e Heterodera glycines (Ichinoe em soja (Glycine max L., desenvolveu-se uma técnica empregando-se segmento de raiz com 2cm de comprimento. Nos segmentos de raiz de soja infectados, observou-se que a penetração de juvenis de segundo estádio (J2 de M. javanica ocorre pela coifa seguida de migração entre os feixes vasculares do cilindro central. Juvenis de H. glycines penetraram, aproximadamente, 15mm da coifa. A região seccionada da raiz de soja atraiu três vezes mais J2 de M. javanica do que a região da coifa, mas esta não foi tão atrativa para J2 de H. glycines. A obstrução conjunta da coifa e do local seccionado reduziu (83% a penetração de J2, tanto de M. javanica quanto de H. glycines. Quando apenas um desses locais foi obstruído, a outra extremidade livre compensou o processo atrativo. Portanto, as substâncias atrativas são liberadas por essas extremidades. A penetração de J2 de M. javanica foi maior no segmento de raiz quando comparada com a plântula intacta de soja. Entretanto, os J2 de H. glycines penetraram menos em segmentos de raiz e em plântulas sem folhas, quando comparados com plântulas intactas e com as seccionadas no colo. Portanto, na cultivar de soja "Embrapa 20", a atração e os locais de penetração de J2 de H. glycines e M. javanica são diferenciados. Esta técnica poderá ser útil nos estudos de atração e penetração de outros nematoides endoparasitas.To study the attraction and penetration of Meloidogyne javanica (Treub Chitwood and Heterodera glycines (Ichinoe in soybean (Glycine max L., a technique using 2-cm long root segments was developed. In infected soybean root segments penetration of second stage juveniles (J2 of M. javanica occured through the root cap following migration between the vascular bundles of the central cylinder. Juveniles of H. glycines penetrated about 15mm from the root cap. The cut

  8. Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

    Energy Technology Data Exchange (ETDEWEB)

    Murakami, M. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: simple@affrc.go.jp; Ae, N. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: aenoriha@kobe-u.ac.jp; Ishikawa, S. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail: isatoru@niaes.affrc.go.jp

    2007-01-15

    Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg{sup -1}, during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot.

  9. Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

    International Nuclear Information System (INIS)

    Murakami, M.; Ae, N.; Ishikawa, S.

    2007-01-01

    Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg -1 , during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot

  10. Pyridine metabolism and trigonelline synthesis in leaves of the mangrove legume trees Derris indica (Millettia pinnata) and Caesalpinia crista.

    Science.gov (United States)

    Yin, Yuling; Sasamoto, Hamako; Ashihara, Hiroshi

    2011-12-01

    The aim of this study was to reveal the pyridine metabolism in leaves of two mangrove legumes, Derris indica (= Millettia pinnata or Pongamia pinnata) and Caesalpinia crista. Radioactivity from [carbonyl-14C]nicotinamide supplied exogenously to young leaf disks was recovered in nicotinic acid, nicotinic acid mononucleotide, NAD, NADP, nicotinamide mononucleotide and trigonelline. These mangrove species, especially D. indica, have strong ability to convert nicotinamide to trigonelline, but not to nicotinic acid glucoside. The endogenous trigonelline content in leaves of D. indica was more than 830 microg/g dry weight. This value is 5-12 times greater than that in leaves of Glycine max. There was little short-term effect of 250 and 500 mM NaCl (equivalent to ca. 50% and 100% sea water) on nicotinamide metabolism.

  11. VARIATION IN RHIZOBIUM GROWTH DUE TO SEED AND ROOT EXUDATES RELEASED FROM GAMMA IRRADIATED GLYCINE MAX SEEDS

    International Nuclear Information System (INIS)

    KAMEL, H.A.; ASKER, M.M.S

    2008-01-01

    In this study, seeds of Glycine max Giza 122 were irradiated with gamma rays from 60 Co source at various doses (10 to 200 Gy), sterilized and soaked into an aerated solution of CaSO 4 (1 mmol and pH 6.5). The capacities of the released seed exudates (SEs) and root exudates (REs) to promote Rhizobium leguminosarum growth were investigated as well as biochemical analysis of the exudates was carried out. SE of both control and gamma irradiated seeds resulted in a higher Rhizobium population and polysaccharide production than RE. Relative to control, the highly effective doses in Rhizobium growth and polysaccharide production were 25 and 200 Gy; the former was a promoter while the later was an inhibitor. HPLC analysis of soluble carbohydrates revealed the presence of glucose (Glu), rhamnose (Rha) and fructose (Fru) in the SE and RE. Protein content in SE was lower than that in RE; the highest values were due to 10 Gy and 25 Gy in SE and RE, respectively. Free amino acids content in SE was increased up to 25 Gy then decreased while RE was increased by increasing gamma doses from 10 to 200 Gy

  12. Regulation of photosynthesis by end-product accumulation in leaves of plants storing starch, sucrose, and hexose sugars.

    Science.gov (United States)

    Goldschmidt, E E; Huber, S C

    1992-08-01

    In the present study, leaves of different plant species were girdled by the hot wax collar method to prevent export of assimilates. Photosynthetic activity of girdled and control leaves was evaluated 3 to 7 days later by two methods: (a) carbon exchange rate (CER) of attached leaves was determined under ambient CO(2) concentrations using a closed gas system, and (b) maximum photosynthetic capacity (A(max)) was determined under 3% CO(2) with a leaf disc O(2) electrode. Starch, hexoses, and sucrose were determined enzymically. Typical starch storers like soybean (Glycine max L.) (up to 87.5 milligrams of starch per square decimeter in girdled leaves), cotton (Gossypium hirsutum L.), and cucumber (Cucumis sativus L.) responded to 7 days of girdling by increased (80-100%) stomatal resistance (r(s)) and decreased A(max) (>50%). On the other hand, spinach (Spinacia oleracea L.), a typical sucrose storer (up to 160 milligrams of sucrose per square decimeter in girdled leaves), showed only a slight reduction in CER and almost no change in A(max). Intermediate plants like tomato (Lycopersicon esculentum Mill.), sunflower (Helianthus annuus L.), broad bean (Vicia faba L.), bean (Phaseolus vulgaris L.), and pea (Pisum sativum L.), which upon girdling store both starch and sucrose, responded to the girdle by a considerable reduction in CER but only moderate inhibition of A(max), indicating that the observed reduction in CER was primarily a stomatal response. Both the wild-type tobacco (Nicotiana sylvestris) (which upon girdling stored starch and hexoses) and the starchless mutant (which stored only hexoses, up to 90 milligrams per square decimeter) showed 90 to 100% inhibition of CER and approximately 50% inhibition of A(max). In general, excised leaves (6 days) behaved like girdled leaves of the respective species, showing 50% reduction of A(max) in wild-type and starchless N. sylvestris but only slight decline of A(max) in spinach. The results of the present study

  13. HERITABILITAS, NISBAH POTENSI, DAN HETEROSIS KETAHANAN KEDELAI (Glycine max [L.] Merrill TERHADAP SOYBEAN MOSAIC VIRUS

    Directory of Open Access Journals (Sweden)

    Nyimas Sa’diyah

    2016-10-01

    Full Text Available Heritability, potential ratio, and heterosis of soybean (Glycine max [L.] Merrill resistance to soybean mosaic virus. The use of soybean cultivars with resistance to SMV is a way for controlling soybean mosaic disease. The objective of this research was to estimate the disease severity, the narrow sense heritability, potential ratio and heterosis of resistance character and number of pithy pods, number of healthy seeds, and healthy seeds weight per plant of ten F1 populations of soybean crossing result to SMV infection. The experiment was arranged in a randomized complete block design in two replications. Observed characters were disease severity, number of pithy pods, number of healthy seeds, and healthy seeds weight per plant. The result of this research showed that 1 the crossing combinations those which were resistant to SMV (lower disease severity were Yellow Bean x Tanggamus, Tanggamus x Orba, and Tanggamus x Taichung, 2 the narrow sense heritability of disease severity was included in medium criteria, 3 number of pithy pods belonged to high criteria, and 4 number of healthy seeds and healthy seeds weight per plant were included in low criteria. The crossing combinations that had low estimation value of heterosis and heterobeltiosis of resistance to SMV infection were Yellow Bean x Taichung, Bean x Tanggamus and Tanggamus x B3570. Disease severity or resistance to SMV is influenced by genetic and environmental factors.

  14. Population-specific gene expression in the plant pathogenic nematode Heterodera glycines exists prior to infection and during the onset of a resistant or susceptible reaction in the roots of the Glycine max genotype Peking

    Directory of Open Access Journals (Sweden)

    Alkharouf Nadim W

    2009-03-01

    Full Text Available Abstract Background A single Glycine max (soybean genotype (Peking reacts differently to two different populations of Heterodera glycines (soybean cyst nematode within the first twelve hours of infection during resistant (R and susceptible (S reactions. This suggested that H. glycines has population-specific gene expression signatures. A microarray analysis of 7539 probe sets representing 7431 transcripts on the Affymetrix® soybean GeneChip® were used to identify population-specific gene expression signatures in pre-infective second stage larva (pi-L2 prior to their infection of Peking. Other analyses focused on the infective L2 at 12hours post infection (i-L212h, and the infective sedentary stages at 3days post infection (i-L23d and 8days post infection (i-L2/L38d. Results Differential expression and false discovery rate (FDR analyses comparing populations of pi-L2 (i.e., incompatible population, NL1-RHg to compatible population, TN8 identified 71 genes that were induced in NL1-RHg as compared to TN8. These genes included putative gland protein G23G12, putative esophageal gland protein Hgg-20 and arginine kinase. The comparative analysis of pi-L2 identified 44 genes that were suppressed in NL1-RHg as compared to TN8. These genes included a different Hgg-20 gene, an EXPB1 protein and a cuticular collagen. By 12 h, there were 7 induced genes and 0 suppressed genes in NL1-RHg. By 3d, there were 9 induced and 10 suppressed genes in NL1-RHg. Substantial changes in gene expression became evident subsequently. At 8d there were 13 induced genes in NL1-RHg. This included putative gland protein G20E03, ubiquitin extension protein, putative gland protein G30C02 and β-1,4 endoglucanase. However, 1668 genes were found to be suppressed in NL1-RHg. These genes included steroid alpha reductase, serine proteinase and a collagen protein. Conclusion These analyses identify a genetic expression signature for these two populations both prior to and subsequently

  15. Analysis of Gene expression in soybean (Glycine max roots in response to the root knot nematode Meloidogyne incognita using microarrays and KEGG pathways

    Directory of Open Access Journals (Sweden)

    Gamal El-Din Abd El Kader Y

    2011-05-01

    Full Text Available Abstract Background Root-knot nematodes are sedentary endoparasites that can infect more than 3000 plant species. Root-knot nematodes cause an estimated $100 billion annual loss worldwide. For successful establishment of the root-knot nematode in its host plant, it causes dramatic morphological and physiological changes in plant cells. The expression of some plant genes is altered by the nematode as it establishes its feeding site. Results We examined the expression of soybean (Glycine max genes in galls formed in roots by the root-knot nematode, Meloidogyne incognita, 12 days and 10 weeks after infection to understand the effects of infection of roots by M. incognita. Gene expression was monitored using the Affymetrix Soybean GeneChip containing 37,500 G. max probe sets. Gene expression patterns were integrated with biochemical pathways from the Kyoto Encyclopedia of Genes and Genomes using PAICE software. Genes encoding enzymes involved in carbohydrate and cell wall metabolism, cell cycle control and plant defense were altered. Conclusions A number of different soybean genes were identified that were differentially expressed which provided insights into the interaction between M. incognita and soybean and into the formation and maintenance of giant cells. Some of these genes may be candidates for broadening plants resistance to root-knot nematode through over-expression or silencing and require further examination.

  16. Soybean (Glycine max) WRINKLED1 transcription factor, GmWRI1a, positively regulates seed oil accumulation.

    Science.gov (United States)

    Chen, Liang; Zheng, Yuhong; Dong, Zhimin; Meng, Fanfan; Sun, Xingmiao; Fan, Xuhong; Zhang, Yunfeng; Wang, Mingliang; Wang, Shuming

    2018-04-01

    Soybean is the world's most important leguminous crop producing high-quality protein and oil. Elevating oil accumulation in soybean seed is always many researchers' goal. WRINKLED1 (WRI1) encodes a transcription factor of the APETALA2/ethylene responsive element-binding protein (AP2/EREBP) family that plays important roles during plant seed oil accumulation. In this study, we isolated and characterized three distinct orthologues of WRI1 in soybean (Glycine max) that display different organ-specific expression patterns, among which GmWRI1a was highly expressed in maturing soybean seed. Electrophoretic mobility shift assays and yeast one-hybrid experiments demonstrated that the GmWRI1a protein was capable of binding to AW-box, a conserved sequence in the proximal upstream regions of many genes involved in various steps of oil biosynthesis. Transgenic soybean seeds overexpressing GmWRI1a under the control of the seed-specific napin promoter showed the increased total oil and fatty acid content and the changed fatty acid composition. Furthermore, basing on the activated expressions in transgenic soybean seeds and existence of AW-box element in the promoter regions, direct downstream genes of GmWRI1a were identified, and their products were responsible for fatty acid production, elongation, desaturation and export from plastid. We conclude that GmWRI1a transcription factor can positively regulate oil accumulation in soybean seed by a complex gene expression network related to fatty acid biosynthesis.

  17. Effects of inoculation with organic-phosphorus-mineralizing bacteria on soybean (Glycine max) growth and indigenous bacterial community diversity.

    Science.gov (United States)

    Sun, Wei; Qian, Xun; Gu, Jie; Wang, Xiao-Juan; Li, Yang; Duan, Man-Li

    2017-05-01

    Three different organic-phosphorus-mineralizing bacteria (OPMB) strains were inoculated to soil planted with soybean (Glycine max), and their effects on soybean growth and indigenous bacterial community diversity were investigated. Inoculation with Pseudomonas fluorescens Z4-1 and Brevibacillus agri L7-1 increased organic phosphorus degradation by 22% and 30%, respectively, compared with the control at the mature stage. Strains P. fluorescens Z4-1 and B. agri L7-1 significantly improved the soil alkaline phosphatase activity, average well color development, and the soybean root activity. Terminal restriction fragment length polymorphism analysis demonstrated that P. fluorescens Z4-1 and B. agri L7-1 could persist in the soil at relative abundances of 2.0%-6.4% throughout soybean growth. Thus, P. fluorescens Z4-1 and B. agri L7-1 could potentially be used in organic-phosphorus-mineralizing biofertilizers. OPMB inoculation altered the genetic structure of the soil bacterial communities but had no apparent influence on the carbon source utilization profiles of the soil bacterial communities. Principal components analysis showed that the changes in the carbon source utilization profiles of bacterial community depended mainly on the plant growth stages rather than inoculation with OPMB. The results help to understand the evolution of the soil bacterial community after OPMB inoculation.

  18. Yield response of soy bean cultivars (Glycine max [L.] Merrill to the application of different doses of biofertilizer FitoMás–E

    Directory of Open Access Journals (Sweden)

    Yanitza Meriño Hernández

    2015-02-01

    Full Text Available This research was done under field conditions, from December 2012 through February 2013. The objective was to evaluate the yield response of soy bean (Glycine max [L.] Merrill, variety “INCASOY-24”, to the application of different doses of FitoMás-E, in a randomized block experimental design with 4 treatments: T1 (control, T2 (1 L.ha-1, T3 (1.5 L.ha-1 and T4 (2 L.ha-1, and 4 replications. The bioestimulant was applied to foliage early in the morning from the 10th day after germination. The data were analyzed statistically with Statistica, ver. 8.0 software. When the indicators used showed significant differences, the Duncan’s Multiple Range Test was applied to p < 0.05. The results of each evaluated variable showed a significant effect of FitoMás-E on the cultivar. The best results were achieved where the application dose was 1 L.ha-1 (T2.

  19. Genome-wide comparative in silico analysis of the RNA helicase gene family in Zea mays and Glycine max: a comparison with Arabidopsis and Oryza sativa.

    Science.gov (United States)

    Xu, Ruirui; Zhang, Shizhong; Huang, Jinguang; Zheng, Chengchao

    2013-01-01

    RNA helicases are enzymes that are thought to unwind double-stranded RNA molecules in an energy-dependent fashion through the hydrolysis of NTP. RNA helicases are associated with all processes involving RNA molecules, including nuclear transcription, editing, splicing, ribosome biogenesis, RNA export, and organelle gene expression. The involvement of RNA helicase in response to stress and in plant growth and development has been reported previously. While their importance in Arabidopsis and Oryza sativa has been partially studied, the function of RNA helicase proteins is poorly understood in Zea mays and Glycine max. In this study, we identified a total of RNA helicase genes in Arabidopsis and other crop species genome by genome-wide comparative in silico analysis. We classified the RNA helicase genes into three subfamilies according to the structural features of the motif II region, such as DEAD-box, DEAH-box and DExD/H-box, and different species showed different patterns of alternative splicing. Secondly, chromosome location analysis showed that the RNA helicase protein genes were distributed across all chromosomes with different densities in the four species. Thirdly, phylogenetic tree analyses identified the relevant homologs of DEAD-box, DEAH-box and DExD/H-box RNA helicase proteins in each of the four species. Fourthly, microarray expression data showed that many of these predicted RNA helicase genes were expressed in different developmental stages and different tissues under normal growth conditions. Finally, real-time quantitative PCR analysis showed that the expression levels of 10 genes in Arabidopsis and 13 genes in Zea mays were in close agreement with the microarray expression data. To our knowledge, this is the first report of a comparative genome-wide analysis of the RNA helicase gene family in Arabidopsis, Oryza sativa, Zea mays and Glycine max. This study provides valuable information for understanding the classification and putative functions of

  20. Drought resistant of bacteria producing exopolysaccharide and IAA in rhizosphere of soybean plant (Glycine max) in Wonogiri Regency Central Java Indonesia

    Science.gov (United States)

    Susilowati, A.; Puspita, A. A.; Yunus, A.

    2018-03-01

    Drought is one of the main problem which limitating the agriculture productivity in most arid region such as in district Eromoko, Wuryantro and SelogiriWonogiri Central Java Indonesia. Bacteria are able to survive under stress condition by producte exopolysaccharide. This study aims to determine the presence of exopolysaccharide-producing drought-resistant bacteria on rhizosphere of soybean (Glycine max) and to determine the species of bacteria based on 16S rRNA gene. Isolation of bacteria carried out by the spread plate method. The decreased of osmotic potential for screening drought tolerant bacteria according to the previous equation [12]. Selection of exopolysaccharide-producing bacteria on solid media ATCC 14 followed by staining the capsule. 16S rRNA gene amplification performed by PCR using primers of 63f and 1387r. The identificationof the bacteria is determined by comparing the results of DNA sequence similarity with bacteria databank in NCBI database. The results showed 11 isolates were exopolysaccharide-producing drought tolerant bacteria. The identity of the bacteria which found are Bacillus sp, Bacillus licheniformis, Bacillus megaterium and Bacillus pumilus.

  1. Antioxidative Defense Responses to lead-induced Oxidative Stress in Glycine max L. CV. Merrill grown in Different pH Gradient

    Directory of Open Access Journals (Sweden)

    Mishra, Pankaj Kishor

    2013-04-01

    Full Text Available Physiological and biochemical changes as well as the activities of anti-oxidative enzymes under lead (Pb2+ phytotoxicity were investigated in 20 days old soybean (Glycine max L. seedlings grown hydroponically in the laboratory under different pH conditions. The rapid uptake of Pb 2+ was observed immediately after the start of treatment. The quantity of accumulation of Pb2+ was much higher in roots than in shoots, its level rising with increasing pH from 3.0 to 8.0 . Not only that, an oxidative stress conditions were observed due to increased level of superoxide anion radical and hydrogen peroxide in shoots and root cells of 20 days old seedlings when treated with Pb(NO32 at a concentration of 0, 500, 1000 and 2000 μM. Spectrometric assays of seedlings showed increased level of activities of antioxidant enzymes like catalase, peroxidase and glutathione reductase. The presence of thiobarbituric acid reacting substances (TBARS indicates the enhanced lipid peroxidation compared to controls. The alteration in the activities of the antioxidant enzymes and the induction of lipid peroxidation reflects the presence of Pb2+, which may cause oxidative stress.

  2. Effect of soaking and fermentation on content of phenolic compounds of soybean (Glycine max cv. Merit) and mung beans (Vigna radiata [L] Wilczek).

    Science.gov (United States)

    María Landete, José; Hernández, Teresa; Robredo, Sergio; Dueñas, Montserrat; de Las Rivas, Blanca; Estrella, Isabel; Muñoz, Rosario

    2015-03-01

    Mung beans (Vigna radiata [L] Wilczek) purchased from a Spanish company as "green soybeans", showed a different phenolic composition than yellow soybeans (Glycine max cv. Merit). Isoflavones were predominant in yellow soybeans, whereas they were completely absent in the green seeds on which flavanones were predominant. In order to enhance their health benefits, both types of bean were subjected to technological processes, such as soaking and fermentation. Soaking increased malonyl glucoside isoflavone extraction in yellow beans and produced an increase in apigenin derivatives in the green beans. Lactobacillus plantarum CECT 748 T fermentation produced an increase in the bioactivity of both beans since a conversion of glycosylated isoflavones into bioactive aglycones and an increase of the bioactive vitexin was observed in yellow and green beans, respectively. In spite of potential consumer confusion, since soybean and "green soybean" are different legumes, the health benefits of both beans were enhanced by lactic fermentation.

  3. EVALUACIÓN DEL POTENCIAL FORRAJERO DE DIEZ CULTIVARES DE SOYA (Glycine max (L Merr EN VENEZUELA

    Directory of Open Access Journals (Sweden)

    Alexander Hernández

    2013-01-01

    Full Text Available Con el objetivo de evaluar y seleccionar cultivares de soya (Glycine max. (L Merr con fines de forraje, se llevó a cabo un experimento de un diseño en bloques completamente al azar con 6 repeticiones. Los materiales experimentales usados fueron 9 cultivares procedentes del banco de germoplasma de La Fundación DANAC y el cultivar CIGRAS-06 provenientes del Centro de Investigaciones de Granos y Semillas de la UCR. Las variables bajo estudio fueron las relacionadas con la arquitectura de la planta, producción de biomasa total en el estado reproductivo R6, rendimiento de grano y algunas variables bromatológicas. Los análisis estadísticos mostraron diferencias significativas para las variables objeto de estudio. Los cultivares con mayores rendimientos de biomasa fueron CIGRAS-06, FP93-1935, FP93-1924 y FP90-6102 con 17245, 13075, 13066 y 12587 kg.ha-1 de materia seca (MS. Los de mayores contenidos de proteína cruda (PC en las vainas fueron FP90-10205, FP93-1930 y FP92-1904, con 24,2, 23,7 y 21,0%, respectivamente; y a nivel de las hojas los cultivares FP93-1935, FP92-4906 y FP90-7102 con 25,5, 24,9 y 23,0%, respectivamente. Para la producción de grano mostraron alto potencial los cultivares CIGRAS-06, FP93-1924, FP90-6102 y FP90-6103, al superar los 3500 kg.ha-1.

  4. Meta-Analyses of QTLs Associated with Protein and Oil Contents and Compositions in Soybean [Glycine max (L.) Merr.] Seed.

    Science.gov (United States)

    Van, Kyujung; McHale, Leah K

    2017-06-01

    Soybean [ Glycine max (L.) Merr.] is a valuable and nutritious crop in part due to the high protein meal and vegetable oil produced from its seed. Soybean producers desire cultivars with both elevated seed protein and oil concentrations as well as specific amino acid and fatty acid profiles. Numerous studies have identified quantitative trait loci (QTLs) associated with seed composition traits, but validation of these QTLs has rarely been carried out. In this study, we have collected information, including genetic location and additive effects, on each QTL for seed contents of protein and oil, as well as amino acid and fatty acid compositions from over 80 studies. Using BioMercator V. 4.2, a meta-QTL analysis was performed with genetic information comprised of 175 QTLs for protein, 205 QTLs for oil, 156 QTLs for amino acids, and 113 QTLs for fatty acids. A total of 55 meta-QTL for seed composition were detected on 6 out of 20 chromosomes. Meta-QTL possessed narrower confidence intervals than the original QTL and candidate genes were identified within each meta-QTL. These candidate genes elucidate potential natural genetic variation in genes contributing to protein and oil biosynthesis and accumulation, providing meaningful information to further soybean breeding programs.

  5. Elevated Atmospheric CO2 and Drought Affect Soil Microbial Community and Functional Diversity Associated with Glycine max

    Directory of Open Access Journals (Sweden)

    Junfeng Wang

    2017-12-01

    Full Text Available Abstract Under the background of climate change, the increase of atmospheric CO2 and drought frequency have been considered as significant influencers on the soil microbial communities and the yield and quality of crop. In this study, impacts of increased ambient CO2 and drought on soil microbial structure and functional diversity of a Stagnic Anthrosol were investigated in phytotron growth chambers, by testing two representative CO2 levels, three soil moisture levels, and two soil cover types (with or without Glycine max. The 16S rDNA and 18S rDNA fragments were amplified to analyze the functional diversity of fungi and bacteria. Results showed that rhizosphere microbial biomass and community structure were significantly affected by drought, but effects differed between fungi and bacteria. Drought adaptation of fungi was found to be easier than that of bacteria. The diversity of fungi was less affected by drought than that of bacteria, evidenced by their higher diversity. Severe drought reduced soil microbial functional diversity and restrained the metabolic activity. Elevated CO2 alone, in the absence of crops (bare soil, did not enhance the metabolic activity of soil microorganisms. Generally, due to the co-functioning of plant and soil microorganisms in water and nutrient use, plants have major impacts on the soil microbial community, leading to atmospheric CO2 enrichment, but cannot significantly reduce the impacts of drought on soil microorganisms.

  6. Effect of gamma irradiation on microbial load, physicochemical and sensory characteristics of soybeans (Glycine max L. Merrill)

    International Nuclear Information System (INIS)

    Yun Juan; Li Xihong; Fan Xuetong; Tang Yao; Xiao Yao; Wan Sen

    2012-01-01

    Gamma irradiation is highly effective in inactivating microorganisms in various foods and offers a safe alternative method of food decontamination. In the present study, soybeans (Glycine max L. Merrill) were treated with 0, 1.0, 3.0, 5.0 and 10.0 KGy of gamma irradiation. Microbial populations on soybeans, isoflavone, tocopherol contents, raffinose family oligosaccharides, color and sensory properties were evaluated as a function of irradiation dose. The results indicated that gamma irradiation reduced aerobic bacterial and fungal load. Irradiation at the doses applied did not cause any significant change (p>0.05) in the contents of isoflavone of soybeans, but decreased tocopherol contents. The content of key flatulence-producing raffinose family oligosaccharides in irradiated soybeans (10.0 kGy) decreased by 82.1% compared to the control. Sensory analysis showed that the odor of the soybeans was organoleptically acceptable at doses up to 5.0 kGy and no significant differences were observed between irradiated and nonirradiated samples in flavor, texture and color after irradiation. - Highlights: ► The objective of this study concerns the elimination of microbial load factors at different radiation dose (0.0, 1.0, 3.0, 5.0 and 10.0 kGy). ► Investigated the degradation of the gamma irradiation on the reduction of flatulence-causing. ► Indicated the effect of irradiation on the isoflavone and tocopherol contents of the soybeans. ► Evaluated the effect of the gamma irradiation on the sensory properties of soybeans.

  7. Deteksi senyawa isoflavon daidzein dan genistein pada kultur invitro kalus kedelai Glycine max Merr

    Directory of Open Access Journals (Sweden)

    Tintrim Rahayu

    2013-10-01

    Full Text Available The aim of this research is to identify the isofl avon compounds in the in-vitro cultured callus of soybean (Glycine max Merr.. This is an explorative research, in which callus were cultured in the B5 medium supplemented with 2 ppm 2,4 D. The friable callus were found when it was cultured in the solid medium containing 8 g/l agar and 20 g/l sucrose. When the callus and soybean were extracted with ethanol, a yellow colored substance appeared. If further analysis was done with thin layer chromatography (TLC method employing 0,2 mm thin layer silica gel 60 F254 (DC-Plastikfolien Schicht-dicke, and eluent consisting n-Butanol - HCL 0.1 N (1:1, six light blue color nodes appeared under 366 nm UV light. The nodes have the following Rf: 0,14; 0,30; 0,52; 0,63; 0,79 and 0,92 respectively. This TLC result is comparable with the TLC result from soybeans since they have two nodes with the same Rf and color, namely blue color at Rf 0,81 and 0,92 respectively. Further confi rmation using HPLC (High Performance Liquid Chromatography equipped with UVvis detector and Lichrospher 100RP–18, (10 μm colom, as well as Hitachi D–2500 Chromato-integrator indicated that those similar two nodes identifi ed in the TLC were either daidzein or genistein. They can be detected by HPLC at 250 nm and 260 nm, when they were eluated at the 80% metanol. The HPLC quantitative calculation indicated that concentration of daidzein is four time higher as it was compared with the daidzein concentration in the bean. The concentration of daidzein in the callus remained high up to 4–5 weeks after plantation. It’s concentration will decrease when the callus reached 6 weeks after plantation. Genistein as another component of isofl avon is not appear upon callus, while on soybean seeds extracts, both daidzen and genistein are detected.

  8. Multi-Population Selective Genotyping to Identify Soybean [Glycine max (L.) Merr.] Seed Protein and Oil QTLs.

    Science.gov (United States)

    Phansak, Piyaporn; Soonsuwon, Watcharin; Hyten, David L; Song, Qijian; Cregan, Perry B; Graef, George L; Specht, James E

    2016-06-01

    Plant breeders continually generate ever-higher yielding cultivars, but also want to improve seed constituent value, which is mainly protein and oil, in soybean [Glycine max (L.) Merr.]. Identification of genetic loci governing those two traits would facilitate that effort. Though genome-wide association offers one such approach, selective genotyping of multiple biparental populations offers a complementary alternative, and was evaluated here, using 48 F2:3 populations (n = ∼224 plants) created by mating 48 high protein germplasm accessions to cultivars of similar maturity, but with normal seed protein content. All F2:3 progeny were phenotyped for seed protein and oil, but only 22 high and 22 low extreme progeny in each F2:3 phenotypic distribution were genotyped with a 1536-SNP chip (ca 450 bimorphic SNPs detected per mating). A significant quantitative trait locus (QTL) on one or more chromosomes was detected for protein in 35 (73%), and for oil in 25 (52%), of the 48 matings, and these QTL exhibited additive effects of ≥ 4 g kg(-1) and R(2) values of 0.07 or more. These results demonstrated that a multiple-population selective genotyping strategy, when focused on matings between parental phenotype extremes, can be used successfully to identify germplasm accessions possessing large-effect QTL alleles. Such accessions would be of interest to breeders to serve as parental donors of those alleles in cultivar development programs, though 17 of the 48 accessions were not unique in terms of SNP genotype, indicating that diversity among high protein accessions in the germplasm collection is less than what might ordinarily be assumed. Copyright © 2016 Phansak et al.

  9. Max plus at work modeling and analysis of synchronized systems a course on max-plus algebra and its applications

    CERN Document Server

    Heidergott, Bernd; van der Woude, Jacob

    2014-01-01

    Trains pull into a railroad station and must wait for each other before leaving again in order to let passengers change trains. How do mathematicians then calculate a railroad timetable that accurately reflects their comings and goings? One approach is to use max-plus algebra, a framework used to model Discrete Event Systems, which are well suited to describe the ordering and timing of events. This is the first textbook on max-plus algebra, providing a concise and self-contained introduction to the topic. Applications of max-plus algebra abound in the world around us. Traffic systems, compu

  10. Vermiculite's strong buffer capacity renders it unsuitable for studies of acidity on soybean (Glycine max L.) nodulation and growth.

    Science.gov (United States)

    Indrasumunar, Arief; Gresshoff, Peter M

    2013-11-14

    Vermiculite is the most common soil-free growing substrate used for plants in horticultural and scientific studies due to its high water holding capacity. However, some studies are not suitable to be conducted in it. The described experiments aimed to test the suitability of vermiculite to study the effect of acidity on nodulation and growth of soybean (Glycine max L.). Two different nutrient solutions (Broughton & Dilworth, and modified Herridge nutrient solutions) with or without MES buffer addition were used to irrigate soybean grown on vermiculite growth substrates. The pH of nutrient solutions was adjusted to either pH 4.0 or 7.0 prior its use. The nodulation and vegetative growth of soybean plants were assessed at 3 and 4 weeks after inoculation. The unsuitability of presumably inert vermiculite as a physical plant growth substrate for studying the effects of acidity on soybean nodulation and plant growth was illustrated. Nodulation and growth of soybean grown in vermiculite were not affected by irrigation with pH-adjusted nutrient solution either at pH 4.0 or 7.0. This was reasonably caused by the ability of vermiculite to neutralise (buffer) the pH of the supplied nutrient solution (pH 2.0-7.0). Due to its buffering capacity, vermiculite cannot be used as growth support to study the effect of acidity on nodulation and plant growth.

  11. Evaluation of the Protective Role of Glycine max Seed Extract (Soybean Oil) in Drug-Induced Nephrotoxicity in Experimental Rats.

    Science.gov (United States)

    Ramasamy, Anand; Jothivel, Nandhakumar; Das, Saibal; Swapna, A; Albert, Alice Padmini; Barnwal, Preeti; Babu, Dinesh

    2017-09-28

    This study was conducted to evaluate the nephroprotective effect of Glycine max seed extract (soybean oil) against gentamicin- and rifampicin-induced nephrotoxicity in Sprague-Dawley rats and to compare its effects with those of vitamin E, which has well-established antioxidant and nephroprotective effects. Sixty male Sprague-Dawley rats (body weight 150-210 g) were divided into 10 groups. The first five groups were treated for 14 consecutive days with normal saline (5 ml/kg, by mouth [p.o.]); gentamicin (80 mg/kg intraperitoneally [i.p.]); gentamicin (80 mg/kg, i.p.) + vitamin E (250 mg/kg p.o.); gentamicin (80 mg/kg i.p.) + soybean oil (2.5 ml/kg p.o.); and gentamicin (80 mg/kg, i.p.) + soybean oil (5 ml/kg p.o.), respectively. For the next five groups, the same group allocation was done, but gentamicin was replaced with rifampicin (1 g/kg i.p.). Various biomarkers for nephrotoxicity in serum and urine were evaluated along with histopathological examination of kidneys. Analysis of variance (ANOVA) was done following Tukey's multiple comparison test; p Soybean oil in both doses significantly (p Soybean oil also showed strong antioxidant effects, causing significant (p Soybean oil demonstrated good nephroprotective activity due to antioxidant effects.

  12. THE INTENSITY OF TRANSPIRATION OF THE LEAVES OF GLYCINE MAX (L. MERR. DEPENDING ON THE GROWTH PHASE AND THE TIERED ARRANGEMENT ON THE PLANT

    Directory of Open Access Journals (Sweden)

    A. V. Amelin

    2018-01-01

    Full Text Available The thematic core facilities plan, CCU of Orel state agrarian university "Genetic resources of plants and their use" for a joint program with Shatilovskay of Institute of leguminous and cereal crops, of field and vegetation experiments on the study of specific features of manifestation of the activity of transpiration leaves of soybean are achieved. The object of the study were 10 varieties of soybeans that were grown on plots of 15 m2 in four replications. Seeding was carried out breeding seeder calculated 600 thousand of viable seeds per hectare. the way the plots were allocated systematically with offset. The care of crops was carried out in accordance with the recommended regional events. It was demonstrated that leaf transpiration activity of the culture increases sharply in the transition of plants to the generative period of development, reaching a maximum in the phase of mass fruit formation, when the most active growth and, consequently, the demand for assimilate. The intensity of transpiration of leaves during this period of plant development was by 8.22 mmol H2O/m2c. The highest transpiration activity was typical for the upper leaves located in the generative sphere of plants, the lowest - activity was fount for the lowerst leaves. On the 5th node from the bottom, its value was 2.2 times lower compared to the assimilating leaves at the top of the plants (3-4 knots top. Thus, the most intensive evaporation of the water by leaves are held from 9:00 to 13:00 hours Moscow time. The intensity of transpiration in this period amounted to an average of 5.42 mmol H2O/m2c, which was 19.9% higher than in the morning (from 7:00 to 8:00 and 42.3% in the afternoon (from 15:00 to 17:00.

  13. Development of a reduced linolenate soy [Glycine max] mutant by re-irradiation and its genetic analysis

    International Nuclear Information System (INIS)

    Takagi, Y.; Rahman, S.M.; Anai, T.; Wasala, S.K.; Kinoshita, T.; Khalekuzzaman, M.

    1999-01-01

    A high content of linolenic acid leads to reduction of keeping quality and frying stability of cooking oil. The present study was conducted to obtain a further reduction of linolenic acid in soybean [Glycine max (L.) Merr.] oil by re-irradiation of M-5 and determine its genetic system. M-5 is a mutant with 4.5% linolenic acid content, derived from the cultivar Bay (8.0% linolenic acid). A seed lot from line M-5 was treated with X-ray irradiation and M2 plants were obtained from randomly selected seeds of M1 plants. The M-2 plants were screened for reduced linolenic acid. One plant was found with 3.0% linolenic acid content and was named MS382. The M3 and M1 generations of this line proved that the character was fixed and significantly lower than the M-5 control. For inheritance studies, MS382 was reciprocally crossed with M-5 (fan) and LOLL [fanfanx-a, a recombinant of M-5 (fan) x M24 (fanx-a)]. The F2 segregation ratio and the segregation of F3 seeds from F2 plants of MS382 x M-5 indicated that reduced linolenic acid in MS382 was conbindly controlled by fan (M-5) and an additional gene. To determine if this additional gene was similar with the fanx-a gene in LOLL, F2 seeds and F3 seeds from each F2 plant of MS382 x LOLL were evaluated. No transgressive segregation for linolenic acid was found in this cross, indicating the genes for reduced linolenic acid content in MS382 and LOLL were identical. However, the mutant MS382 was developed by re-irradiation which indicates the practicability of this technique to develop new gene for further reduction of linolenic acid in soybean oil

  14. Novel process of fermenting black soybean [Glycine max (L.) Merrill] yogurt with dramatically reduced flatulence-causing oligosaccharides but enriched soy phytoalexins.

    Science.gov (United States)

    Feng, Shengbao; Saw, Chin Lee; Lee, Yuan Kun; Huang, Dejian

    2008-11-12

    Black soybeans [Glycine max (L.) Merrill] were germinated under fungal stress with food grade R. oligosporus for 3 days and were homogenized and fermented with lactic acid bacteria (LAB) to produce soy yogurt. Fungal stress led to the generation of oxylipins [oxooctadecadienoic acids (KODES) isomers and their respective glyceryl esters] and glyceollins--a type of phytoalexins unique to soybeans. In soy yogurt, the concentrations of total KODES and total glyceollins were 0.678 mg/g (dry matter) and 0.953 mg/g, respectively. The concentrations of other isoflavones (mainly genistein and daidzein and their derivatives) in soy yogurt remained largely unchanged after the processes compared with the control soy yogurt. Germination of black soybean under fungal stress for 3 days was sufficient to reduce stachyose and raffinose (which cause flatulence) by 92 and 80%, respectively. With a pH value of 4.42, a lactic acid content of 0.262%, and a maximum viable cell count of 2.1 x 10 (8) CFU/mL in the final soy yogurt, soy milk from germinated soybeans under fungal stress was concluded to be a suitable medium for yogurt-making. The resulting soy yogurt had significantly altered micronutrient profiles with significantly reduced oligosaccharides and enriched glyceollins.

  15. Influence of pulsed magnetic field on soybean (Glycine max L.) seed germination, seedling growth and soil microbial population.

    Science.gov (United States)

    Radhakrishnan, Ramalingam; Kumari, Bollipo Dyana Ranjitha

    2013-08-01

    The effects of pulsed magnetic field (PMF) treatment of soybean (Glycine max L. cv CO3) seeds were investigated on rate of seed germination, seedling growth, physico-chemical properties of seed leachates and soil microbial population under laboratory conditions. Seeds were exposed to PMF of 1500 nT at 0.1, 1.0 10.0 and 100.0 Hz for 5 h per day for 20 days, induced by enclosure coil systems. Non-treated seeds were considered as controls. All PMF treatments significantly increased the rate of seed germination, while 10 and 100 Hz PMFs showed the most effective response. The 1.0 and 10 Hz PMFs remarkably improved the fresh weight of shoots and roots, leaf area and plant height from seedlings from magnetically-exposed seeds compared to the control, while 10 Hz PMF increased the total soluble sugar, total protein and phenol contents. The leaf chlorophyll a, b and total chlorophyll were higher in PMF (10 and 100 Hz) pretreated plants, as compared to other treatments. In addition, activities of alpha-amylase, acid phosphatase, alkaline phosphatase, nitrate reductase, peroxidase and polyphenoloxidase were increased, while beta-amylase and protease activities were declined in PMF (10 Hz)-exposed soybean plants. Similarly, the capacity of absorbance of water by seeds and electrical conductivity of seed leachates were significantly enhanced by 10 Hz PMF exposure, whereas PMF (10 Hz) pretreated plants did not affect the microbial population in rhizosphere soil. The results suggested the potential of 10 Hz PMF treatment to enhance the germination and seedling growth of soybean.

  16. Distribución e identificación de especies hospedantes de Heterodera glycines Ichinohe raza 3 en el Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Varón de Agudelo Francia

    1988-06-01

    Full Text Available Se dividió la parte plana del Valle del Cauca en tres zonas (norte, centro y sur, habiéndose visitado 33 fincas. En la zona norte las malezas con mayor porcentaje de frecuencia y distribución en los cultivos de soya fueron Digitaria horizontalis, Echinochloa colonum y Leptochloa filiformis; en la zona centro Ipomoea hirta, Amaranthus dubius y Echinochloa colonum y en la zona sur predominaron Ipomoea hirta, Portulaca oleracea Cyperus rotundus. Los análisis de muestras de suelo y raíces indicaron que H. glycines se encuentra distribuido en todo el Valle del Cauca, presentando la zona sur (Candelaria, Palmira y Puerto Tejada las mayores poblaciones. Entre las especies evaluadas (malezas, cultivos, leguminosas forrajeras y silvestres, solamente Glycine max y Phaseolus vulgaris se consideraron como susceptibles a H. glycines raza 3. y P. angularis y P. multiflora permitieron muy poca infección y multiplicación del nemátodo.A nematode recognition of Heterodera glycines was focused on crops of soybean. Valle del Cauca was divided in three zones (northen, central and southern and 33 farms were visited. The results of the analysis on samples of soils and roots showe that Heterodera glycines is scattered throughout Valle del Cauca, being the southern zone (Palmira, Candelaria and Puerto Tejada the one having the highest standards in nematode population. Weeds showing a greater frequency percentage were : Digitaria horizontalis, Echinochloa colonum and Leptochloa filiformis, in the northen zone; Ipomoea hirta, Amaranthus dubius and Echinochloa colonum, in the central zone, and Ipomoea hirta, Portulaca oleracea and Cyperus rotundus, in the southern zone , From among the whole species evaluated (weeds, crops, leguminous a n d fodder plants, Glycine max and Phaseolus vulgaris were considered to be susceptible to H. Glycines race 3. Phaseolus angularis y P. multiflora let low population levels.

  17. Evaluating effect of biofertilizer on nodulation and soybean (Glycine max L plants growth characteristics under water deficit stress of seed

    Directory of Open Access Journals (Sweden)

    M. Tajik Khaveh

    2016-05-01

    Full Text Available In order to evaluate the effects of biofertilizer on soybean (Glycine max L. seed vigor that produced under water deficit condition and related traits, an experiment was conducted in a factorial layout based of complete randomized block design with four replications at the research greenhouse of Aboureihan campus- Tehran University, Iran. Experimental treatments were include biofertilizer (seed inoculation with Bradyrhizobium japonicum, co-inoculation with Bradyrhizobium japonicum and Pseudomonas fluorescens, co-inoculation with Bradyrhizobium japonicum and Glomus mosseae, Cultivar (Zalta Zalha and Clark×Hobbit line and water deficit stress [irrigation plants after 50 (normal irrigation, 100 (medium stress, 150 (sever stress mm evaporation from pan class A, in parents field]. Results showed that the water deficit stress had negative effects on seed quality and seedling emergence percentage, mean daily seedling emergence, root, leaf and shoot dry weight, number of nodule were decreased. ZaltaZalha cultivar had higher shoot dry weight and number of leaf compared with other cultivars. Applications of biofertilzer was effective on stem diameter, root, leaf and shoot dry weight, number of leaf and nodule and those attributes increased by co-inoculation of Bradyrhizobium japonicum and Glomus mosseae. Also, use of biofertilizer in stress levels was effective on stem dry weight. Stem dry weight was increased by Co-inoculation of cultivar seeds with Bradyrhizobium japonicum and Glomus mosseae.

  18. Influence of high glycine diets on the activity of glycine-catabolizing enzymes and on glycine catabolism in rats

    International Nuclear Information System (INIS)

    Petzke, K.J.; Albrecht, V.; Przybilski, H.

    1986-01-01

    Male albino rats were adapted to isocaloric purified diets that differed mainly in their glycine and casein contents. Controls received a 30% casein diet. In experimental diets gelatin or gelatin hydrolysate was substituted for half of the 30% casein. An additional group was fed a glycine-supplemented diet, which corresponded in glycine level to the gelatin diet but in which the protein level was nearly the same as that of the casein control diet. Another group received a 15% casein diet. Rat liver glycine cleavage system, serine hydroxymethyltransferase and serine dehydratase activities were measured. 14 CO 2 production from the catabolism of 14 C-labeled glycine was measured in vivo and in vitro (from isolated hepatocytes). Serine dehydratase and glycine cleavage system activities were higher in animals fed 30% casein diets than in those fed 15% casein diets. Serine hydroxymethyltransferase activity of the cytosolic and mitochondrial fractions was highest when a high glycine diet (glycine administered as pure, protein bound in gelatin or peptide bound in gelatin hydrolysate) was fed. 14 CO 2 formation from [1- 14 C]- and [2- 14 C]glycine both in vivo and in isolated hepatocytes was higher when a high glycine diet was fed than when a casein diet was fed. These results suggest that glycine catabolism is dependent on and adaptable to the glycine content of the diet. Serine hydroxymethyltransferase appears to play a major role in the regulation of glycine degradation via serine and pyruvate

  19. Glycine max

    African Journals Online (AJOL)

    otoigiakih

    2013-05-29

    May 29, 2013 ... obvious, such as cross incompatibility and sterility of either hybrids or their ... ficulty in producing fertile hybrids and progeny by cros- sing genotypes .... Analysis of recombination rate in female and male gametogenesis in ...

  20. Genome-wide association study, genomic prediction and marker-assisted selection for seed weight in soybean (Glycine max).

    Science.gov (United States)

    Zhang, Jiaoping; Song, Qijian; Cregan, Perry B; Jiang, Guo-Liang

    2016-01-01

    Twenty-two loci for soybean SW and candidate genes conditioning seed development were identified; and prediction accuracies of GS and MAS were estimated through cross-validation and validation with unrelated populations. Soybean (Glycine max) is a major crop for plant protein and oil production, and seed weight (SW) is important for yield and quality in food/vegetable uses of soybean. However, our knowledge of genes controlling SW remains limited. To better understand the molecular mechanism underlying the trait and explore marker-based breeding approaches, we conducted a genome-wide association study in a population of 309 soybean germplasm accessions using 31,045 single nucleotide polymorphisms (SNPs), and estimated the prediction accuracy of genomic selection (GS) and marker-assisted selection (MAS) for SW. Twenty-two loci of minor effect associated with SW were identified, including hotspots on Gm04 and Gm19. The mixed model containing these loci explained 83.4% of phenotypic variation. Candidate genes with Arabidopsis orthologs conditioning SW were also proposed. The prediction accuracies of GS and MAS by cross-validation were 0.75-0.87 and 0.62-0.75, respectively, depending on the number of SNPs used and the size of training population. GS also outperformed MAS when the validation was performed using unrelated panels across a wide range of maturities, with an average prediction accuracy of 0.74 versus 0.53. This study convincingly demonstrated that soybean SW is controlled by numerous minor-effect loci. It greatly enhances our understanding of the genetic basis of SW in soybean and facilitates the identification of genes controlling the trait. It also suggests that GS holds promise for accelerating soybean breeding progress. The results are helpful for genetic improvement and genomic prediction of yield in soybean.

  1. Molecular cloning, heterologous expression and functional characterization of gamma tocopherol methyl transferase (γ-TMT) from Glycine max.

    Science.gov (United States)

    Tewari, Kalpana; Dahuja, Anil; Sachdev, Archana; Kumar, Vaibhav; Ali, Kishwar; Kumar, Amresh; Kumari, Sweta

    2017-12-01

    γ-Tocopherol methyltransferase (γ-TMT) (EC 2.1.1.95) is the last enzyme in the tocopherol biosynthetic pathway and it catalyzes the conversion of γ-tocopherol into α-tocopherol, the nutritionally significant and most bioactive form of vitamin E. Although the γ-TMT gene has been successfully overexpressed in many crops to enhance their α-tocopherol content but still only few attempts have been made to uncover its structural, functional and regulation aspects at protein level. In this study, we have cloned the complete 909bp coding sequence of Glycine max γ-TMT (Gm γ-TMT) gene that encodes the corresponding protein comprising of 302 amino acid residues. The deduced Gm γ-TMT protein showed 74-87% sequence identity with other characterized plant γ-TMTs. Gm γ-TMT belongs to Class I Methyl Transferases that have a Rossmann-like fold which consists of a seven-stranded β sheet joined by α helices. Heterologous expression of Gm γ-TMT in pET29a expression vector under the control of bacteriophage T7 promoter produced a 37.9 kDa recombinant Gm γ-TMT protein with histidine hexamer tag at its C-terminus. The expression of recombinant Gm γ-TMT protein was confirmed by western blotting using anti-His antibody. The recombinant protein was purified by Ni 2+ -NTA column chromatography. The purified protein showed SAM dependent methyltransferase activity. The α-tocopherol produced in the in-vitro reaction catalyzed by the purified enzyme was detected using reverse phase HPLC. This study has laid the foundation to unveil the biochemical understanding of Gm γ-TMT enzyme which can be further explored by studying its kinetic behaviour, substrate specificity and its interaction with other biomolecules. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. Floral biology and behavior of Africanized honeybees Apis mellifera in soybean (Glycine max L. Merril

    Directory of Open Access Journals (Sweden)

    Wainer César Chiari

    2005-05-01

    Full Text Available This research was carried out to evaluate the pollination by Africanized honeybees Apis mellifera, the floral biology and to observe the hoarding behavior in the soybean flowers (Glycine max Merril, var. BRS-133. The treatments were constituted of demarcated areas for free visitation of insects, covered areas by cages with a honeybee colony (A. mellifera and also covered areas by cage without insects visitation. All areas had 24 m² (4m x 6m. The soybean flowers stayed open for a larger time (82.82 ± 3.48 hours in covered area without honeybees. The stigma of the flowers was also more receptive (P=0.0021 in covered area without honeybees (87.3 ± 33.0% and at 10:42 o'clock was the schedule of greater receptivity. The pollen stayed viable in all treatments, the average was 99.60 ± 0.02%, which did not present differences among treatments. The percentage of abortion of the flowers was 82.91% in covered area without honeybees, this result was superior (P=0.0002 to the 52.66% and 53.95% of the treatments uncovered and covered with honeybees, respectively. Honeybees were responsible for 87.7% of the pollination accomplished by the insects. The medium amounts of total sugar and glucose measured in the nectar of the flowers were, 14.33 ± 0.96 mg/flower and 3.61 ± 0.36 mg/ flower, respectively, not showing differences (PEste experimento teve como objetivos avaliar a polinização realizada por abelhas Apis mellifera, estudar a biologia floral e observar o comportamento de coleta nas flores de soja (Glycine max L. Merril, variedade BRS-133 plantadas na região de Maringá-PR. Os tratamentos constituíram de áreas demarcadas de livre visitação por insetos, áreas cobertas por gaiolas, com uma colônia de abelhas (A. mellifera no seu interior e plantas também cobertas por gaiola que impedia a visitação por insetos. Todas as áreas possuíam 24 m² (4 m x 6 m. As flores de soja permaneceram abertas por um tempo maior (82,82 ± 3,48 horas no

  3. Transgenic soybean overexpressing GmSamT1 exhibits resistance to multiple-HG types of soybean cyst nematode Heterodera glycines

    Science.gov (United States)

    Soybean (Glycine max (L.) Merr.) salicylic acid methyl transferase (GmSAMT1) catalyzes the conversion of salicylic acid to methyl salicylate. Prior results showed that when GmSAMT1 was overexpressed in transgenic soybean hairy roots, resistance is conferred against soybean cyst nematode (SCN), Heter...

  4. Enhanced Single Seed Trait Predictions in Soybean (Glycine max) and Robust Calibration Model Transfer with Near-Infrared Reflectance Spectroscopy.

    Science.gov (United States)

    Hacisalihoglu, Gokhan; Gustin, Jeffery L; Louisma, Jean; Armstrong, Paul; Peter, Gary F; Walker, Alejandro R; Settles, A Mark

    2016-02-10

    Single seed near-infrared reflectance (NIR) spectroscopy predicts soybean (Glycine max) seed quality traits of moisture, oil, and protein. We tested the accuracy of transferring calibrations between different single seed NIR analyzers of the same design by collecting NIR spectra and analytical trait data for globally diverse soybean germplasm. X-ray microcomputed tomography (μCT) was used to collect seed density and shape traits to enhance the number of soybean traits that can be predicted from single seed NIR. Partial least-squares (PLS) regression gave accurate predictive models for oil, weight, volume, protein, and maximal cross-sectional area of the seed. PLS models for width, length, and density were not predictive. Although principal component analysis (PCA) of the NIR spectra showed that black seed coat color had significant signal, excluding black seeds from the calibrations did not impact model accuracies. Calibrations for oil and protein developed in this study as well as earlier calibrations for a separate NIR analyzer of the same design were used to test the ability to transfer PLS regressions between platforms. PLS models built from data collected on one NIR analyzer had minimal differences in accuracy when applied to spectra collected from a sister device. Model transfer was more robust when spectra were trimmed from 910 to 1679 nm to 955-1635 nm due to divergence of edge wavelengths between the two devices. The ability to transfer calibrations between similar single seed NIR spectrometers facilitates broader adoption of this high-throughput, nondestructive, seed phenotyping technology.

  5. Mechanisms of glycine release, which build up synaptic and extrasynaptic glycine levels: the role of synaptic and non-synaptic glycine transporters.

    Science.gov (United States)

    Harsing, Laszlo G; Matyus, Peter

    2013-04-01

    Glycine is an amino acid neurotransmitter that is involved in both inhibitory and excitatory neurochemical transmission in the central nervous system. The role of glycine in excitatory neurotransmission is related to its coagonist action at glutamatergic N-methyl-D-aspartate receptors. The glycine levels in the synaptic cleft rise many times higher during synaptic activation assuring that glycine spills over into the extrasynaptic space. Another possible origin of extrasynaptic glycine is the efflux of glycine occurring from astrocytes associated with glutamatergic synapses. The release of glycine from neuronal or glial origins exhibits several differences compared to that of biogenic amines or other amino acid neurotransmitters. These differences appear in an external Ca(2+)- and temperature-dependent manner, conferring unique characteristics on glycine as a neurotransmitter. Glycine transporter type-1 at synapses may exhibit neural and glial forms and plays a role in controlling synaptic glycine levels and the spill over rate of glycine from the synaptic cleft into the extrasynaptic biophase. Non-synaptic glycine transporter type-1 regulates extrasynaptic glycine concentrations, either increasing or decreasing them depending on the reverse or normal mode operation of the carrier molecule. While we can, at best, only estimate synaptic glycine levels at rest and during synaptic activation, glycine concentrations are readily measurable via brain microdialysis technique applied in the extrasynaptic space. The non-synaptic N-methyl-D-aspartate receptor may obtain glycine for activation following its spill over from highly active synapses or from its release mediated by the reverse operation of non-synaptic glycine transporter-1. The sensitivity of non-synaptic N-methyl-D-aspartate receptors to glutamate and glycine is many times higher than that of synaptic N-methyl-D-aspartate receptors making the former type of receptor the primary target for drug action. Synaptic

  6. Residual Effect Of Organic Fertilizer And Addition Inorganik Fertilizer To Nutrient Uptake Growth And Productions Of Black Soy Bean Glycine Max L. Merr At Rainfed Areas.

    Directory of Open Access Journals (Sweden)

    Elli Afrida

    2015-02-01

    Full Text Available Abstract Research that have theme Residual Effect of Organic Fertilizer and Addition Anorganik Fertilizer to Nutrient Uptake Growth and pruductions of Black Soy Bean Glycine max L. Merr at Rainfed Wetland. Research was conducted at Suka Makmur village sub-distric Binjai Distric Langkat. Research was arranged in split plot design main plot is applications of phonska fertilizerwith 4 level i.e 0 t ha-1 A0 0.20 t ha-1 A1 0.25 t ha-1 A2 dan 0.30 t ha-1 A3 and sub plot is residual effect from first research with 16 combinations. Research was replicated 3 times. Result of research was showed application organic fertilizer that was combinated with anorganic fertilizer can increased N and K uptake. Application organic and anorganic fertilizer as single factor showed significantly effect of number of pods and soy bean productions but at interaction treatment not significantly effect however generally occurs increased production at O33A3 tratment until 80 comparison with control.

  7. Changes in the physiological activity of soybean (Glycine max L. Merr. under the influence of exogenous growth regulators

    Directory of Open Access Journals (Sweden)

    Anna Nowak

    2015-07-01

    Full Text Available In a two-year pot experiment (2008–2009 conducted at the Vegetation Hall, West Pomeranian University of Technology in Szczecin, we investigated the influence of exogenous growth regulators, i.e. indole-3-butyric acid (IBA and 6-benzylaminopurine (BAP and their mixture, on the activity of gas exchange and selected physiological features of soybeans (Glycine max L. Merr.. The experimental factors included the following Polish soybean cultivars: ‘Aldana’, ‘Progres’ and ‘Jutro’. During plant growth, CO2 assimilation (A, transpiration rate (E, stomatal conductance (gs, and substomatal CO2 concentration (ci were determined. Two soybean cultivars, i.e. ‘Jutro’ and ‘Progres’, showed a significant increase in the intensity of assimilation and transpiration after using all kinds of growth regulators as compared with the control plants. It was found that the ‘Jutro’ cultivar, after using a mixture of growth regulators (IBA + BAP, was characterized by the significantly highest CO2 assimilation (A and transpiration (E as well as the highest stomatal conductance (gs. The ‘Aldana’ cultivar, on the other hand, responded by a significant reduction in the transpiration rate, stomatal conductance and subsomatal CO2 concentration. The spraying of the plants with exogenous growth regulators had a significant influence on the increase in the number of stomata and stomatal pore length, mostly on the lower epidermis of the lamina. It was also found that plants from the ‘Jutro’ and ‘Aldana’ cultivars sprayed with IBA and IBA + BAP were characterized by the highest yield, as compared with the control plants. In the case of the ‘Jutro’ cultivar, after using the growth regulators, a positive correlation was observed between the assimilation and transpiration rates and the length of stomata, which in consequence produced increased yields.

  8. Nonomuraea glycinis sp. nov., a novel actinomycete isolated from the root of black soya bean [Glycine max (L.) Merr].

    Science.gov (United States)

    Li, Zhilei; Song, Wei; Zhao, Junwei; Zhuang, Xiaoxin; Zhao, Yue; Wang, Xiangjing; Xiang, Wensheng

    2017-12-01

    A novel actinomycete, designated strain NEAU-BB2C19 T , was isolated from the root of black soya bean [Glycine max (L.) Merr] collected from Harbin, Heilongjiang Province, China, and characterized using a polyphasic approach. The strain was an aerobic, Gram-stain-positive actinomycete that formed extensively branched substrate mycelium and aerial hyphae. The predominant menaquinones were MK-9(H2) and MK-9(H0). The major cellular fatty acid profile consisted of iso-C16 : 0, 10-methyl C17 : 0 and 10-methyl C18 : 0. The polar lipid profile consisted of diphosphatidylglycerol, phosphatidylethanolamine, hydroxy-phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannoside, phosphatidylglycerol and glycolipid. The DNA G+C content was 68.2±0.4 mol%. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain NEAU-BB2C19 T should be assigned to the genus Nonomuraea and formed a distinct branch with its closest neighbour Nonomuraea guangzhouensis NEAU-ZJ3 T (98.75 % 16S rRNA gene sequence similarity). The morphological and chemotaxonomic properties of the strain were also consistent with those of members of the genus Nonomuraea. A combination of DNA-DNA hybridization results and some phenotypic characteristics indicated that strain NEAU-BB2C19 T could be clearly differentiated from its closest phylogenetic relative. Thus, the strain is concluded to represent a novel species of the genus Nonomuraea, for which the name Nonomuraea glycinis sp. nov. is proposed. The type strain is NEAU-BB2C19 T (=CGMCC 4.7430 T =DSM 104838 T ).

  9. Response of Glycine max to drought stress in relation to growth parameters and some key enzymes of carbon and nitrogen metabolism

    Directory of Open Access Journals (Sweden)

    Maryam Nasr Esfahani

    2015-06-01

    Full Text Available Drought stress is one of the major constraints for production and yield of soybean (Glycine max. For this reason, identifying mechanisms associated with drought tolerance in soybean is very impotent for improving and increasing drought resistance by genetic engineering methods. In this study, the effect of drought on growth traits (plant height, fresh and dry weight of shoot and also fresh and dry weight of root and enzyme activities of isocitrate dehydrogenase (ICDH, phosphoenolpyruvate carboxylase (PEPC, malate dehydrogenase (MDH, glutamine synthetase (GS and nitrate reductase (NR were assessed in drought sensitive and tolerant cultivars of soybean. The results showed that growth indicators are higher in drought tolerant cultivar under water availability (control and water deficient when compared with those of drought sensitive cultivar. An increase in the activity of ICDH was observed in both the cultivars under drought stress as compared with their respective control plants but this activity was higher in tolerant cultivar. The activities of PEPC, MDH, GS and NR were significantly decreased in drought sensitive cultivar whereas the activities of these enzymes were higher in another cultivar. In general, the results of this study showed different behavior in the activities of assayed enzymes in two sets of soybean cultivars differing in drought tolerance and also decline of the activities of these enzymes in drought sensitive cultivar due to water deficit stress may be one of the possible reasons for decreased growth of the soybean plants under drought.

  10. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress.

    Science.gov (United States)

    Bilal, Saqib; Khan, Abdul L; Shahzad, Raheem; Asaf, Sajjad; Kang, Sang-Mo; Lee, In-Jung

    2017-01-01

    This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum , Paecilomyces formosus , Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean) in response to dose-dependent increases in soil Ni (0.5, 1.0, and 5.0 mM). Inoculation with P. formosus LHL10 significantly increased plant biomass and growth attributes as compared to non-inoculated control plants with or without Ni contamination. LHL10 enhanced the translocation of Ni from the root to the shoot as compared to the control. In addition, P. formosus LHL10 modulated the physio-chemical apparatus of soybean plants during Ni-contamination by reducing lipid peroxidation and the accumulation of linolenic acid, glutathione, peroxidase, polyphenol oxidase, catalase, and superoxide dismutase. Stress-responsive phytohormones such as abscisic acid and jasmonic acid were significantly down-regulated in fungal-inoculated soybean plants under Ni stress. LHL10 Ni-remediation potential can be attributed to its phytohormonal synthesis related genetic makeup. RT-PCR analysis showed the expression of indole-3-acetamide hydrolase , aldehyde dehydrogenase for indole-acetic acid and geranylgeranyl-diphosphate synthase , ent-kaurene oxidase ( P450-4 ), C13-oxidase ( P450-3 ) for gibberellins synthesis. In conclusion, the inoculation of P. formosus can significantly improve plant growth in Ni-polluted soils, and assist in improving the phytoremediation abilities of economically important crops.

  11. Ecological aspects study of replacement intercropping patterns of Soybean (Glycine max L. and Millet (Panicum miliaceum L.

    Directory of Open Access Journals (Sweden)

    Goudarz Ahmadvand

    2016-03-01

    Full Text Available Intercropping is considered for increasing and stability of yield in per unit. In order to study the effects of soybean (Glycine max L. and millet (Panicum miliaceum L. replacement intercropping on agronomic traits, diversity of weeds and soil biological activity, an experiment was conducted at the Research Station of Agricultural Faculty, of Bu-Ali Sina University, in 2014. The experiment was carried out as a randomized complete block design with three replications. The replacement intercropping series consisted of monoculture of soybean, monoculture of millet, 75% soybean+ 25% millet, 50% soybean+ 50% millet and 25% soybean+ 75% millet. The results showed that the highest seed yield of 219.8 and 171.9 gm-2 belonged to monoculture of soybean and monoculture of millet, respectively. Intercropping reduced maximum leaf area index of soybean and millet but leaf chlorophyll content of soybean and millet were increased. The highest number of pods per plant, number of seeds per plant in soybean and panicle number per plant in millet were obtained in 50S:50M ratio. Mean soil respiration rate in intercropping treatments was 4 and 8 % higher than the monoculture of soybean and millet, respectively. Intercropping patterns of 50S:50M and 25S:75M were successful in reducing weed plant density and diversity in comparison with soybean monoculture. Results showed that in all intercropping treatments, land equivalent ratio was more than one. Maximum value of land equivalent ratio (2.20 was achieved in 50S:50M treatment. Soybean and millet intercropping at different levels of replacement, didn’t have actual yield loss. Calculating the aggressivity showed that millet was more dominate than soybean. The maximum relative crowding coefficient of soybean was observed in 75S:25M, however that of millet was obtained in 25S:75M and 50S:50M intercroppings indicating that millet is more competitor than soybean.

  12. An overview of the metabolic differences between Bradyrhizobium japonicum 110 bacteria and differentiated bacteroids from soybean (Glycine max) root nodules: an in vitro 13C- and 31P-nuclear magnetic resonance spectroscopy study

    International Nuclear Information System (INIS)

    Vauclare, Pierre; Bligny, Richard; Gout, Elisabeth; Widmer, Francois

    2013-01-01

    Bradyrhizobium japonicum is a symbiotic nitrogen-fixing soil bacteria that induce root nodules formation in legume soybean (Glycine max.). Using 13 C- and 31 P-nuclear magnetic resonance (NMR) spectroscopy, we have analysed the metabolite profiles of cultivated B. japonicum cells and bacteroids isolated from soybean nodules. Our results revealed some quantitative and qualitative differences between the metabolite profiles of bacteroids and their vegetative state. This includes in bacteroids a huge accumulation of soluble carbohydrates such as trehalose, glutamate, myo-inositol and homo-spermidine as well as Pi, nucleotide pools and intermediates of the primary carbon metabolism. Using this novel approach, these data show that most of the compounds detected in bacteroids reflect the metabolic adaptation of rhizobia to the surrounding microenvironment with its host plant cells. (authors)

  13. Analysis of embryo, cytoplasm and maternal effects on fatty acid components in soybean (Glycine max Merill.)

    Institute of Scientific and Technical Information of China (English)

    NING Hailong; LI Wenxia; LI Wenbin

    2007-01-01

    The quality of oil determined by the constituents and proportion of fatty acid components,and the understanding of heredity of fatty acid components are of importance to breeding good quality soybean varieties.Embryo,cytoplasmic and maternal effects and genotype×environment interaction effects for quality traits of soybean [Glycine max (L.) Merrill.] seeds were analyzed using a general genetic model for quantitative traits of seeds with parents,F1 and F2,of 20 crosses from a diallel mating design of five parents planted in the field in 2003 and 2004 in Harbin,China.The interaction effects of palmitic,stearic,and linoleic acid contents were larger than the genetic main effects,while the genetic main effects were equal to interaction effects for linolenic and oleic acid content.Among all kinds of genetic main effects,the embryo effects were the largest for palmitic,stearic,and linoleic acids,while the cytoplasm effects were the largest for oleic and linolenic acids.Among all kinds of interaction effects,the embryo interaction effects were the largest for fatty acids.The sum of additive and additive× environment effects were larger than that of dominance and dominance×environment effects for the linolenic acid content,but not for other quality traits.The general heritabilities were the main parts of heritabilities for palmitic and oleic acid contents,but the interaction was more important for stearic,linoleic,and linolenic acid contents.For the general heritability,maternal and cytoplasm heritabilities were the main components for palmitic,oleic,and linolenic acid contents.It was shown for the interaction heritabilities that the embryo interaction heritabilities were more important for oleic and linolenic acid contents,while the maternal interaction heritabilities were more important for linoleic acid content.Among selection response components,the maternal and cytoplasm general responses and/or interaction responses were more important for palmitic

  14. Selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in greenhouse

    Directory of Open Access Journals (Sweden)

    SRI PURWANINGSIH

    2005-07-01

    Full Text Available An experiment on the selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in green house. The aim of the experiment the selection and potency of the Rhizobium strain to increase the growth of soybean. The experiment was carried out in green house condition in Microbiology Division, Research Center for Biology-LIPI with sterile sand medium. The research design was Completely Randomized Design with three replications for each treatment. The Rhizobium strains used were 1 W (isolated from bean, Vigna radiata, 2 W (isolated from soybean, 3 W (isolated from bean, 4 W (isolated from soybean, 5 W (isolated from soybean, 6 W (isolated from peanut, Arachis hypogaea, 7 W (isolated from peanut, 8 W (isolated from peanut, the controls were uninoculated with Rhizobium strain and without urea fertilizer (K1, uninoculated and with urea fertilizer equal 100 kg/ha (K2. The plants were harvested after 50 days, the variable of investigation were the dry weight of canopy, roots, nodules root, total plants, number of nodules and ‘symbiotic capacity”. The results showed that all of experiment plant which be inoculated with Rhizobium able to form nodule. Strain of 2 W (isolated from soybean has given the best effects on the growth of soybean.

  15. Physiological and transcriptomic responses in the seed coat of field-grown soybean (Glycine max L. Merr.) to abiotic stress.

    Science.gov (United States)

    Leisner, Courtney P; Yendrek, Craig R; Ainsworth, Elizabeth A

    2017-12-12

    Understanding how intensification of abiotic stress due to global climate change affects crop yields is important for continued agricultural productivity. Coupling genomic technologies with physiological crop responses in a dynamic field environment is an effective approach to dissect the mechanisms underpinning crop responses to abiotic stress. Soybean (Glycine max L. Merr. cv. Pioneer 93B15) was grown in natural production environments with projected changes to environmental conditions predicted for the end of the century, including decreased precipitation, increased tropospheric ozone concentrations ([O 3 ]), or increased temperature. All three environmental stresses significantly decreased leaf-level photosynthesis and stomatal conductance, leading to significant losses in seed yield. This was driven by a significant decrease in the number of pods per node for all abiotic stress treatments. To understand the underlying transcriptomic response involved in the yield response to environmental stress, RNA-Sequencing analysis was performed on the soybean seed coat, a tissue that plays an essential role in regulating carbon and nitrogen transport to developing seeds. Gene expression analysis revealed 49, 148 and 1,576 differentially expressed genes in the soybean seed coat in response to drought, elevated [O 3 ] and elevated temperature, respectively. Elevated [O 3 ] and drought did not elicit substantive transcriptional changes in the soybean seed coat. However, this may be due to the timing of sampling and does not preclude impacts of those stresses on different tissues or different stages in seed coat development. Expression of genes involved in DNA replication and metabolic processes were enriched in the seed coat under high temperate stress, suggesting that the timing of events that are important for cell division and proper seed development were altered in a stressful growth environment.

  16. Desenvolvimento, partição de assimilados e produção de matéria seca de plantas de soja (Glycine max (L. merrill submetidas a quatro doses de metribuzin Development,assimilate partition and dry matter production in soybean (Glycine max (L. merrill plants treated with four doses of metribuzin

    Directory of Open Access Journals (Sweden)

    P. J. Silva Neto

    1991-01-01

    Full Text Available O desenvolvimento, a partição e a produção de matéria seca, foram estudados em soja (Glycine Max (L. Merri ll, cv. 'Uberaba', cultivadas em condições de campo, sob quatro doses de metribuzin - (0,0; 0,35; 0,70 e 1,05 kg i.a. ha-1. O metri buzin não reduziu a população e nem alterou significativamente a razão parte aérea/sistema radicular. A altura média das plantas aumentou significativamente com o incremento das doses de metribuzin, sendo que as alturas máximas das plantas foram 761, 784, 815 e 812 mm, em ordem crescente de dose de metribuzin. As variações das taxas de acúmulo de matéria seca foram nitida mente seqüenciais em todos os tratamentos, ocorrendo mudanças do dreno metabólico preferencial de um órgão para outro, de acordo com as transformações morfológicas das plantas, ressaltando-se que o metribuzin não alterou esse comportamento. Os tratamentos não influencia ramo acumulo de matéria seca das vagens (Wv, no entanto, a partir do inicio da maturação, as plantas-controle apres entaram maiores Wv, provavelmente, devido a maior taxa assi milatória líquida verificada a partir da floração plena. A matéria seca acumulada nos pericarpos (Wp diminuiu, a partir das sementes completamente desenvolvid os, para todos os tratamentos com exceção de Wp das plantas tratadas com 0,7 kg i.a. ha-1 de metribuzin que, manteve-se estável. Por outro lado, a matéria seca nas sementes (Ws aumentou de forma acentuada, desde o seu aparecimento até a colheita final , em todas as doses do herbicida.Development, assimlate partition and dry matter production in soybean (Glycine Max (L. Merri ll, cv. Uberaba plants treat ed with four metri buzin doses (0,0; 0,35; 0,70 and 1,05 kg i.a.ha-1 were studied in a field experiment. Metribuzin did not reduce the stand or alter ed significantly shoot /root ratio. Plants height average incre ased as the doses of metribuzin increased; maximum heights were 761, 784, 815 and 812 mm, for

  17. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress

    Directory of Open Access Journals (Sweden)

    Saqib Bilal

    2017-05-01

    Full Text Available This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum, Paecilomyces formosus, Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean in response to dose-dependent increases in soil Ni (0.5, 1.0, and 5.0 mM. Inoculation with P. formosus LHL10 significantly increased plant biomass and growth attributes as compared to non-inoculated control plants with or without Ni contamination. LHL10 enhanced the translocation of Ni from the root to the shoot as compared to the control. In addition, P. formosus LHL10 modulated the physio-chemical apparatus of soybean plants during Ni-contamination by reducing lipid peroxidation and the accumulation of linolenic acid, glutathione, peroxidase, polyphenol oxidase, catalase, and superoxide dismutase. Stress-responsive phytohormones such as abscisic acid and jasmonic acid were significantly down-regulated in fungal-inoculated soybean plants under Ni stress. LHL10 Ni-remediation potential can be attributed to its phytohormonal synthesis related genetic makeup. RT-PCR analysis showed the expression of indole-3-acetamide hydrolase, aldehyde dehydrogenase for indole-acetic acid and geranylgeranyl-diphosphate synthase, ent-kaurene oxidase (P450-4, C13-oxidase (P450-3 for gibberellins synthesis. In conclusion, the inoculation of P. formosus can significantly improve plant growth in Ni-polluted soils, and assist in improving the phytoremediation abilities of economically important crops.

  18. Conformational Structure of Tyrosine, Tyrosyl-Glycine, and Tyrosyl-Glycyl-Glycine by Double Resonance Spectroscopy

    Science.gov (United States)

    Abo-Riziq, Ali; Grace, Louis; Crews, Bridgit; Callahan, Michael P,; van Mourik, Tanja; de Vries, Mattanjah S,

    2011-01-01

    We investigated the variation in conformation for the amino acid tyrosine (Y), alone and in the small peptides tyrosine-glycine (YC) and tyrosine-glycine-glycine (YGG), in the gas phase by using UV-UV and IR-UV double resonance spectroscopy and density functional theory calculations. For tyrosine we found seven different conformations, for YG we found four different conformations, and for YGG we found three different conformations. As the peptides get larger, we observe fewer stable conformers, despite the increasing complexity and number of degrees of freedom. We find structural trends similar to those in phenylalanine-glycine glycine (FGG) and tryptophan-glycine-glycine (WGG)j however) the effect of dispersive forces in FGG for stabilizing a folded structure is replaced by that of hydrogen bonding in YGG.

  19. Effects of hydrogen fluoride and wounding on respiratory enzymes in soybean leaves

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C J; Miller, G W; Welkie, G W

    1966-01-01

    Soybeans (Glycine max, merr, Var. Hawkeye) were cultured in Hoagland's solution and fumigated with hydrogen fluoride (ca. 100 ppb). After 24, 96 and 144 hr of fumigation, the enzyme activities of cytochrome oxidase, peroxidase, catalase, polyphenol oxidase, ascorbic acid oxidase and glucose-6-phosphate dehydrogenase were assayed in leaves from fumigated and control plants. The total oxygen uptake after each time of treatment was measured. The effect of mechanically wounding the tissue on the above enzymes was determined by rubbing with carborundum. Glucose-6-phosphate dehydrogenase activity from fumigated leaves showed an average increase of 5 to 22 times that of the control. Cytochrome oxidase, peroxidase and catalase activities were markedly stimulated by fluoride fumigation. Polyphenol oxidase activity was suppressed throughout the fumigation period. Ascorbic acid oxidase was stimulated at the initial state, then showed a steady decrease in activity. In vitro tests revealed that ascorbic acid oxidase and peroxidase were very sensitive to fluoride ions. Polyphenol oxidase was only slightly inhibited by 10/sup -2/M KF solution. Cytochrome oxidase and catalase were not affected by KF up to 10/sup -2/M. Total respiration throughout the treatment period showed an accelerated rate. All enzymes studied were stimulated by wounding. The effect of HF on respiration and specific enzymes is discussed in terms of direct effects and injury. 48 references, 8 tables.

  20. Rye cover crop increases earthworm populations and reduces losses of broadcast, fall-applied, fertilizers in surface runoff

    Science.gov (United States)

    Corn (Zea mays L.) silage and soybean [Glycine max (L.) Merr.] rotations in the US Upper Midwest leave minimal amounts of surface residues, which can contribute to soil degradation and a reduction in water quality. Planting cover crops after harvest can reduce these concerns, but their effectiveness...

  1. Soybean (Glycine max) SWEET gene family: insights through comparative genomics, transcriptome profiling and whole genome re-sequence analysis.

    Science.gov (United States)

    Patil, Gunvant; Valliyodan, Babu; Deshmukh, Rupesh; Prince, Silvas; Nicander, Bjorn; Zhao, Mingzhe; Sonah, Humira; Song, Li; Lin, Li; Chaudhary, Juhi; Liu, Yang; Joshi, Trupti; Xu, Dong; Nguyen, Henry T

    2015-07-11

    SWEET (MtN3_saliva) domain proteins, a recently identified group of efflux transporters, play an indispensable role in sugar efflux, phloem loading, plant-pathogen interaction and reproductive tissue development. The SWEET gene family is predominantly studied in Arabidopsis and members of the family are being investigated in rice. To date, no transcriptome or genomics analysis of soybean SWEET genes has been reported. In the present investigation, we explored the evolutionary aspect of the SWEET gene family in diverse plant species including primitive single cell algae to angiosperms with a major emphasis on Glycine max. Evolutionary features showed expansion and duplication of the SWEET gene family in land plants. Homology searches with BLAST tools and Hidden Markov Model-directed sequence alignments identified 52 SWEET genes that were mapped to 15 chromosomes in the soybean genome as tandem duplication events. Soybean SWEET (GmSWEET) genes showed a wide range of expression profiles in different tissues and developmental stages. Analysis of public transcriptome data and expression profiling using quantitative real time PCR (qRT-PCR) showed that a majority of the GmSWEET genes were confined to reproductive tissue development. Several natural genetic variants (non-synonymous SNPs, premature stop codons and haplotype) were identified in the GmSWEET genes using whole genome re-sequencing data analysis of 106 soybean genotypes. A significant association was observed between SNP-haplogroup and seed sucrose content in three gene clusters on chromosome 6. Present investigation utilized comparative genomics, transcriptome profiling and whole genome re-sequencing approaches and provided a systematic description of soybean SWEET genes and identified putative candidates with probable roles in the reproductive tissue development. Gene expression profiling at different developmental stages and genomic variation data will aid as an important resource for the soybean research

  2. WiMax taking wireless to the max

    CERN Document Server

    Pareek, Deepak

    2006-01-01

    With market value expected to reach 5 billion by 2007 and the endorsement of some of the biggest names in telecommunications, World Interoperability for Microwave Access (WiMAX) is poised to change the broadband wireless landscape. But how much of WiMAX's touted potential is merely hype? Now that several pre-WiMAX networks have been deployed, what are the operators saying about QoS and ROI? How and when will device manufacturers integrate WiMAX into their products? What is the business case for using WiMAX rather than any number of other established wireless alternatives?WiMAX: Taking Wireless

  3. A new species of Lysiphlebus Förster 1862 (Hymenoptera: Braconidae, Aphidiinae) attacking soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae) from China

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Rakhshani, E.; Tomanović, Ž.; Hoelmer, K.; Kavallieratos, N. G.; Yu, J.; Wang, M.; Heimpel, G. E.

    2010-01-01

    Roč. 19, č. 1 (2010), s. 179-186 ISSN 1070-9428 Grant - others:Ministry of Science and Technological Developments of the Republic of Serbia(SR) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Lysiphlebus orientalis sp. n. * aphid parasitoids * Glycine max Subject RIV: EG - Zoology Impact factor: 0.500, year: 2010

  4. A decline in transcript abundance for Heterodera glycines homologs of Caenorhabditis elegans uncoordinated genes accompanies its sedentary parasitic phase

    Directory of Open Access Journals (Sweden)

    Overall Christopher C

    2007-04-01

    Full Text Available Abstract Background Heterodera glycines (soybean cyst nematode [SCN], the major pathogen of Glycine max (soybean, undergoes muscle degradation (sarcopenia as it becomes sedentary inside the root. Many genes encoding muscular and neuromuscular components belong to the uncoordinated (unc family of genes originally identified in Caenorhabditis elegans. Previously, we reported a substantial decrease in transcript abundance for Hg-unc-87, the H. glycines homolog of unc-87 (calponin during the adult sedentary phase of SCN. These observations implied that changes in the expression of specific muscle genes occurred during sarcopenia. Results We developed a bioinformatics database that compares expressed sequence tag (est and genomic data of C. elegans and H. glycines (CeHg database. We identify H. glycines homologs of C. elegans unc genes whose protein products are involved in muscle composition and regulation. RT-PCR reveals the transcript abundance of H. glycines unc homologs at mobile and sedentary stages of its lifecycle. A prominent reduction in transcript abundance occurs in samples from sedentary nematodes for homologs of actin, unc-60B (cofilin, unc-89, unc-15 (paromyosin, unc-27 (troponin I, unc-54 (myosin, and the potassium channel unc-110 (twk-18. Less reduction is observed for the focal adhesion complex gene Hg-unc-97. Conclusion The CeHg bioinformatics database is shown to be useful in identifying homologs of genes whose protein products perform roles in specific aspects of H. glycines muscle biology. Our bioinformatics comparison of C. elegans and H. glycines genomic data and our Hg-unc-87 expression experiments demonstrate that the transcript abundance of specific H. glycines homologs of muscle gene decreases as the nematode becomes sedentary inside the root during its parasitic feeding stages.

  5. Synthesis and distribution of N-benzyloxycarbonyl-[14C]-glycine, a lipophilic derivative of glycine

    International Nuclear Information System (INIS)

    Lambert, D.M.; Gallez, Bernard; Poupaert, J.H.

    1995-01-01

    N-benzyloxycarbonyl[ 14 C]-glycine, a lipophilic derivative of glycine exhibiting anticonvulsant properties, was prepared in one step from [U- 14 C] glycine and benzyl chloroformate in alkali medium. a comparative study of biodistribution was carried on mice between this compound and the parent amino-acid after intravenous administration. Dimethylsulfoxide was used as injection vehicle for N-benzyloxycarbonylglycine. The influence of this injection vehicle was studied comparing glycine injected in a saline solution and glycine co-administered with dimethylsulfoxide. No significant difference was found between these two treatments. Compared to glycine, N-benzyloxycarbonylglycine reached quickly the central nervous system and exhibited an enhanced brain penetration index, 13-fold superior to the parent aminoacid value. (Author)

  6. From forest to waste: Assessment of the Brazilian soybean chain, using nitrogen as a marker.

    NARCIS (Netherlands)

    Smaling, E.M.A.; Roscoe, R.; Lesschen, J.P.; Bouwman, A.F.; Comunello, E.

    2008-01-01

    Soybean (Glycine max) is a booming crop in Brazil. In 2004, the export value was equivalent to 10 billion US $, covering over 10% of total Brazilian exports. Three-quarters of total production leaves the country, mainly to China and the European Union (EU). Soybean cultivation in Brazil is expected

  7. Analysis and modeling of dry matter production rate by soybean [Glycine max] community: Curvilinear response to radiation intensity

    International Nuclear Information System (INIS)

    Sameshima, R.

    1996-01-01

    The linear relationship between the amount of absorbed radiation and dry matter production by crop communities has long been known, and the proportionality constant between them is known as the radiation use efficiency (RUE). To analyze and predict crop production using RUE, the assumption is often made that RUE is not sensitive to radiation intensity and that dry matter production rate (DMPR) is a linear function of radiation intensity.However, there is evidence in opposition to this assumption, including reports of increasing RUE in shade tests, and hyperbolic response of photosynthetic rate to radiation intensity. The following model was developed and used to analyze the response of DMPR and RUE to daily radiation R S : DMPR = DMPR max (R S ) * g(α) where DMPR max (R S ) is the DMPR of a hypothetical soybean community absorbing all radiation, and g(α) represents the effect of radiation absorptivity (α). A hyperbolic curve and a straight line were employed for DMPR max (R S ) and g(α), respectively. Field experimental data including shade tests were used to determine the parameters for the model. Two sets of parameters were required to cover the entire experimental period. DMPR max (R S ) had an apparent curvilinear relationship with R S . The model successfully described dry matter production under successive low radiation conditions, which could not be estimated by a model with RUE insensitive to radiation. (author)

  8. Chemical Composition, Antioxidant and Biological Activities of the Essential Oil and Extract of the Seeds of Glycine max (Soybean) from North Iran.

    Science.gov (United States)

    Ghahari, Somayeh; Alinezhad, Heshmatollah; Nematzadeh, Ghorban Ali; Tajbakhsh, Mahmood; Baharfar, Robabeh

    2017-04-01

    Glycine max (L.) Merrill (soybean) is a major leguminous crop, cultivated globally as well as in Iran. This study examines the chemical composition of soybean essential oil, and evaluates the antioxidant and antimicrobial activities of seeds on various plant pathogens that commonly cause irreparable damages to agricultural crops. The essential oil of soybean seeds was analyzed by gas chromatography coupled to mass spectrometry. Antimicrobial activity was tested against 14 microorganisms, including three gram-positive, five gram-negative bacteria, and six fungi, using disk diffusion method and the Minimum Inhibitory Concentration technique. The soybean seeds were also subjected to screening for possible antioxidant activity by using catalase, peroxidase, superoxide dismutase, and 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay. Forty components were identified, representing 96.68% of the total oil. The major constituents of the oil were carvacrol (13.44%), (E,E)-2,4-decadienal (9.15%), p-allylanisole (5.65%), p-cymene (4.87%), and limonene (4.75%). The oil showed significant activity against Pseudomonas syringae subsp. syringae, Rathayibacter toxicus with MIC = 25 µg/mL, and Pyricularia oryzae with MIC = 12.5 µg/mL. In addition, the free radical scavenging capacity of the essential oil was determined with an IC 50 value of 162.35 µg/mL. Our results suggest that this plant may be a potential source of biocide, for economical and environmentally friendly disease control strategies. It may also be a good candidate for further biological and pharmacological investigations.

  9. Effect of cadmium salts on some growth and metabolic activities of selected fungi from the rhizosphere of Glycine max and Zea mays

    Energy Technology Data Exchange (ETDEWEB)

    Naguib, M.I.; Ali, M.I.; Haikal, N.Z.; Sharaf, E.F. (Cairo Univ. (Egypt))

    1986-12-01

    Six fungi, isolated from the rhizosphere of Glycine max and Zea Mays, were selected for their variable resistance to soil application of cadmium nitrate and cadmium sulfate, at the range of 100-1000 ppm concentration. These were (a) Aspergillus terreus and Rhizopus oryzae; (b) Paecilomyces divaricata, Curvularia tetramera; (c) Fusarium oxysporum and (d) Cladosporium herbarum. Fifty ppm cadmium salts exerted no effect on spore germination of R. oryzae, F. oxysporum or C. tetramera, stimulated A. terreus and P. divaricata and suppressed C. herbarum. 100 ppm dose exerted variable effects dependent on the organism and/or accompanying anion. 1000 ppm cadmium arrested spore germination of all the tested fungi except F. oxysporum where marked suppression were observed. Cadmium arrested growth of C. herbarum and P. divaricata at 50 ppm, initiated that of A. terreus, C. tetramera and F. oxysporum but seemed without effect on R. oryzae. Larger doses seemed to be inhibitory to all organisms, R. oryzae being least affected. Results show that nitrogen secretion was not a function of tolerance of the fungi to cadmium applied to the soil but was largely controlled by the effect of cadmium on the permeability of the cells of each individual fungus. Cadmium seemed to stimulate nitrogen metabolism of Aspergillus and Fusarium, had little or no effect on that of Rhizopus but suppressed that of Curvularia. Most accumulated nitrogen was in the form of amino and other soluble nitrogen. Cadmium inhibited the incorporation of absorbed phosphorus into energy-rich compounds. This was concomitant with the failure of amino acid incorporation into proteins.

  10. Synthesis and distribution of N-benzyloxycarbonyl-[{sup 14}C]-glycine, a lipophilic derivative of glycine

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D.M.; Gallez, Bernard; Poupaert, J.H. [Universite Catholique de Louvain, Brussels (Belgium). Dept. des Sciences Pharmaceutiques

    1995-12-31

    N-benzyloxycarbonyl[{sup 14}C]-glycine, a lipophilic derivative of glycine exhibiting anticonvulsant properties, was prepared in one step from [U-{sup 14}C] glycine and benzyl chloroformate in alkali medium. a comparative study of biodistribution was carried on mice between this compound and the parent amino-acid after intravenous administration. Dimethylsulfoxide was used as injection vehicle for N-benzyloxycarbonylglycine. The influence of this injection vehicle was studied comparing glycine injected in a saline solution and glycine co-administered with dimethylsulfoxide. No significant difference was found between these two treatments. Compared to glycine, N-benzyloxycarbonylglycine reached quickly the central nervous system and exhibited an enhanced brain penetration index, 13-fold superior to the parent aminoacid value. (Author).

  11. Escherichia coli O157:H7 Converts Plant-Derived Choline to Glycine Betaine for Osmoprotection during Pre- and Post-harvest Colonization of Injured Lettuce Leaves

    Directory of Open Access Journals (Sweden)

    Russell A. Scott

    2017-12-01

    Full Text Available Plant injury is inherent to the production and processing of fruit and vegetables. The opportunistic colonization of damaged plant tissue by human enteric pathogens may contribute to the occurrence of outbreaks of foodborne illness linked to produce. Escherichia coli O157:H7 (EcO157 responds to physicochemical stresses in cut lettuce and lettuce lysates by upregulation of several stress response pathways. We investigated the tolerance of EcO157 to osmotic stress imposed by the leakage of osmolytes from injured lettuce leaf tissue. LC-MS analysis of bacterial osmoprotectants in lettuce leaf lysates and wound washes indicated an abundant natural pool of choline, but sparse quantities of glycine betaine and proline. Glycine betaine was a more effective osmoprotectant than choline in EcO157 under osmotic stress conditions in vitro. An EcO157 mutant with a deletion of the betTIBA genes, which are required for biosynthesis of glycine betaine from imported choline, achieved population sizes twofold lower than those of the parental strain (P < 0.05 over the first hour of colonization of cut lettuce in modified atmosphere packaging (MAP. The cell concentrations of the betTIBA mutant also were 12-fold lower than those of the parental strain (P < 0.01 when grown in hypertonic lettuce lysate, indicating that lettuce leaf cellular contents provide choline for osmoprotection of EcO157. To demonstrate the utilization of available choline by EcO157 for osmoadaptation in injured leaf tissue, deuterated (D-9 choline was introduced to wound sites in MAP lettuce; LC-MS analysis revealed the conversion of D9-choline to D-9 glycine betaine in the parental strain, but no significant amounts were observed in the betTIBA mutant. The EcO157 ΔbetTIBA-ΔotsBA double mutant, which is additionally deficient in de novo synthesis of the compatible solute trehalose, was significantly less fit than the parental strain after their co-inoculation onto injured lettuce leaves and

  12. [1-14C]Glycolate metabolism and serine biosynthesis in soybean plants

    International Nuclear Information System (INIS)

    Calmes, J.; Viala, G.; Latche, J.C.; Cavalie, G.

    1977-01-01

    [1- 14 C]Glycolate metabolism was examined in leafy shoots of soybean plants (Glycine max (L.) Merr., var. Adepta). Only small amounts of 14 C were incorporated into evolved carbon dioxide and glucidic compounds. Free and protein glycine was labelled but higher levels of radioactivity were found in free serine. Changes in the distribution of 14 C with time showed that metabolic conversion glycollate → glycine → serine occurred very early and serine biosynthesis was more important in the shoot than in the leaves. Carbon dioxide labelling was always slight compared to serine labelling. These data suggest strong relations between glycollate and nitrogen metabolism

  13. Jasmonic acid Modulates the Physio-Biochemical Attributes, Antioxidant Enzyme Activity and Gene Expression in Glycine max under Nickel Toxicity

    Directory of Open Access Journals (Sweden)

    Geetika eSirhindi

    2016-05-01

    Full Text Available In present study, we evaluated the effects of Jasmonic acid (JA on physio-biochemical attributes, antioxidant enzyme activity and gene expression in soybean (Glycine max L. plants subjected to nickel (Ni stress. Ni stress decreases the shoot and root length and chlorophyll content by 37.23%, 38.31% and 39.21% respectively over the control. However, application of JA was found to improve the chlorophyll content and growth of Ni-stressed seedlings in terms of root and shoot length. Plants supplemented with Jasmonate restores the chlorophyll fluorescence, which was disturbed by Ni stress. The present study demonstrated increase in proline, glycinebetaine, total protein and total soluble sugar (TSS by 33.09%, 51.26%, 22.58% and 49.15% respectively under Ni toxicity as compared to control. Supplementation of JA to Ni stressed plants further enhanced the above parameters. Ni stress increases hydrogen peroxide (H2O2 by 68.49%, lipid peroxidation (MDA by 50.57% and NADPH oxidase by 50.92% over the control. Supplementation of JA minimizes the accumulation of H2O2, MDA and NADPH oxidase, which helps in stabilization of biomolecules. The activities of superoxide dismutase (SOD, peroxidase (POD, catalase (CAT and ascorbate peroxidase (APX increases by 40.04%, 28.22%, 48.53% and 56.79% respectively over the control in Ni treated seedlings and further enhancement in the antioxidant activity was observed by the application of JA. Ni treated soybean seedlings showed increase in expression of Fe-SOD by 77.62%, CAT by 15.25%, POD by 58.33% and APX by 80.58% over the control. Nevertheless, application of JA further enhanced the expression of the above genes in the present study. Our results signified that Ni stress caused negative impacts on soybean seedlings, but, co-application of JA facilitate the seedlings to combat the detrimental effects of Ni through enhanced osmolytes and osmoprotectants, antioxidant enzyme activity and gene expression.

  14. Mutants obtained by chronic gamma irradiation of soybean [Glycine Max (l.) Merrill]varieties

    International Nuclear Information System (INIS)

    Hajos Novak, M; Korosi, F.; Sipos, T.; Hodosne Kotvics, G.

    2001-01-01

    Soybean [Glycine max (L.) Merrill] is a wonder crop, containing about 20% oil and 40% high quality protein, having multiple uses such as food, fodder and industrial products. In Hungary in he last few years there has been a renewed interest in improving protein and oil content of the soybean crop. Selection for oil and/or protein content from segregating populations, derived from induced mutagenesis or hybridization, is known to be effective. Orf and Helms (1994) emphasized, that to fulfill demands of both sellers and purchasers, combined selection for yield components, yield, oil and/or protein content has to be carried out. For this purpose mutant soybean germplasm s were developed by pedigree method from a Carpathian-Ukrainian (KA) further more a Vietnamese (VL40) local variety adapted to Hungarian environmental conditions by 100-300 Gy chronic gamma irradiation. A function index was introduced to evaluate the genetic variability for the quality parameters and the most important agronomic traits. Chronic gamma irradiation increased the genetic variability of the oil content in the KA and of the protein content in the VL40 germplasm. Function index predicted up to 28% oil content in the KA mutant germplasm. Plants with 24.1 and 23.6% oil content were selected from the 150 Gy and the 100 Gy populations in the M4 generation. In the M5, progenies of a superior plant with 23.6% oil content were homozygous for this characteristics, while progenies of a superior plant with 24.1% oil content were segregating. Year can cause +-2.0-2.5% differences in the oil content of the seeds. Oil content had a moderate negative correlation with 1000-seed weight in both of the above mentioned generations .Seed samples with the highest oil content were analysed for fatty acid composition using gas-liquid chromatography. Their linoleic acid content ranged from 51.8 to 55.0%. Unfortunately, in M5 the linolenic acid content was higher than in M4, varying between 7.9% and 9.3%. The 200 Gy

  15. RELACIÓN BIOMASA DE RAÍZ/BIOMASA TOTAL DE SOJA (Glycine max EN DOS SISTEMAS DE LABRANZA

    Directory of Open Access Journals (Sweden)

    Mónica Beatriz Barrios

    2014-07-01

    Full Text Available La soja es el principal cultivo en Argentina debido a su adaptación a los suelos, la incorporación de tecnología con el empleo de la siembra directa y el precio del mercado internacional. Las propiedades físicas, químicas y biológicas de cada suelo se ven modificadas por el tipo de sistema de laboreo empleado. El entorno generado por la labranza altera el crecimiento y el equilibrio funcional de los cultivos herbáceos. En el año 2006, se instaló un ensayo en el Partido de Ezeiza (Pampa Ondulada, con el objetivo de evaluar los efectos del sistema de laboreo en el equilibrio funcional entre biomasa de raíces/biomasa total en soja (Glycine max durante la campaña 2012/2013. Se utilizó un diseño de bloques completos al azar con dos tratamientos que consistieron en: labranza convencional (LC y siembra directa (SD, con cuatro repeticiones. Se midió: peso de biomasa aérea, área foliar, rendimiento en grano, peso de raíces de 0-10 y 10-20 cm de profundidad, y se calculó biomasa total y la relación biomasa de raíces/biomasa total. El peso de raíces se determinó con el método del cilindro, el área foliar con el paquete estadístico Iproplus y el rendimiento con el cuadrado de corte. Los datos obtenidos fueron sometidos a análisis de varianza y las medias de los tratamientos fueron comparadas según Tukey (P < 0.05. El efecto del sistema de labranza generó diferentes respuestas en función de la variable evaluada y la fecha de muestreo. LC resultó significativamente superior (P < 0.05 respecto a SD en biomasa total y biomasa aérea en las etapas fenológicas R3 y R5; biomasa de raíces en R1 y R3; IAF en R2, R3 y R5. El rendimiento en grano fue mayor en LC respecto de SD, sin embargo el sistema de labranza no afectó la relación biomasa de raíz/biomasa total.

  16. Feeding preference of Diabrotica speciosa (Ger. (Coleoptera: Chrysomelidae by broccoli leaves from natural, organic and conventional farming systems/ Preferência alimentar de Diabrotica speciosa (Ger. (Coleoptera: Chrysomelidae por folhas de brócolos cultivado em sistema natural, orgânico e convencional

    Directory of Open Access Journals (Sweden)

    Pedro Manuel O. J. Neves

    2006-06-01

    Full Text Available Multiple-choice laboratory tests were achieved to compare feeding preference of Diabrotica speciosa (Ger. to leaves of broccoli (Brassica oleraceae L. var. italica from natural, conventional and organic farming systems. Natural farming systems included incorporation of the elephant grass Pennisetum purpureum Schumacher cv. Napier (50 ton/ha, Bokashi compost (1.5 ton/ha and spray of EM 4 (Natural 1, or the incorporation of the Bokashi compost (1.5 ton /ha and spray of EM 4 (Natural 2, and in the conventional, NPK + borax were incorporated in the planting + dressing N and organic compost (1 kg/ plant was incorporated in the organic system. Organic compost was prepared using crop residues of corn (Zea mays L., soybean [Glycine max (L. Mer.], and cattle manure. Leaf discs were collected and placed in cages in multiple-choice tests. Beetles preferred mostly broccoli leaves from conventional farming system than leaves from Natural (1 and 2 and Organic farming systems. Feeding on leaves from Natural 1, Natural 2 and Organic farming system were 68, 67 and 57% of the feeding on leaves from Conventional farming system.Testes de múltipla escola foram realizados para comparar a preferência alimentar de Diabrotica speciosa (Ger. por folhas de brócolos (Brassica oleraceae L. var. italica cultivado em sistema natural, convencional e orgânico. No sistema natural de cultivo houve a incorporação de capim elefante Pennisetum purpureum Schumacher cv. Napier (50 ton/ha, composto Bokashi (1,5 ton/ha e pulverização de EM 4 (Natural 1, ou a incorporação do composto Bokashi (1,5 ton/ha e pulverização do EM 4 (Natural 2, no sistema convencional houve a incorporação do NPK + borax + N em cobertura, e no sistema orgânico incorporouse composto orgânico (1 kg/planta. O composto orgânico foi preparado utilizando-se resíduos de milho (Zea mays L. e soja [Glycine max (L. Mer.] e esterco de gado. Folhas foram retiradas das plantas das quais foram separados

  17. Effect of no-tillage crop rotation systems on nutrient status of a rhodic ...

    African Journals Online (AJOL)

    In this study the effects of no-tillage and eight crop rotations (established in 1985) on chemical properties of a Rhodic Ferralsol (Typic Haplorthox, Soil Taxonomy) and on nutrient uptake by maize (Zea mays L.) and soybean (Glycine max L. Merrill) leaves were assessed in the state of São Paulo, Brazil, using a randomized ...

  18. Yield and Yield Attributes Responses of Soybean (Glycine max L. Merrill to Elevated CO2 and Arbuscular Mycorrhizal Fungi Inoculation in the Humid Transitory Rainforest

    Directory of Open Access Journals (Sweden)

    Nurudeen ADEYEMI

    2017-06-01

    Full Text Available Variations in yield components and grain yield of arbuscular mycorrhizal fungi (AMF inoculated soybean varieties (Glycine max L. Merrill grown in CO2 enriched environment in the humid rainforest were tested.  A screen house trial was established with soybean varieties (‘TGx 1448-2E’, ‘TGx 1440-1E’ and ‘TGx 1740-2F’, AMF inoculation (with and without and CO2 enrichment (350±50 ppm and 550±50 ppm in open top chamber, arranged in completely randomised design, replicated three times. A field trial was also conducted; the treatments were arranged in a split-split plot configuration fitted into randomised complete block design. In the main plot the variant was CO2 enrichment, the sub-plot consisted of AMF inoculation (with and without, while the sub-sub plot consisted of soybean varieties, replicated three times. Both trials had significantly higher grain yield at elevated CO2 than ambient. This could be attributed to improved yield attributes, more spore count and root colonisation. In both trials, inoculated soybean had significantly higher dry pod weight than un-inoculated, which could suggest the increased grain yield observed on the field. AMF inoculated soybean varieties outperformed un-inoculated in both CO2 enriched and ambient concentrations. AMF inoculated soybean variety ‘TGx 1740-2F’ is most preferable in CO2 enriched environment, while variety ‘TGx 1448-2E’ had the most stable grain yield in all growth environments.

  19. Molecular cloning, characterization and expression analysis of two members of the Pht1 family of phosphate transporters in Glycine max.

    Directory of Open Access Journals (Sweden)

    Zhaoyun Wu

    Full Text Available BACKGROUND: Phosphorus is one of the macronutrients essential for plant growth and development. The acquisition and translocation of phosphate are pivotal processes of plant growth. In a large number of plants, phosphate uptake by roots and translocation within the plant are presumed to occur via a phosphate/proton cotransport mechanism. PRINCIPAL FINDINGS: We cloned two cDNAs from soybean (Glycine max, GmPT1 and GmPT2, which show homology to the phosphate/proton cotransporter PHO84 from the budding yeast Saccharomyces cerevisiae. The amino acid sequence of the products predicted from GmPT1 and GmPT2 share 61% and 63% identity, respectively, with the PHO84 in amino acid sequence. The deduced structure of the encoded proteins revealed 12 membrane-spanning domains with a central hydrophilic region. The molecular mass values are ∼58.7 kDa for GmPT1 and ∼58.6 kDa for GmPT2. Transiently expressed GFP-protein fusions provide direct evidence that the two Pi transporters are located in the plasma membrane. Uptake of radioactive orthophosphate by the yeast mutant MB192 showed that GmPT1 and GmPT2 are dependent on pH and uptake is reduced by the addition of uncouplers of oxidative phosphorylation. The K(m for phosphate uptake by GmPT1 and GmPT2 is 6.65 mM and 6.63 mM, respectively. A quantitative real time RT-PCR assay indicated that these two genes are expressed in the roots and shoots of seedlings whether they are phosphate-deficient or not. Deficiency of phosphorus caused a slight change of the expression levels of GmPT1 and GmPT2. CONCLUSIONS: The results of our experiments show that the two phosphate transporters have low affinity and the corresponding genes are constitutively expressed. Thereby, the two phosphate transporters can perform translocation of phosphate within the plant.

  20. The effect of soil tillage system and weeding time on the growth of weed and yield of soybean (Glycine max (L. Merril

    Directory of Open Access Journals (Sweden)

    Husni Thamrin Sebayang

    2018-04-01

    Full Text Available The growth and yield of soybeans can decrease due to competition from weeds. Various efforts have been made to control the growth of weeds such as land preparation and weeding periods. An experiment to study the effect of soil tillage systems and weeding time on the growth of weeds and soybean crop yield (Glycine max (L. Merril has been done in Wringinsongo Village, Tumpang Sub-District, Malang Regency from February to May 2017. The split-plot design with three replicates was used with the soil tillage system as the main plot consisting of three levels, T0: no tillage, T1: minimum tillage, and T2: conventional tillage, and weeding time as the sub plot consisting of 4 levels, P0: no weeding, P1: weeding 1 time, P2: weeding two times and P3: weeding three times. The results showed that the dominant weed species before treatment were Amaranthus spinosus (Spiny amaranth, Cynodon dactylon (Bermuda grass, Cyperus rotundus (Purple nutsedge, Ageratum conyzoides (Billygoat weed, and Portulaca oleracea (Common purslane. After treatment, the dominant weed species were Cyperus rotundus (Purple nutsedge, Amaranthus spinosus (Spiny amaranth, Ageratum conyzoides (Billygoat weed, Physalis peruviana (Cape gooseberry, and Eclipta alba (False daisy. There was no significant difference of the dry weight of weeds in conventional tillage followed by weeding 3 times at 15, 30 and 45 days after planting, and minimum tillage and no tillage. For the yield of soybeans, conventional tillage followed by weeding 3 times at 15, 30 and 45 days after planting were not significant with that of minimum tillage. The yield of soybeans was lower than that of with no tillage and no weeding.

  1. Formation of intercalation compound of kaolinite-glycine via displacing guest water by glycine.

    Science.gov (United States)

    Zheng, Wan; Zhou, Jing; Zhang, Zhenqian; Chen, Likun; Zhang, Zhongfei; Li, Yong; Ma, Ning; Du, Piyi

    2014-10-15

    The kaolinite-glycine intercalation compound was successfully formed by displacing intercalated guest water molecules in kaolinite hydrate as a precursor. The microstructure of the compound was characterized by X-ray diffraction, Fourier Transform Infrared Spectroscopy and Scanning Electron Microscope. Results show that glycine can only be intercalated into hydrated kaolinite to form glycine-kaolinite by utilizing water molecules as a transition phase. The intercalated glycine molecules were squeezed partially into the ditrigonal holes in the silicate layer, resulting in the interlayer distance of kaolinite reaching 1.03nm. The proper intercalation temperature range was between 20°C and 80°C. An intercalation time of 24h or above was necessary to ensure the complete formation of kaolinite-glycine. The highest intercalation degree of about 84% appeared when the system was reacted at the temperature of 80°C for 48h. There were two activation energies for the intercalation of glycine into kaolinite, one being 21kJ/mol within the temperature range of 20-65°C and the other 5.8kJ/mol between 65°C and 80°C. The intercalation degree (N) and intercalation velocity (v) of as a function of intercalation time (t) can be empirically expressed as N=-79.35e(-)(t)(/14.8)+80.1 and v=5.37e(-)(t)(/14.8), respectively. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Efeito do metribuzin no controle das plantas daninhas e na produção de grãos em Glycine max (L merrill Effect of metribuzin in weed control and yield of Glycine max (L. merrill

    Directory of Open Access Journals (Sweden)

    J. P. Silva Neto

    1991-01-01

    Full Text Available No ano agrícola 1985/ 86, em Viçosa-MG, foi instalado um ensaio de campo em solo Pdzólico Vermelho-Amarelo argiloso e com 2,9% de matéria orgânica, objetivando estudar o efeito das doses de metribuzin (0,0; 0,35; 0,70 e 1,05 kg i.a.ha-1 no controle de plantas daninhas e na produtividade da soja (Geycine max (L. Merri ll, cv. 'Uber aba'. A maioria das monocotiledôneas que ocorreram na area experimental foi represent ada por Cyperus rotundus L., Brachiaria plantaginea (Link Hitch. e Cynodon dactylon (L. Pers., tendo-se verificado somente redução em Brachiaria planta taginea em virtude do aumento das doses de metribuzin, ocorrendo o mesmo com relação às dicotiledôneas que se fizerem presentes no experimento, com exceção de Oxalis Oxyptera Prop., que não foi controlada nas doses utilizadas. A densidade total médias das invasoras, menos Cyperus rotundus , Oxalis oxyptera e Cynodon dactylon, foi de 141; 124; 62 e 59 plantas . m-2, respectivamente, para as doses de 0,0; 0,35 ; 0,70 e 1,05 kg i.a.ha-1 de metribuzin. A dose de 0,35 kg i.a. de metribuzin.ha-1 foi suficiente para promover a redução da matéria seca da parte aérea das plantas daninhas com a mesma eficiência de controle da dose de 1,05 kg i.a .ha-1 Entretanto, a densidade total médil das invasoras foi reduzida sig nificativamente nas doses de 0,70 e 1,05 kg i.a. de metribuzin.ha-l. O efeito do metribuzin na soja foi evidenciado somente na dose de 1,05 kg i.a.ha-1, com injúria foliar (clorose leve ocorrida até 25 dias, aproximadamente, apôs a emergência das plântulas. Após esse período, houve total recuperação de todas as plantas de soja submetidas a essa dose. A produção de grão se o índice de colheita não foram influencia dos significativamente pelas doses de metribuzin.In order to test doses of metribu zin (0,0; 0,35; 0,70 and 1,05 kg a.i.ha ¹ in weed control and yield of soybe an (Glycine max (L. Merri ll, Uberaba, an experiment was conducted under

  3. Glycine metabolism by Pseudomonas aeruginosa: hydrogen cyanide biosynthesis

    International Nuclear Information System (INIS)

    Castric, P.A.

    1977-01-01

    Hydrogen cyanide (HCN) production by Pseudomonas aeruginosa in a synthetic medium is stimulated by the presence of glycine. Methionine enhances this stimulation but will not substitute for glycine as a stimulator of cyanogenesis. Threonine and phenylalanine are effective substitutes for glycine in the stimulation of HCN production. Glycine, threonine, and serine are good radioisotope precursors of HCN, but methionine and phenylalanine are not. Cell extracts of P. aeruginosa convert [ 14 C]threonine to [ 14 C]glycine. H14CN is produced with low dilution of label from either [1- 14 C]glycine or [2- 14 C]glycine, indicating a randomization of label either in the primary or secondary metabolism of glycine. When whole cells were fed [1,2- 14 C]glycine, cyanide and bicarbonate were the only radioactive extracellular products observed

  4. Anatomical, biochemical, and photosynthetic responses to recent allopolyploidy in Glycine dolichocarpa (Fabaceae).

    Science.gov (United States)

    Coate, Jeremy E; Luciano, Amelia K; Seralathan, Vasu; Minchew, Kevin J; Owens, Tom G; Doyle, Jeff J

    2012-01-01

    Previous studies have shown that polyploidy has pronounced effects on photosynthesis. Most of these studies have focused on synthetic or recently formed autopolyploids, and comparatively little is known about the integrated effects of natural allopolyploidy, which involves hybridity and genome doubling and often incorporates multiple genotypes through recurrent origins and lineage recombination. Glycine dolichocarpa (designated T2) is a natural allotetraploid with multiple origins. We quantified 21 anatomical, biochemical, and physiological phenotypes relating to photosynthesis in T2 and its diploid progenitors, G. tomentella (D3) and G. syndetika (D4). To assess how direction of cross affects these phenotypes, we included three T2 accessions having D3-like plastids (T2(D3)) and two accessions having D4-like plastids (T2(D4)). T2 accessions were transgressive (more extreme than any diploid accession) for 17 of 21 phenotypes, and species means differed significantly in T2 vs. both progenitors for four of 21 phenotypes (higher for guard cell length, electron transport capacity [J(max)] per palisade cell, and J(max) per mesophyll cell; lower for palisade cells per unit leaf area). Within T2, four of 21 parameters differed significantly between T2(D3) and T2(D4) (palisade cell volume; chloroplast number and volume per unit leaf area; and J(max) per unit leaf area). T2 is characterized by transgressive photosynthesis-related phenotypes (including an ca. 2-fold increase in J(max) per cell), as well as by significant intraspecies variation correlating with plastid type. These data indicate prominent roles for both nucleotypic effects and cytoplasmic factors in photosynthetic responses to allopolyploidy.

  5. 76 FR 8771 - Glycine From China

    Science.gov (United States)

    2011-02-15

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-718 (Third Review)] Glycine From China... order on glycine from China. SUMMARY: The Commission hereby gives notice that it will proceed with a... determine whether revocation of the antidumping duty order on glycine from China would be likely to lead to...

  6. 76 FR 55109 - Glycine From China

    Science.gov (United States)

    2011-09-06

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-718 (Third Review)] Glycine From China... U.S.C. 1675(c)), that revocation of the antidumping duty order on glycine from China would be likely... contained in USITC Publication 4255 (August 2011), entitled Glycine from China: Investigation No. 731-TA-718...

  7. Effect of Hf on the fine structure of mesophyll cells from Glycine max, Merr

    Energy Technology Data Exchange (ETDEWEB)

    Wei, L.; Miller, G.W.

    1972-04-01

    A series of ultrastructural changes were observed in soybean leaves fumigated with 40 to 50 ppb of hydrogen fluoride. In the cytoplasm the presence of small vacuoles was the first noticeable initial change. The fragmentation of the vacuolar membrane occurred either simultaneously or followed immediately. Lipid-droplet-like globules and numerous vesicles occurred subsequently in the cytoplasm and increased as the injury became more severe. There was a decrease in polysomes and a detachment of ribosome from the rough endoplasmic reticulum. Free ribosome concentration also decreased as the injury became severe. Mitochondrial modifications involving dilation of outer and cristae membranes followed by reduction of both cristae number and matrix electron density and the disappearance of mitochondrial granules were observed in the chlorotic leaves. Electron dense inclusions accumulated in some mitochondria as well. The first noticeable change observed in the chloroplast was the presence of clusters of phytoferritin granules within the stoma after only 2 days of fumigation. Alterations in nuclear structures were observed in later stages of injury. Numerous small electron dense particles were found on various types of membranes in cells of severely chlorotic leaves. They were distributed on outer mitochondrial membranes, endoplasmic reticula, dictyosomes, tonoplasts, plasmalemma, nuclear envelopes, and disintegrating organelles and vesicles, but were never observed on membranes of chloroplasts and microbodies. The presence of fluoride has attracted the attention of many workers primarily in certain industrial areas where the emitted atmospheric fluoride concentrates and is accumulated by plants initiating injury. 6 references.

  8. Utilization of [1-14C]carbon of glycine of high glycine diet fed young and old rats

    International Nuclear Information System (INIS)

    Petzke, K.J.; Albrecht, V.; Medovar, B.Ya.; Pisarczuk, K.L.; Grigorov, Yu.G.

    1987-01-01

    The incorporation of radioactivity from [1- 14 C]glycine was studied in various organ (serum, liver, muscle) fractions (acid soluble, proteins, lipids, liver glycogen) and carbon dioxide in rats fed with isonitrogenous isocaloric purfied diets. The diets contained 30% casein (control), gelatin (exchange of half of the 30% casein) or glycine (corresponding level of glycine in relation to the gelatin diet). The incorporation of radioactivity into proteins was reduced by feeding high glycine diets in young (20-weeks-old) and old (18-month-old) rats in relation to the control diet. The modifications of the results for old animals may be partially explained on the base of a reduced protein turnover rate and adaptation to a high gelatin (glycine) diet. (author)

  9. Min-Max Spaces and Complexity Reduction in Min-Max Expansions

    Energy Technology Data Exchange (ETDEWEB)

    Gaubert, Stephane, E-mail: Stephane.Gaubert@inria.fr [Ecole Polytechnique, INRIA and CMAP (France); McEneaney, William M., E-mail: wmceneaney@ucsd.edu [University of California San Diego, Dept. of Mech. and Aero. Eng. (United States)

    2012-06-15

    Idempotent methods have been found to be extremely helpful in the numerical solution of certain classes of nonlinear control problems. In those methods, one uses the fact that the value function lies in the space of semiconvex functions (in the case of maximizing controllers), and approximates this value using a truncated max-plus basis expansion. In some classes, the value function is actually convex, and then one specifically approximates with suprema (i.e., max-plus sums) of affine functions. Note that the space of convex functions is a max-plus linear space, or moduloid. In extending those concepts to game problems, one finds a different function space, and different algebra, to be appropriate. Here we consider functions which may be represented using infima (i.e., min-max sums) of max-plus affine functions. It is natural to refer to the class of functions so represented as the min-max linear space (or moduloid) of max-plus hypo-convex functions. We examine this space, the associated notion of duality and min-max basis expansions. In using these methods for solution of control problems, and now games, a critical step is complexity-reduction. In particular, one needs to find reduced-complexity expansions which approximate the function as well as possible. We obtain a solution to this complexity-reduction problem in the case of min-max expansions.

  10. The Effects of Seed Inoculation with Rhizobium and Nitrogen Application on Yield and some Agronomi Characterstics of Soybean (Glycine max L. under Ardabil Condition

    Directory of Open Access Journals (Sweden)

    M.N Seiedi

    2014-03-01

    Full Text Available In order to study the effects of seed inoculation with rhizobium and nitrogen application on yield and some agronomic characterstics of soybean (Glycine max L., a spilt plot experiment based on randomized complete block design with three replications was conducted in 2011 at the research farm of the Islamic Azad University, Ardabil Branch. Factors were inorganic nitrogen fertilizer urea at four levels (0, 30, 60 and 90 kg urea/ha in the main plot and two levels of inoculation with Rhizobium japanicum bacteria (with and without inoculation assigned to the sub plots. Study the growth indices showed that the maximum total dry matter (435.4 gr/m2 , crop growth rate (6.75 gr/m2.day and relative growth rate (0.1003 gr/gr.day were obtained from compound of treatments high levels of urea application × inoculation with rhizobium while, the minimum values of these indices recorded in without nitrogen application×non inoculation with rhizobium. The highest plant height, number of pod per plant and grain yield were obtained from the highest level of nitrogen fertilizer (90 kg/ha urea and seed inoculation with rhizobium. Number and dry weight of nodules per plant increased significantly with increasing nitrogen application till 60 kg/ha in seed inoculation with rhizobium. The lowest values of these traits recorded in non application of urea×non inoculation with rhizobium. Inoculation with rhizobium bacteria increased the number and dry weight of nodules per plant. Thus, it can be suggested that in order to increasing of grain yield, seed can be inoculated with rhizobium bacteria × application of 60 kg urea/ha in conditions of Ardabil region.

  11. Evaluation of replacement intercropping of soybean (Glycine max L. with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. under weed infestation

    Directory of Open Access Journals (Sweden)

    M. Bagheri Shirvan

    2016-05-01

    Full Text Available In order to evaluate intercropping of soybean (Glycine max L. cv. JK with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. with weed interference, an experiment was performed in randomized complete block design with 12 treatments and three replications at a field located 10 km of Shirvan during year of 2011. The treatments were included 75% soybean: 25%sweet basil, 50%soybean: 50% sweet basil, 25% soybean: 75% sweet basil, 75% soybean: 25% borage, 50% soybean: 50% borage and 25% soybean: 75% borage under weed infestation, in addition sole cropping of plants under weed control and weed interference. Intercropped plants had more success in reduction of weed density and biomass compared to monoculture. Soybean50: sweet basil50, reduced the weed density by 47.95% and 52.9%, and reduced the weed biomass by 68.91% and 61.87% more than sweet basil and soybean pure stand, respectively. Investigation of dry matter accumulation showed that increasing of plant proportion in intercropping caused increasing of plant dry matter. The height of soybean and borage was increased in intercropping and weed interference, while the highest height of sweet basil was observed in monoculture at second harvest. Biological and economical yield of soybean in intercropping with sweet basil was higher than intercropping with borage. The highest harvest index was related to 50:50 soybean: sweet basil ratio. In this ratio, the harvest index increased 4.9% compared to soybean monoculture. Yield of sweet basil and borage decreased with increasing of soybean rows in intercropping. Based on area-time equivalent ratio, soybean 75% with sweet basil and borage 25% (based on borage seed yield had 3% and 4% advantage compared to monoculture.

  12. Glycine serine interconversion in the rooster

    International Nuclear Information System (INIS)

    Sugahara, Michihiro; Kandatsu, Makoto

    1976-01-01

    Serine was isolated by the column chromatography from the hydrolyzates of proteins of the serum, the liver and the pectoral muscle which were obtained from the roosters fed a diet containing 2- 14 C glycine for 16 - 17 days. The carbon chain of serine was cut off by treating with sodium periodate. The specific activity of each carbon (as barium carbonate) was estimated. Carboxyl carbon had little radioactivity. The specific activity of hydroxymethyl carbon was 10 - 19% of that of methylene carbon. Glycine isolated from the same hydrolyzates was degraded by ninhydrin oxidation. Formaldehyde produced from 2-C was oxidized to carbon dioxide by treating with mercuric chloride. Carboxyl carbon had little radioactivity. The specific activities of 2-C of glycine and 2-C of serine in the same tissue protein were compared. The ratio of serine 2-C/glycine 2-C was between 0.7 - 1.5. These results seem to indicate that glycine directly converts to serine in the rooster. The quantitative significance of the pathways of glycine (serine) biosynthesis is discussed. (auth.)

  13. Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2002-01-01

    President Rüütel andis Soome tuntud diplomaadile ja Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni (IKURK) esimehele Max Jakobsonile Maarjamaa Risti I klassi teenetemärgi. Tseremooniajärgne intervjuu Max Jakobsoniga

  14. [Parameter optimization of BEPS model based on the flux data of the temperate deciduous broad-leaved forest in Northeast China.

    Science.gov (United States)

    Lu, Wei; Fan, Wen Yi; Tian, Tian

    2016-05-01

    Keeping other parameters as empirical constants, different numerical combinations of the main photosynthetic parameters V c max and J max were conducted to estimate daily GPP by using the iteration method in this paper. To optimize V c max and J max in BEPSHourly model at hourly time steps, simulated daily GPP using different numerical combinations of the parameters were compared with the flux tower data obtained from the temperate deciduous broad-leaved forest of the Maoershan Forest Farm in Northeast China. Comparing the simulated daily GPP with the observed flux data in 2011, the results showed that optimal V c max and J max for the deciduous broad-leaved forest in Northeast China were 41.1 μmol·m -2 ·s -1 and 82.8 μmol·m -2 ·s -1 respectively with the minimal RMSE and the maximum R 2 of 1.10 g C·m -2 ·d -1 and 0.95. After V c max and J max optimization, BEPSHourly model simulated the seasonal variation of GPP better.

  15. Internal coordination between hydraulics and stomatal control in leaves.

    Science.gov (United States)

    Brodribb, Tim J; Jordan, Gregory J

    2008-11-01

    The stomatal response to changing leaf-atmospheric vapour pressure gradient (D(l)) is a crucial yet enigmatic process that defines the daily course of leaf gas exchange. Changes in the hydration of epidermal cells are thought to drive this response, mediated by the transpiration rate and hydraulic conductance of the leaf. Here, we examine whether species-specific variation in the sensitivity of leaves to perturbation of D(l) is related to the efficiency of water transport in the leaf (leaf hydraulic conductivity, K(leaf)). We found good correlation between maximum liquid (K(leaf)) and gas phase conductances (g(max)) in leaves, but there was no direct correlation between normalized D(l) sensitivity and K(leaf). The impact of K(leaf) on D(l) sensitivity in our diverse sample of eight species was important only after accounting for the strong relationship between K(leaf) and g(max). Thus, the ratio of g(max)/K(leaf) was strongly correlated with stomatal sensitivity to D(l). This ratio is an index of the degree of hydraulic buffering of the stomata against changes in D(l), and species with high g(max) relative to K(leaf) were the most sensitive to D(l) perturbation. Despite the potentially high adaptive significance of this phenomenon, we found no significant phylogenetic or ecological trend in our species.

  16. Remembering Max Boisot

    DEFF Research Database (Denmark)

    Sanchez, Ron

    2013-01-01

    This chapter offers some reflections on Max Boisot and his extraordinary intellect drawn from our 15 years of exchanging and crafting ideas together. I first comment on the process of working with Max, and then suggest some of the remarkable qualities of thought that I believe distinguished Max's...... these qualities of thought are also reflected in Max's individual work and especially in his crowning achievement, the Information-Space Model....

  17. Heat waves imposed during early pod development in soybean (Glycine max) cause significant yield loss despite a rapid recovery from oxidative stress.

    Science.gov (United States)

    Siebers, Matthew H; Yendrek, Craig R; Drag, David; Locke, Anna M; Rios Acosta, Lorena; Leakey, Andrew D B; Ainsworth, Elizabeth A; Bernacchi, Carl J; Ort, Donald R

    2015-08-01

    Heat waves already have a large impact on crops and are predicted to become more intense and more frequent in the future. In this study, heat waves were imposed on soybean using infrared heating technology in a fully open-air field experiment. Five separate heat waves were applied to field-grown soybean (Glycine max) in central Illinois, three in 2010 and two in 2011. Thirty years of historical weather data from Illinois were analyzed to determine the length and intensity of a regionally realistic heat wave resulting in experimental heat wave treatments during which day and night canopy temperatures were elevated 6 °C above ambient for 3 days. Heat waves were applied during early or late reproductive stages to determine whether and when heat waves had an impact on carbon metabolism and seed yield. By the third day of each heat wave, net photosynthesis (A), specific leaf weight (SLW), and leaf total nonstructural carbohydrate concentration (TNC) were decreased, while leaf oxidative stress was increased. However, A, SLW, TNC, and measures of oxidative stress were no different than the control ca. 12 h after the heat waves ended, indicating rapid physiological recovery from the high-temperature stress. That end of season seed yield was reduced (~10%) only when heat waves were applied during early pod developmental stages indicates the yield loss had more to do with direct impacts of the heat waves on reproductive process than on photosynthesis. Soybean was unable to mitigate yield loss after heat waves given during late reproductive stages. This study shows that short high-temperature stress events that reduce photosynthesis and increase oxidative stress resulted in significant losses to soybean production in the Midwest, U.S. The study also suggests that to mitigate heat wave-induced yield loss, soybean needs improved reproductive and photosynthetic tolerance to high but increasingly common temperatures. Published 2015. This article is a U.S. Government work and is

  18. AuroraMAX!

    Science.gov (United States)

    Donovan, E.; Spanswick, E. L.; Chicoine, R.; Pugsley, J.; Langlois, P.

    2011-12-01

    AuroraMAX is a public outreach and education initiative that brings auroral images to the public in real time. AuroraMAX utilizes an observing station located just outside Yellowknife, Canada. The station houses a digital All-Sky Imager (ASI) that collects full-colour images of the night sky every six seconds. These images are then transmitted via satellite internet to our web server, where they are made instantly available to the public. Over the last two years this program has rapidly become one of the most successful outreach programs in the history of Space Science in Canada, with hundreds of thousands of distinct visitors to the CSA AuroraMAX website, thousands of followers on social media, and hundreds of newspaper, magazine, radio, and television spots. Over the next few years, the project will expand to include a high-resolution SLR delivering real-time auroral images (also from Yellowknife), as well as a program where astronauts on the ISS will take pictures of the aurora with a handheld SLR. The objectives of AuroraMAX are public outreach and education. The ASI design, operation, and software were based on infrastructure that was developed for the highly successful ASI component of the NASA THEMIS mission as well as the Canadian Space Agency (CSA) Canadian GeoSpace Monitoring (CGSM) program. So from an education and public outreach perspective, AuroraMAX is a single camera operating in the Canadian north. On the other hand, AuroraMAX is one of nearly 40 All-Sky Imagers that are operating across North America. The AuroraMAX camera produces data that is seamlessly integrated with the CGSM ASI data, and made widely available to the Space Science community through open-access web and FTP sites. One of our objectives in the next few years is to incorporate some of the data from the THEMIS and CGSM imagers into the AuroraMAX system, to maximize viewing opportunities and generate more real-time data for public outreach. This is an exemplar of a program that

  19. Molecular cloning and characterization of a novel salt-inducible gene encoding an acidic isoform of PR-5 protein in soybean (Glycine max [L.] Merr.).

    Science.gov (United States)

    Onishi, M; Tachi, H; Kojima, T; Shiraiwa, M; Takahara, H

    2006-10-01

    We identified a novel salt-inducible soybean gene encoding an acidic-isoform of pathogenesis-related protein group 5 (PR-5 protein). The soybean PR-5-homologous gene, designated as Glycine max osmotin-like protein, acidic isoform (GmOLPa)), encodes a putative polypeptide having an N-terminal signal peptide. The mature GmOLPa protein without the signal peptide has a calculated molecular mass of 21.5 kDa and a pI value of 4.4, and was distinguishable from a known PR-5-homologous gene of soybean (namely P21 protein) through examination of the structural features. A comparison with two intracellular salt-inducible PR-5 proteins, tobacco osmotin and tomato NP24, revealed that GmOLPa did not have a C-terminal extension sequence functioning as a vacuole-targeting motif. The GmOLPa gene was transcribed constitutively in the soybean root and was induced almost exclusively in the root during 24 h of high-salt stress (300 mM NaCl). Interestingly, GmOLPa gene expression in the stem and leaf, not observed until 24 h, was markedly induced at 48 and 72 h after commencement of the high-salt stress. Abscisic acid (ABA) and dehydration also induced expression of the GmOLPa gene in the root; additionally, dehydration slightly induced expression in the stem and leaf. In fact, the 5'-upstream sequence of the GmOLPa gene contained several putative cis-elements known to be involved in responsiveness to ABA and dehydration, e.g. ABA-responsive element (ABRE), MYB/MYC, and low temperature-responsive element (LTRE). These results suggested that GmOLPa may function as a protective PR-5 protein in the extracellular space of the soybean root in response to high-salt stress and dehydration.

  20. Do glycine-extended hormone precursors have clinical significance?

    DEFF Research Database (Denmark)

    Rehfeld, Jens Frederik

    2014-01-01

    Half of the known peptide hormones are C-terminally amidated. Subsequent biogenesis studies have shown that the immediate precursor is a glycine-extended peptide. The clinical interest in glycine-extended hormones began in 1994, when it was suggested that glycine-extended gastrin stimulated cancer...... and clinical effects of glycine-extended precursors for most other amidated hormones than gastrin and cholecystokinin (CCK). The idea of glycine-extended peptides as independent messengers was interesting. But clinical science has to move ahead from ideas that cannot be supported at key points after decades...

  1. RNA-seq data comparisons of wild soybean genotypes in response to soybean cyst nematode (Heterodera glycines

    Directory of Open Access Journals (Sweden)

    Hengyou Zhang

    2017-12-01

    Full Text Available Soybean [Glycine max (L. Merr.] is an important crop rich in vegetable protein and oil, and is a staple food for human and animals worldwide. However, soybean plants have been challenged by soybean cyst nematode (SCN, Heterodera glycines, one of the most damaging pests found in soybean fields. Applying SCN-resistant cultivars is the most efficient and environmentally friendly strategy to manage SCN. Currently, soybean breeding and further improvement in soybean agriculture are hindered by severely limited genetic diversity in cultivated soybeans. G. soja is a soybean wild progenitor with much higher levels of genetic diversity compared to cultivated soybeans. In this study, transcriptomes of the resistant and susceptible genotypes of the wild soybean, Glycine soja Sieb & Zucc, were sequenced to examine the genetic basis of SCN resistance. Seedling roots were treated with infective second-stage juveniles (J2s of the soybean cyst nematode (HG type 2.5.7 for 3, 5, 8 days and pooled for library construction and RNA sequencing. The transcriptome sequencing generated approximately 245 million (M high quality (Q > 30 raw sequence reads (125 bp in length for twelve libraries. The raw sequence reads were deposited in NCBI sequence read archive (SRA database, with the accession numbers SRR5227314-25. Further analysis of this data would be helpful to improve our understanding of the molecular mechanisms of soybean-SCN interaction and facilitate the development of diverse SCN resistance cultivars.

  2. Glycolic acid synthesis during dark glucose U14C metabolism, in French Bean and Maize leaves

    International Nuclear Information System (INIS)

    Cailliau-Commanay, Lucienne; Calmes, Jean; Latche, J.-C.; Cavalie, Gerard

    1977-01-01

    Serine, glycerate and glycolate are among the first radioactive compounds when French Bean and Maize leaves are fed with glucose U 14 C. Failing to detect radioactive glycine suggests that glycolate so synthesized is unavailable for the photorespiration glycolate pool [fr

  3. 21 CFR 520.550 - Dextrose/glycine/electrolyte.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Dextrose/glycine/electrolyte. 520.550 Section 520...) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.550 Dextrose/glycine..., potassium citrate 0.12 gram, aminoacetic acid (glycine) 6.36 grams, and dextrose 44.0 grams. (b) Sponsor...

  4. Functional reconstitution of the glycine receptor

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Calvo, M.; Ruiz-Gomez, A.; Vazquez, J.; Morato, E.; Valdivieso, F.; Mayor, F. Jr. (Universidad Autonoma de Madrid (Spain))

    1989-07-25

    The functional reconstitution of the chloride channel coupled glycine receptor is described. Glycine receptors were purified from the cholate extract of rat spinal cord membranes by affinity chromatography and incorporated into phospholipid vesicles by the addition of phosphatidylcholine and removal of detergent by gel filtration. The reconstituted vesicles showed the same polypeptide composition as the purified receptor. The pharmacological characteristics of the glycine receptor were also preserved in the proteoliposomes, as demonstrated by the displacement of ({sup 3}H)strychnine binding by several glycinergic ligands and by photoaffinity labeling experiments. In order to observe functional responses (i.e., specific agonist-induced anion translocation), the authors have developed an assay based on the fluorescence quenching of an anion-sensitive entrapped probe, SPQ (6-methoxy-N-(3-sulfopropyl)quinolinium). Reconstituted vesicles were loaded with the fluorescent probe during a freeze-thaw-sonication cycle in the presence of added liposomes containing cholesterol. In such a reconstituted system, glycine receptor agonists are able to increase the rate of anion influx into the vesicles. The action of agonists is blocked by the simultaneous presence of strychnine or other glycine antagonists. The results show that the purified 48,000- and 58,000-dalton polypeptides reconstituted into phospholipid vesicles can bind ligands and promote specific ion translocation in a way similar to the glycine receptor in its native environment.

  5. Glycine

    DEFF Research Database (Denmark)

    Sabin, John R.; Oddershede, Jens; Sauer, Stephan P. A.

    2013-01-01

    With the advent of the use of precise ion accelerators for medical purposes, it becomes ever more important to understand the interaction of biomolecules with fast ions.  Glycine is both a protein component and a model biomolecule, and is thus an important test system.    In this report, we discu...

  6. Characterization and molecular modeling of Inositol 1,3,4 tris phosphate 5/6 kinase-2 from Glycine max (L) Merr.: comprehending its evolutionary conservancy at functional level.

    Science.gov (United States)

    Marathe, Ashish; Krishnan, Veda; Mahajan, Mahesh M; Thimmegowda, Vinutha; Dahuja, Anil; Jolly, Monica; Praveen, Shelly; Sachdev, Archana

    2018-01-01

    Soybean genome encodes a family of four inositol 1,3,4 trisphosphate 5/6 kinases which belong to the ATP-GRASP group of proteins. Inositol 1,3,4 trisphosphate kinase-2 ( GmItpk2 ), catalyzing the ATP-dependent phosphorylation of Inositol 1,3,4 trisphosphate (IP3) to Inositol 1,3,4,5 tetra phosphate or Inositol 1,3,4,6 tetra phosphate, is a key enzyme diverting the flux of inositol phosphate pool towards phytate biosynthesis. Although considerable research on characterizing genes involved in phytate biosynthesis is accomplished at genomic and transcript level, characterization of the proteins is yet to be explored. In the present study, we report the isolation and expression of single copy Itpk 2 (948 bp) from Glycine max cv Pusa-16 predicted to encode 315 amino acid protein with an isoelectric point of 5.9. Sequence analysis revealed that Gm ITPK2 shared highest similarity (80%) with Phaseolus vulgaris. The predicted 3D model confirmed 12 α helices and 14 β barrel sheets with ATP-binding site close to β sheet present towards the C-terminus of the protein molecule. Spatio-temporal transcript profiling signified GmItpk2 to be seed specific, with higher transcript levels in the early stage of seed development. The present study using various molecular and bio-computational tools could, therefore, help in improving our understanding of this key enzyme and prove to be a potential target towards generating low phytate trait in nutritionally rich crop like soybean.

  7. Habitat affinity of resident natural enemies of the invasive Aphis glycines (Hemiptera: Aphididae), on soybean, with comments on biological control.

    Science.gov (United States)

    Brewer, Michael J; Noma, Takuji

    2010-06-01

    We integrated a natural enemy survey of the broader landscape into a more traditional survey for Aphis glycines Matsumura (Hemiptera: Aphididae), parasitoids and predatory flies on soybean using A. glycines-infested soybean, Glycine max (L.) Merr., placed in cropped and noncropped plant systems to complement visual field observations. Across three sites and 5 yr, 18 parasitoids and predatory flies in total (Hymenoptera: Aphelinidae [two species] and Bracondae [seven species], Diptera: Cecidomyiidae [one species], Syrphidae [seven species], Chamaemyiidae [one species]) were detected, with significant variability in recoveries detected across plant system treatments and strong contrasts in habitat affinity detected among species. Lysiphlebus testaceipes Cresson was the most frequently detected parasitoid, and no differences in abundance were detected in cropped (soybean, wheat [Triticum aestivum L.], corn [Zea mays L.], and alfalfa [Medicago sativa L.]) and noncropped (poplar [Populus euramericana (Dode) Guinier] and early successional vegetation) areas. In contrast, Binodoxys kelloggensis Pike, Starý & Brewer had strong habitat affinity for poplar and early successional vegetation. The low recoveries seasonally and across habitats of Aphelinus asychis Walker, Aphelinus sp., and Aphidius colemoni Viereck make their suitability to A. glycines on soybean highly suspect. The widespread occurrence of many of the flies reflects their broad habitat affinity and host aphid ranges. The consistent low field observations of parasitism and predation suggest that resident parasitoids and predatory flies are unlikely to contribute substantially to A. glycines suppression, at least during the conventional time period early in the pest invasion when classical biological control activities are considered. For selected species that were relatively well represented across plant systems (i.e., L. testaceipes and Aphidoletes aphidimyza Rondani), conservation biological control efforts

  8. Glycine phases formed from frozen aqueous solutions: Revisited

    Energy Technology Data Exchange (ETDEWEB)

    Surovtsev, N. V. [Institute of Automation and Electrometry, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation); Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Adichtchev, S. V.; Malinovsky, V. K. [Institute of Automation and Electrometry, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation); Ogienko, A. G.; Manakov, A. Yu. [Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Nikolaev Institute of Inorganic Chemistry, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation); Drebushchak, V. A. [Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Institute of Geology and Mineralogy, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation); Ancharov, A. I.; Boldyreva, E. V. [Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Institute of Solid Chemistry and Mechanochemistry, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation); Yunoshev, A. S. [Novosibirsk State University, Novosibirsk 630090 (Russian Federation); Lavrentiev Institute of Hydrodynamics, Siberian Branch of Russian Academy of Sciences, Novosibirsk 630090 (Russian Federation)

    2012-08-14

    Glycine phases formed when aqueous solutions were frozen and subsequently heated under different conditions were studied by Raman scattering, x-ray diffraction, and differential scanning calorimetry (DSC) techniques. Crystallization of ice I{sub h} was observed in all the cases. On cooling at the rates of 0.5 K/min and 5 K/min, glassy glycine was formed as an intermediate phase which lived about 1 min or less only, and then transformed into {beta}-polymorph of glycine. Quench cooling of glycine solutions (15% w/w) in liquid nitrogen resulted in the formation of a mixture of crystalline water ice I{sub h} and a glassy glycine, which could be preserved at cryogenic temperatures (80 K) for an indefinitely long time. This mixture remained also quite stable for some time after heating above the cryogenic temperature. Subsequent heating under various conditions resulted in the transformation of the glycine glass into an unknown crystalline phase (glycine 'X-phase') at 209-216 K, which at 218-226 K transformed into {beta}-polymorph of glycine. The 'X-phase' was characterized by Raman spectroscopy; it could be obtained in noticeable amounts using a special preparation technique and tentatively characterized by x-ray powder diffraction (P2, a= 6.648 A, b= 25.867 A, c= 5.610 A, {beta}= 113.12 Masculine-Ordinal-Indicator ); the formation of 'X-phase' from the glycine glassy phase and its transformation into {beta}-polymorph were followed by DSC. Raman scattering technique with its power for unambiguous identification of the crystalline and glassy polymorphs without limitation on the crystallite size helped us to follow the phase transformations during quenching, heating, and annealing. The experimental findings are considered in relation to the problem of control of glycine polymorphism on crystallization.

  9. Glycine phases formed from frozen aqueous solutions: Revisited

    Science.gov (United States)

    Surovtsev, N. V.; Adichtchev, S. V.; Malinovsky, V. K.; Ogienko, A. G.; Drebushchak, V. A.; Manakov, A. Yu.; Ancharov, A. I.; Yunoshev, A. S.; Boldyreva, E. V.

    2012-08-01

    Glycine phases formed when aqueous solutions were frozen and subsequently heated under different conditions were studied by Raman scattering, x-ray diffraction, and differential scanning calorimetry (DSC) techniques. Crystallization of ice Ih was observed in all the cases. On cooling at the rates of 0.5 K/min and 5 K/min, glassy glycine was formed as an intermediate phase which lived about 1 min or less only, and then transformed into β-polymorph of glycine. Quench cooling of glycine solutions (15% w/w) in liquid nitrogen resulted in the formation of a mixture of crystalline water ice Ih and a glassy glycine, which could be preserved at cryogenic temperatures (80 K) for an indefinitely long time. This mixture remained also quite stable for some time after heating above the cryogenic temperature. Subsequent heating under various conditions resulted in the transformation of the glycine glass into an unknown crystalline phase (glycine "X-phase") at 209-216 K, which at 218-226 K transformed into β-polymorph of glycine. The "X-phase" was characterized by Raman spectroscopy; it could be obtained in noticeable amounts using a special preparation technique and tentatively characterized by x-ray powder diffraction (P2, a = 6.648 Å, b = 25.867 Å, c = 5.610 Å, β = 113.12°); the formation of "X-phase" from the glycine glassy phase and its transformation into β-polymorph were followed by DSC. Raman scattering technique with its power for unambiguous identification of the crystalline and glassy polymorphs without limitation on the crystallite size helped us to follow the phase transformations during quenching, heating, and annealing. The experimental findings are considered in relation to the problem of control of glycine polymorphism on crystallization.

  10. Re-annotation of the physical map of Glycine max for polyploid-like regions by BAC end sequence driven whole genome shotgun read assembly

    Directory of Open Access Journals (Sweden)

    Shultz Jeffry

    2008-07-01

    Full Text Available Abstract Background Many of the world's most important food crops have either polyploid genomes or homeologous regions derived from segmental shuffling following polyploid formation. The soybean (Glycine max genome has been shown to be composed of approximately four thousand short interspersed homeologous regions with 1, 2 or 4 copies per haploid genome by RFLP analysis, microsatellite anchors to BACs and by contigs formed from BAC fingerprints. Despite these similar regions,, the genome has been sequenced by whole genome shotgun sequence (WGS. Here the aim was to use BAC end sequences (BES derived from three minimum tile paths (MTP to examine the extent and homogeneity of polyploid-like regions within contigs and the extent of correlation between the polyploid-like regions inferred from fingerprinting and the polyploid-like sequences inferred from WGS matches. Results Results show that when sequence divergence was 1–10%, the copy number of homeologous regions could be identified from sequence variation in WGS reads overlapping BES. Homeolog sequence variants (HSVs were single nucleotide polymorphisms (SNPs; 89% and single nucleotide indels (SNIs 10%. Larger indels were rare but present (1%. Simulations that had predicted fingerprints of homeologous regions could be separated when divergence exceeded 2% were shown to be false. We show that a 5–10% sequence divergence is necessary to separate homeologs by fingerprinting. BES compared to WGS traces showed polyploid-like regions with less than 1% sequence divergence exist at 2.3% of the locations assayed. Conclusion The use of HSVs like SNPs and SNIs to characterize BACs wil improve contig building methods. The implications for bioinformatic and functional annotation of polyploid and paleopolyploid genomes show that a combined approach of BAC fingerprint based physical maps, WGS sequence and HSV-based partitioning of BAC clones from homeologous regions to separate contigs will allow reliable de

  11. System-level insights into the cellular interactome of a non-model organism: inferring, modelling and analysing functional gene network of soybean (Glycine max.

    Directory of Open Access Journals (Sweden)

    Yungang Xu

    Full Text Available Cellular interactome, in which genes and/or their products interact on several levels, forming transcriptional regulatory-, protein interaction-, metabolic-, signal transduction networks, etc., has attracted decades of research focuses. However, such a specific type of network alone can hardly explain the various interactive activities among genes. These networks characterize different interaction relationships, implying their unique intrinsic properties and defects, and covering different slices of biological information. Functional gene network (FGN, a consolidated interaction network that models fuzzy and more generalized notion of gene-gene relations, have been proposed to combine heterogeneous networks with the goal of identifying functional modules supported by multiple interaction types. There are yet no successful precedents of FGNs on sparsely studied non-model organisms, such as soybean (Glycine max, due to the absence of sufficient heterogeneous interaction data. We present an alternative solution for inferring the FGNs of soybean (SoyFGNs, in a pioneering study on the soybean interactome, which is also applicable to other organisms. SoyFGNs exhibit the typical characteristics of biological networks: scale-free, small-world architecture and modularization. Verified by co-expression and KEGG pathways, SoyFGNs are more extensive and accurate than an orthology network derived from Arabidopsis. As a case study, network-guided disease-resistance gene discovery indicates that SoyFGNs can provide system-level studies on gene functions and interactions. This work suggests that inferring and modelling the interactome of a non-model plant are feasible. It will speed up the discovery and definition of the functions and interactions of other genes that control important functions, such as nitrogen fixation and protein or lipid synthesis. The efforts of the study are the basis of our further comprehensive studies on the soybean functional

  12. Multifarious Beneficial Effect of Nonessential Amino Acid, Glycine: A Review

    Directory of Open Access Journals (Sweden)

    Meerza Abdul Razak

    2017-01-01

    Full Text Available Glycine is most important and simple, nonessential amino acid in humans, animals, and many mammals. Generally, glycine is synthesized from choline, serine, hydroxyproline, and threonine through interorgan metabolism in which kidneys and liver are the primarily involved. Generally in common feeding conditions, glycine is not sufficiently synthesized in humans, animals, and birds. Glycine acts as precursor for several key metabolites of low molecular weight such as creatine, glutathione, haem, purines, and porphyrins. Glycine is very effective in improving the health and supports the growth and well-being of humans and animals. There are overwhelming reports supporting the role of supplementary glycine in prevention of many diseases and disorders including cancer. Dietary supplementation of proper dose of glycine is effectual in treating metabolic disorders in patients with cardiovascular diseases, several inflammatory diseases, obesity, cancers, and diabetes. Glycine also has the property to enhance the quality of sleep and neurological functions. In this review we will focus on the metabolism of glycine in humans and animals and the recent findings and advances about the beneficial effects and protection of glycine in different disease states.

  13. Syn-Selective Synthesis of β-Branched α-Amino Acids by Alkylation of Glycine-Derived Imines with Secondary Sulfonates.

    Science.gov (United States)

    Lou, Sha; McKenna, Grace M; Tymonko, Steven A; Ramirez, Antonio; Benkovics, Tamas; Conlon, David A; González-Bobes, Francisco

    2015-10-16

    A syn-selective synthesis of β-branched α-amino acids has been developed based on the alkylation of glycine imine esters with secondary sulfonates. The potassium counterion for the enolate, the solvent, and the leaving group on the electrophile were key levers to maximize the diasteroselectivity of the alkylation. The optimized conditions enabled a straightforward preparation of a number of β-branched α-amino acids that can be challenging to obtain.

  14. Characterization of the recombinant copper chaperone (CCS) from the plant Glycine (G.) max.

    Science.gov (United States)

    Sagasti, Sara; Yruela, Inmaculada; Bernal, Maria; Lujan, Maria A; Frago, Susana; Medina, Milagros; Picorel, Rafael

    2011-02-01

    The goal of the present work was to characterize the recombinant copper chaperone (CCS) from soybean. Very little is known about plant copper chaperones, which makes this study of current interest, and allows for a comparison with the better known homologues from yeast and humans. To obtain sizeable amounts of pure protein suitable for spectroscopic characterization, we cloned and overexpressed the G. max CCS chaperone in E. coli in the presence of 0.5 mM CuSO(4) and 0.5 mM ZnSO(4) in the broth. A pure protein preparation was obtained by using two IMAC steps and pH gradient chromatography. Most of the proteins were obtained as apo-form, devoid of copper atoms. The chaperone showed a high content (i.e., over 40%) of loops, turns and random coil as determined both by circular dichroism and homology modelling. The homology 3-D structural model suggests the protein might fold in three structural protein domains. The 3-D model along with the primary structure and spectroscopic data may suggest that copper atoms occupy the two metal binding sites, MKCEGC and CTC, within the N-terminal domain I and C-terminal domain III, respectively. But only one Zn-binding site was obtained spectroscopically.

  15. PENGEMBANGAN PERSAMAAN VO2 MAX DAN EVALUASI HR MAX (STUDI AWAL PADA PEKERJA PRIA

    Directory of Open Access Journals (Sweden)

    Purnawan Adi Wicaksono

    2012-10-01

    Full Text Available Kapasitas fisik maksimum seseorang direpresentasikan dengan nilai konsumsi oksigen maksimum (VO2 Max dan denyut nadi maksimum (HR Max yang memberikan suatu informasi batasan kemampuan fisik maksimum seseorang dalam melakukan pekerjaan. Penelitian kali ini mempunyai tujuan untuk mencari nilai VO2 Max pekerja pria Indonesia untuk nantinya akan dikembangkan suatu persamaan prediksi VO2 Max yang didekati dengan hubungan linier antara denyut nadi (Heart Rate seperti yang dilakukan Astrand (2003, tinggi badan (Chatterjee et al, 2006, berat badan (Akalan et al, 2008, usia (Magrani et al, 2009 dan mengevaluasi persamaan HR Max manakah yang dapat diaplikasikan untuk mendekati nilai denyut nadi maksimum pekerja Indonesia. Responden dalam penelitian kali ini adalah 12  pekerja industri pria yang diambil dari beberapa industri di Depok dan sekitarnya. Kriteria responden yang berpartisipasi dalam penelitian kali ini adalah: berusia 20-40 tahun, bukan perokok baik aktif maupun pasif, sehat , tidak mengkonsumsi makanan, kafein, alkohol minimal 2 jam sebelum eksperimen (Balderrama et. al, 2007.Eksperimen yang dilakukan menggunakan metode maximal test dengan protokol treadmill. Adapun peralatan yang digunakan adalah seperangkat alat pengukur kondisi fisiologi Fitmate MED (COSMED srl-Italy terdiri dari Heart Rate Transmitter, Heart Rate Receiver, V mask (Hans Rudolph Inc,dan treadmill SportArt@60.  Eksperimen dilakukan menjadi dua bagian, yaitu istirahat dan tahap bekerja.Aktivitas istirahat terdiri dari tidur selama 20 menit, duduk selama 20 menit dan berdiri selama 10 menit. Eksperimen tahap kedua yaitu tahap kerja yang terdiri dari latihan selama 5 menit. Responden dipersilakan beristirahat selama 15 menit, setelah itu responden melaksanakan maximal test detik hingga responden merasa tidak sanggup lagi melanjutkan eksperimen. Hasil penelitian model prediksi VO2 max untuk pekerja industri pria mempunyai nilai 2,78 ± 0,5 liter/menit dan dengan regresi linier

  16. Microbial rhodopsins on leaf surfaces of terrestrial plants

    OpenAIRE

    Atamna-Ismaeel, Nof; Finkel, Omri M.; Glaser, Fabian; Sharon, Itai; Schneider, Ron; Post, Anton F.; Spudich, John L.; von Mering, Christian; Vorholt, Julia A.; Iluz, David; Béjà, Oded; Belkin, Shimshon

    2011-01-01

    The above-ground surfaces of terrestrial plants, the phyllosphere, comprise the main interface between the terrestrial biosphere and solar radiation. It is estimated to host up to 1026 microbial cells that may intercept part of the photon flux impinging on the leaves. Based on 454-pyrosequencing-generated metagenome data, we report on the existence of diverse microbial rhodopsins in five distinct phyllospheres from tamarisk (Tamarix nilotica), soybean (Glycine max), Arabidopsis (Arabidopsis t...

  17. 78 FR 9317 - Glycine max

    Science.gov (United States)

    2013-02-08

    ... overall sequence similarity or identity at the level of eight contiguous amino acid residues, the level of... inhibitors of amino acid biosynthesis and herbicide-tolerant crops. Amino Acids 30: 195-204. 13. Locke, M...

  18. Sensitization of glycine (spectrophotometric read-out) dosimetric system using sorbitol

    International Nuclear Information System (INIS)

    Shinde, S.H.; Mukherjee, T.

    2009-01-01

    Glycine spectrophotometric read-out systems have a useful dose range of 15-4000 Gy. An attempt was made to sensitize it using sorbitol as a sensitizer. Optimum compositions of aqueous acidic solutions of ferrous ammonium sulphate-xylenol orange (XO), i.e. FX and sorbitol-ferrous ammonium sulphate-xylenol orange, i.e. SFX, for 400 mg of glycine, which gives maximum dosimetric response for any given dose, were established. Molar absorption coefficient values of ferric-XO-glycine complex, i.e. ε-values, were determined for glycine system in FX and SFX. These values were found to be 8410 and 15,000 m 2 mol -1 respectively, indicating that an enhancement or sensitivity factor of about 1.78 can be achieved by sorbitol for glycine in SFX. This factor was further confirmed by measuring the gamma dose response of glycine in FX and in SFX for four different doses, viz. 37.8, 75.5, 151 and 302 Gy. It was observed that dose response of glycine in SFX is about 77% more than that of glycine in FX. The maximum variation observed in response of glycine in FX or SFX was found to be within ±1.5%.

  19. Magnetic molecularly imprinted polymers based on silica modified by deep eutectic solvents for the rapid simultaneous magnetic-based solid-phase extraction of Salvia miltiorrhiza bunge, Glycine max (Linn.) Merr and green tea.

    Science.gov (United States)

    Li, Guizhen; Wang, Xiaoqin; Row, Kyung Ho

    2018-04-01

    Novel magnetic molecularly imprinted polymers (MMIPs) with multiple-template based on silica were modified by four types of deep eutectic solvents (DESs) for the rapid simultaneous magnetic solid-phase extraction (MSPE) of tanshinone Ⅰ, tanshinone ⅡA, and cryptotanshinone from Salvia miltiorrhiza bunge; glycitein, genistein, and daidzein from Glycine max (Linn.) Merr; and epicatechin, epigallocatechin gallate, and epicatechin gallate from green tea, respectively. The synthesized materials were characterized by Fourier transform infrared spectroscopy and field emission scanning electron microscopy. Single factor experiments were to explore the relationship between the extraction efficiency and four factors (the sample solution pH, amount of DESs for modification, amount of adsorbent, and extraction time). It was showed that the DES4-MMIPs have better extraction ability than the MMIPs without DESs and the other three DESs-modified MMIPs. The best extraction recoveries with DES4-MMIP were tanshinone Ⅰ (85.57%), tanshinone ⅡA (80.58%), cryptotanshinone (92.12%), glycitein (81.65%), genistein (87.72%), daidzein (92.24%), epicatechin (86.43%), epigallocatechin gallate (80.92%), and epicatechin gallate (93.64%), respectively. The novel multiple-template MMIPs materials modified by DES for the rapid simultaneous MSPE of active compounds were proved to reduce the experimental steps than single-template technique, and increase the extraction efficiency. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Identification of wild soybean (Glycine soja) TIFY family genes and their expression profiling analysis under bicarbonate stress.

    Science.gov (United States)

    Zhu, Dan; Bai, Xi; Luo, Xiao; Chen, Qin; Cai, Hua; Ji, Wei; Zhu, Yanming

    2013-02-01

    Wild soybean (Glycine soja L. G07256) exhibits a greater adaptability to soil bicarbonate stress than cultivated soybean, and recent discoveries show that TIFY family genes are involved in the response to several abiotic stresses. A genomic and transcriptomic analysis of all TIFY genes in G. soja, compared with G. max, will provide insight into the function of this gene family in plant bicarbonate stress response. This article identified and characterized 34 TIFY genes in G. soja. Sequence analyses indicated that most GsTIFY proteins had two conserved domains: TIFY and Jas. Phylogenetic analyses suggested that these GsTIFY genes could be classified into two groups. A clustering analysis of all GsTIFY transcript expression profiles from bicarbonate stress treated G. soja showed that there were five different transcript patterns in leaves and six different transcript patterns in roots when the GsTIFY family responds to bicarbonate stress. Moreover, the expression level changes of all TIFY genes in cultivated soybean, treated with bicarbonate stress, were also verified. The expression comparison analysis of TIFYs between wild and cultivated soybeans confirmed that, different from the cultivated soybean, GsTIFY (10a, 10b, 10c, 10d, 10e, 10f, 11a, and 11b) were dramatically up-regulated at the early stage of stress, while GsTIFY 1c and 2b were significantly up-regulated at the later period of stress. The frequently stress responsive and diverse expression profiles of the GsTIFY gene family suggests that this family may play important roles in plant environmental stress responses and adaptation.

  1. Differential gene expression and mitotic cell analysis of the drought tolerant soybean (Glycine max L. Merrill Fabales, Fabaceae cultivar MG/BR46 (Conquista under two water deficit induction systems

    Directory of Open Access Journals (Sweden)

    Polyana K. Martins

    2008-01-01

    Full Text Available Drought cause serious yield losses in soybean (Glycine max, roots being the first plant organ to detect the water-stress signals triggering defense mechanisms. We used two drought induction systems to identify genes differentially expressed in the roots of the drought-tolerant soybean cultivar MG/BR46 (Conquista and characterize their expression levels during water deficit. Soybean plants grown in nutrient solution hydroponically and in sand-pots were submitted to water stress and gene expression analysis was conducted using the differential display (DD and real time polymerase chain reaction (PCR techniques. Three differentially expressed mRNA transcripts showed homology to the Antirrhinum majus basic helix-loop-helix transcription factor bHLH, the Arabidopsis thaliana phosphatidylinositol transfer protein PITP and the auxin-independent growth regulator 1 (axi 1. The hydroponic experiments showed that after 100 min outside the nutrient solution photosynthesis completely stopped, stomata closed and leaf temperature rose. Both stress induction treatments produced significant decrease in the mitotic indices of root cells. Axi 1, PITP and bHLH were not only differentially expressed during dehydration in the hydroponics experiments but also during induced drought in the pot experiments. Although, there were differences between the two sets of experiments in the time at which up or down regulation occurred, the expression pattern of all three transcripts was related. Similar gene expression and cytological analysis results occurred in both systems, suggesting that hydroponics could be used to simulate drought detection by roots growing in soil and thus facilitate rapid and easy root sampling.

  2. Oxygen-18 as a tool for studying photorespiration. Oxygen uptake and incorporation into glycolate, glycine and serine

    International Nuclear Information System (INIS)

    Gerster, R.; Dimon, B.; Tournier, P.; Peybernes, A.

    1977-01-01

    The intensity of photosynthesis and photorespiration has been determined by measuring 16 O 2 evolvement and 18 O 2 uptake on algae and leaves. In the case of algae, there is still an important oxygen uptake even when ribulose diphosphate oxygenase is inhibited by 10 -3 M cyanide. Oxygen-18 incorporation into glycolate, glycine and serine of photorespiring algae and leaves exposed to atmospheres containing 18 O 2 has also been measured. Only one of the two atoms present in molecular oxygen was incorporated into the carboxyl group of the glycolate excreted from algae; the rate of 18 O incorporation was important (65 to 80% according to experimental conditions), even in the presence of 10 -3 M cyanide. Thus, oxidation of ribulose diphosphate is not the sole reaction leading to 18 O glycolate synthesis. In the case of maize, there was a rapid and important 18 O incorporation into the carboxyl group of glycine and serine, the kinetics of which was determined as a function of CO 2 presence in the atmosphere. These results suggest that photorespiration is also operating in C 4 species. Furthermore, in vitro experiments showed that phosphorylated ceto-acids of the Calvin cycle were very sensitive to H 2 O 2 ; the corresponding reaction can explain O 2 uptake and 18 O labelling of glycolate. (author)

  3. A role for accumbal glycine receptors in modulation of dopamine release by the glycine transporter-1 inhibitor Org25935

    Directory of Open Access Journals (Sweden)

    Helga eHöifödt Lidö

    2011-03-01

    Full Text Available AbstractAccumbal glycine modulates basal and ethanol-induced dopamine levels in the nucleus accumbens (nAc as well as voluntary ethanol consumption. Also, systemic administration of the glycine transporter-1 inhibitor Org25935 elevates dopamine levels in nAc, prevents a further ethanol-induced dopamine elevation and robustly and dose-dependently decreases ethanol consumption in rats. Here we investigated whether Org25935 applied locally in nAc modulates dopamine release, and whether accumbal glycine receptors or NMDA receptors are involved in this tentative effect. We also addressed whether Org25935 and ethanol applied locally in nAc interact with dopamine levels, as seen after systemic administration. We used in vivo microdialysis coupled to HPLC-ED in freely moving male Wistar rats to monitor dopamine output in nAc after local perfusion of Org25935 alone, with ethanol, or Org25935-perfusion after pre-treatment with the glycine receptor antagonist strychnine or the NMDA receptor glycine site antagonist L-701.324. Local Org25935 increased extracellular dopamine levels in a subpopulation of rats. Local strychnine, but not systemic L-701.324, antagonized the dopamine-activating effect of Org25935. Ethanol failed to induce a dopamine overflow in the subpopulation responding to Org25935 with a dopamine elevation. The study supports a role for accumbal glycine receptors rather than NMDA receptor signaling in the dopamine-activating effect of Org25935. The results further indicate that the previously reported systemic Org25935-ethanol interaction with regard to accumbal dopamine is localized to the nAc. This adds to the growing evidence for the glycine receptor as an important player in the dopamine reward circuitry and in ethanol’s effects within this system.

  4. Glycine and a glycine dehydrogenase (GLDC) SNP as citalopram/escitalopram response biomarkers in depression: pharmacometabolomics-informed pharmacogenomics.

    Science.gov (United States)

    Ji, Y; Hebbring, S; Zhu, H; Jenkins, G D; Biernacka, J; Snyder, K; Drews, M; Fiehn, O; Zeng, Z; Schaid, D; Mrazek, D A; Kaddurah-Daouk, R; Weinshilboum, R M

    2011-01-01

    Major depressive disorder (MDD) is a common psychiatric disease. Selective serotonin reuptake inhibitors (SSRIs) are an important class of drugs used in the treatment of MDD. However, many patients do not respond adequately to SSRI therapy. We used a pharmacometabolomics-informed pharmacogenomic research strategy to identify citalopram/escitalopram treatment outcome biomarkers. Metabolomic assay of plasma samples from 20 escitalopram remitters and 20 nonremitters showed that glycine was negatively associated with treatment outcome (P = 0.0054). This observation was pursued by genotyping tag single-nucleotide polymorphisms (SNPs) for genes encoding glycine synthesis and degradation enzymes, using 529 DNA samples from SSRI-treated MDD patients. The rs10975641 SNP in the glycine dehydrogenase (GLDC) gene was associated with treatment outcome phenotypes. Genotyping for rs10975641 was carried out in 1,245 MDD patients in the Sequenced Treatment Alternatives to Relieve Depression (STAR*D) study, and its presence was significant (P = 0.02) in DNA taken from these patients. These results highlight a possible role for glycine in SSRI response and illustrate the use of pharmacometabolomics to "inform" pharmacogenomics.

  5. Glycine transporter 1 is a target for the treatment of epilepsy

    NARCIS (Netherlands)

    Shen, Hai-Ying; van Vliet, Erwin A.; Bright, Kerry-Ann; Hanthorn, Marissa; Lytle, Nikki K.; Gorter, Jan; Aronica, Eleonora; Boison, Detlev

    2015-01-01

    Glycine is the major inhibitory neurotransmitter in brainstem and spinal cord, whereas in hippocampus glycine exerts dual modulatory roles on strychnine-sensitive glycine receptors and on the strychnine-insensitive glycineB site of the N-methyl-D-aspartate receptor (NMDAR). In hippocampus, the

  6. Glycine transporter 1 is a target for the treatment of epilepsy

    NARCIS (Netherlands)

    Shen, H-Y; van Vliet, E.A.; Bright, K-A.; Hanthorn, M.; Lytle, N.K.; Gorter, J.; Aronica, E.; Boison, D.

    2015-01-01

    Glycine is the major inhibitory neurotransmitter in brainstem and spinal cord, whereas in hippocampus glycine exerts dual modulatory roles on strychnine-sensitive glycine receptors and on the strychnine-insensitive glycineB site of the N-methyl-d-aspartate receptor (NMDAR). In hippocampus, the

  7. Analysis list: Max [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Max Blood,Muscle,Pluripotent stem cell + mm9 http://dbarchive.biosciencedbc.jp/kyus...hu-u/mm9/target/Max.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Max.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/target/Max.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Blood....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Max.Muscle.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Max.Pluripotent_stem_cell.tsv http://dbarchive.biosciencedbc.jp/k

  8. Effects of substituting roasted soybean (Glycine max seeds by those of cowpea (Vigna unguiculata, and of the protein level in the diet, on growth performance and profitability of local-breed chickens (Gallus gallus in Burkina

    Directory of Open Access Journals (Sweden)

    S. Ouattara

    2014-07-01

    Full Text Available This study aimed to evaluate the effects of substituting roasted seeds of soya (Glycine max by those of cowpea (Vigna unguiculata, and of the protein level in the diet, on growth performance and economic profitability of local-breed chickens (Gallus gallus in Burkina Faso. Three hundred 12-day-old chicks were divided into 12 batches of 25 chicks each. Four diets incorporating seeds of cowpea or soya, with different protein levels for starting and growing/finishing, were prepared. Data on various parameters (body weight, weight gain, intake and feed conversion, mortality were recorded once every two weeks from the 12th to the 138th day of age. At the 138th day, four chickens (two males and two females from each batch were slaughtered to assess the characteristics of carcasses and selected organs. The comparative profitability of the different treatments was evaluated. Results indicate that the substitution of roasted seeds of soya by those of cowpea had no devaluing effect on growth performance nor on carcass characteristics of the local chicken. In addition, the use of these seeds did not decrease profitability. Lastly, increasing the protein level in the diets significantly (p ≤ 0.05 improved weight gains and reduced the duration of the breeding period by two weeks.

  9. Diaspora, a large family of Ty3-gypsy retrotransposons in Glycine max, is an envelope-less member of an endogenous plant retrovirus lineage.

    Science.gov (United States)

    Yano, Sho T; Panbehi, Bahman; Das, Arpita; Laten, Howard M

    2005-05-05

    The chromosomes of higher plants are littered with retrotransposons that, in many cases, constitute as much as 80% of plant genomes. Long terminal repeat retrotransposons have been especially successful colonizers of the chromosomes of higher plants and examinations of their function, evolution, and dispersal are essential to understanding the evolution of eukaryotic genomes. In soybean, several families of retrotransposons have been identified, including at least two that, by virtue of the presence of an envelope-like gene, may constitute endogenous retroviruses. However, most elements are highly degenerate and are often sequestered in regions of the genome that sequencing projects initially shun. In addition, finding potentially functional copies from genomic DNA is rare. This study provides a mechanism to surmount these issues to generate a consensus sequence that can then be functionally and phylogenetically evaluated. Diaspora is a multicopy member of the Ty3-gypsy-like family of LTR retrotransposons and comprises at least 0.5% of the soybean genome. Although the Diaspora family is highly degenerate, and with the exception of this report, is not represented in the Genbank nr database, a full-length consensus sequence was generated from short overlapping sequences using a combination of experimental and in silico methods. Diaspora is 11,737 bp in length and contains a single 1892-codon ORF that encodes a gag-pol polyprotein. Phylogenetic analysis indicates that it is closely related to Athila and Calypso retroelements from Arabidopsis and soybean, respectively. These in turn form the framework of an endogenous retrovirus lineage whose members possess an envelope-like gene. Diaspora appears to lack any trace of this coding region. A combination of empirical sequencing and retrieval of unannotated Genome Survey Sequence database entries was successfully used to construct a full-length representative of the Diaspora family in Glycine max. Diaspora is presently the

  10. Evaluation of constitutive iron reductase (AtFRO2 expression on mineral accumulation and distribution in soybean (Glycine max. L

    Directory of Open Access Journals (Sweden)

    Marta Wilton Vasconcelos

    2014-04-01

    Full Text Available Iron is an important micronutrient in human and plant nutrition. Adequate iron nutrition during crop production is central for assuring appropriate iron concentrations in the harvestable organs, for human food or animal feed. The whole-plant movement of iron involves several processes, including the reduction of ferric to ferrous iron at several locations throughout the plant, prior to transmembrane trafficking of ferrous iron. In this study, soybean plants that constitutively expressed the AtFRO2 iron reductase gene were analyzed for leaf iron reductase activity, as well as the effect of this transgene's expression on root, leaf, pod wall, and seed mineral concentrations. High Fe supply, in combination with the constitutive expression of AtFRO2, resulted in significantly higher concentrations of different minerals in roots (K, P, Zn, Ca, Ni, Mg and Mo, pod walls (Fe, K, P, Cu and Ni, leaves (Fe, P, Cu, Ca, Ni and Mg and seeds (Fe, Zn, Cu and Ni. Leaf and pod wall iron concentrations increased as much as 500% in transgenic plants, while seed iron concentrations only increased by 10%, suggesting that factors other than leaf and pod wall reductase activity were limiting the translocation of iron to seeds. Protoplasts isolated from transgenic leaves had three-fold higher reductase activity than controls. Expression levels of the iron storage protein, ferritin, were higher in the transgenic leaves than in wild-type, suggesting that the excess iron may be stored as ferritin in the leaves and therefore unavailable for phloem loading and delivery to the seeds. Also, citrate and malate levels in the roots and leaves of transgenic plants were significantly higher than in wild-type, suggesting that organic acid production could be related to the increased accumulation of minerals in roots, leaves and pod walls, but not in the seeds. All together, these results suggest a more ubiquitous role for the iron reductase in whole-plant mineral accumulation and

  11. Glycine and Folate Ameliorate Models of Congenital Sideroblastic Anemia.

    Directory of Open Access Journals (Sweden)

    J Pedro Fernández-Murray

    2016-01-01

    Full Text Available Sideroblastic anemias are acquired or inherited anemias that result in a decreased ability to synthesize hemoglobin in red blood cells and result in the presence of iron deposits in the mitochondria of red blood cell precursors. A common subtype of congenital sideroblastic anemia is due to autosomal recessive mutations in the SLC25A38 gene. The current treatment for SLC25A38 congenital sideroblastic anemia is chronic blood transfusion coupled with iron chelation. The function of SLC25A38 is not known. Here we report that the SLC25A38 protein, and its yeast homolog Hem25, are mitochondrial glycine transporters required for the initiation of heme synthesis. To do so, we took advantage of the fact that mitochondrial glycine has several roles beyond the synthesis of heme, including the synthesis of folate derivatives through the glycine cleavage system. The data were consistent with Hem25 not being the sole mitochondrial glycine importer, and we identify a second SLC25 family member Ymc1, as a potential secondary mitochondrial glycine importer. Based on these findings, we observed that high levels of exogenous glycine, or 5-aminolevulinic acid (5-Ala a metabolite downstream of Hem25 in heme biosynthetic pathway, were able to restore heme levels to normal in yeast cells lacking Hem25 function. While neither glycine nor 5-Ala could ameliorate SLC25A38 congenital sideroblastic anemia in a zebrafish model, we determined that the addition of folate with glycine was able to restore hemoglobin levels. This difference is likely due to the fact that yeast can synthesize folate, whereas in zebrafish folate is an essential vitamin that must be obtained exogenously. Given the tolerability of glycine and folate in humans, this study points to a potential novel treatment for SLC25A38 congenital sideroblastic anemia.

  12. Max Algebraic Complementary Basic Matrices

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Hall, F.J.

    2014-01-01

    Roč. 457, 15 September (2014), s. 287-292 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : CB-matrix * Max algebra * Max permanent * Max eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  13. The light activated alkylation of glycine

    International Nuclear Information System (INIS)

    Knowles, H.S.

    2001-04-01

    The work contained in this thesis focuses on the light-initiated alkylation of the α-centre of glycine compounds. The elaboration of the glycines in this manner represents a versatile, clean and cost effective alternative to ionic routes to higher α-amino acids. Preliminary investigations demonstrated that a range of nitrogen protecting groups were compatible with the radical alkylation. A variety of solvents could also be used although solvents with easily removable hydrogen atoms were found to interfere with the alkylation. Furthermore, a number of photo-initiators were investigated and the use of di-tert-butyl peroxide was found to afford the desired phenylalanine products in up to 27% yield (54% based on recovered starting material) when toluene was used as the alkylating agent. A range of different precursor concentrations was investigated and it was found that the optimum concentration of the glycine precursor was 0.13 mol dm -3 ; the phenylalanine yields were reduced when the concentration was less than this value. Owing to the poor UV absorption by di-tert-butyl peroxide, benzophenone (an effective photosensitiser) was added to the reaction mixture and this was shown to increase the alkylation yields. The ratio of reagents which produced the highest yield of phenylalanine products was found to be 1 : 5 : 5 : 10 for glycine : di-tert-butyl peroxide : benzophenone : toluene. This produced the phenylalanine product in up to 37% yield (57% based on recovered starting material). A number of substituents. (e.g. F, Cl etc.) could be attached to the aromatic ring of the toluene alkylating agent, affording substituted phenylalanines in 5 - 36% under these conditions. The formation of chiral phenylalanine products was probed by reacting glycine precursors bearing chiral auxiliaries. However, low diastereoselectivities were observed; the d.r. ranged from 1 : 1.1 to 1 : 1.5 only when chiral ester and amide protecting groups were used. In the final chapter, the

  14. Presynaptic Glycine Receptors Increase GABAergic Neurotransmission in Rat Periaqueductal Gray Neurons

    Directory of Open Access Journals (Sweden)

    Kwi-Hyung Choi

    2013-01-01

    Full Text Available The periaqueductal gray (PAG is involved in the central regulation of nociceptive transmission by affecting the descending inhibitory pathway. In the present study, we have addressed the functional role of presynaptic glycine receptors in spontaneous glutamatergic transmission. Spontaneous EPSCs (sEPSCs were recorded in mechanically dissociated rat PAG neurons using a conventional whole-cell patch recording technique under voltage-clamp conditions. The application of glycine (100 µM significantly increased the frequency of sEPSCs, without affecting the amplitude of sEPSCs. The glycine-induced increase in sEPSC frequency was blocked by 1 µM strychnine, a specific glycine receptor antagonist. The results suggest that glycine acts on presynaptic glycine receptors to increase the probability of glutamate release from excitatory nerve terminals. The glycine-induced increase in sEPSC frequency completely disappeared either in the presence of tetrodotoxin or Cd2+, voltage-gated Na+, or Ca2+ channel blockers, suggesting that the activation of presynaptic glycine receptors might depolarize excitatory nerve terminals. The present results suggest that presynaptic glycine receptors can regulate the excitability of PAG neurons by enhancing glutamatergic transmission and therefore play an important role in the regulation of various physiological functions mediated by the PAG.

  15. Cytochrome c catalyzes the in vitro synthesis of arachidonoyl glycine

    International Nuclear Information System (INIS)

    McCue, Jeffrey M.; Driscoll, William J.; Mueller, Gregory P.

    2008-01-01

    Long chain fatty acyl glycines are an emerging class of biologically active molecules that occur naturally and produce a wide array of physiological effects. Their biosynthetic pathway, however, remains unknown. Here we report that cytochrome c catalyzes the synthesis of N-arachidonoyl glycine (NAGly) from arachidonoyl coenzyme A and glycine in the presence of hydrogen peroxide. The identity of the NAGly product was verified by isotope labeling and mass analysis. Other heme-containing proteins, hemoglobin and myoglobin, were considerably less effective in generating arachidonoyl glycine as compared to cytochrome c. The reaction catalyzed by cytochrome c in vitro points to its potential role in the formation of NAGly and other long chain fatty acyl glycines in vivo

  16. Glycine-U-14C metabolism in young rats fed the 10% casein diets containing excess glycine

    International Nuclear Information System (INIS)

    Takeuchi, Hisanao; Wakatsuki, Tetsuo; Muramatsu, Keiichiro

    1975-01-01

    Nine hours after rats fed ad libitum for 14 days a 10% casein diet (10C), a 10% casein diet containing 7% glycine (10C7G) and a 10% casein diet containing 7% glycine with 1.4% L-arginine.HCl and 0.9% L-methionine (10C7GArgMet) were force-fed 10 ml of each diet suspension containing 5μCi of glycine-U- 14 C per 100 g of body weight, the radioactivity recoveries of 14 C in expired CO 2 , tissue components and urine were determined. The radioactivity recovery of 14 C in the expired CO 2 of the 10C7G group was generally higher than that of the 10C7GArgMet group. The recovery of 14 C in the trichloroacetic acid (TCA) soluble fraction of muscle of the 10C7G and the 10C7GArgMet groups were greater than that of the 10C group. The recoveries of 14 C in the TCA soluble fraction and protein of plasma and liver, and the muscle protein were negligible in all the groups. The amount of glycine- 14 C incorporated into the carcass lipids of the 10C7GArgMet group was larger than that of other groups. The recoveries of 14 C in the liver and muscle glycogen, and liver lipids were remarkably small in all the groups. From the above results, it was suggested that the degradation of glycine- 14 C to expiratory CO 2 was not accelerated, but the rate of incorporation of the isotope into carcass lipids was increased by the supplementation of L-arginine and L-methionine to the 10C7G diet as compared with that of rats fed the 10C7G diet. (JPN)

  17. 3ds Max 2012 Bible

    CERN Document Server

    Murdock, Kelly L

    2011-01-01

    Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav

  18. Biochemical studies on the effect of fluoride on higher plants. I. Metabolism of carbohydrates, organic acids and amino acids. [Glycine max var. Hawkeye

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S F; Miller, G W

    1963-01-01

    Metabolic processes associated with free sugars, organic acids and amino acids in higher plants subjected to fluoride fumigation were studied quantitatively. Fluoride-fumigated leaves contained more reducing sugars and less sucrose than the normal leaves. This result suggested inhibition of sucrose synthesis by fluoride. Necrotic leaves contained increased total concentrations of organic acids, which were mostly attributable to malic acid, malonic acid and citric acid. The greater increase in malic acid relative to that of citric acid was the reverse of results observed in chlorotic tissue. Necrotic leaves contained enhanced amounts of free amino acids. The greatest increase occurred in the concentration of asparagine and might be related to the increased respiratory rate of necrotic leaves. Pipecolic acid accumulated in large quantities in nicrotic tissue and was not detected in normal leaves. The accumulation of organic acids and amino acids in leaves during fluoride fumigation was evidenced by a lowered respiratory quotient.

  19. The ergogenic effect of recombinant human erythropoietin on VO2max depends on the severity of arterial hypoxemia

    DEFF Research Database (Denmark)

    Robach, Paul; Calbet, Jose A L; Thomsen, Jonas J

    2008-01-01

    degrees of acute hypoxia in eight rhEpo-treated subjects. Following prolonged rhEpo treatment, the gain in systemic VO(2)max observed in normoxia (6-7%) persisted during mild hypoxia (8% at inspired O(2) fraction (F(I)O(2)) of 0.173) and was even larger during moderate hypoxia (14-17% at F(I)O(2) = 0...... redistribution of cardiac output toward the exercising legs, whereas this advantageous effect disappeared during severe hypoxia, leaving augmented CaO(2) alone insufficient for improving peak leg O(2) delivery and VO(2). Finally, that VO(2)max was largely dependent on CaO(2) during moderate hypoxia but became...

  20. Main: 1V3H [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1V3H 大豆 Soybean Glycine max (L.) Merrill Beta-Amylase Name=Bmy1; Glycine Max Molecule: Beta-Amylase; Chai... 495 AA, Molecular weight: 56011 Da ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRSLFQLVQECGLTLQAI...MSFHQCGGNVGDIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG...FLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSG...GWREDIRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIFKKFVLKMHADQDYCANPQKYNHAITPLKPSAPKIPIEVLLEATKPTLPFPWLPETDMKVDG soybean_1V3H.jpg ...

  1. Fast heavy-ion radiation damage of glycine in aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Shinji [Department of Nuclear Engineering, Kyoto University, Kyoto 615-8530 (Japan); Tsuchida, Hidetsugu, E-mail: tsuchida@nucleng.kyoto-u.ac.jp [Department of Nuclear Engineering, Kyoto University, Kyoto 615-8530 (Japan); Quantum Science and Engineering Center, Kyoto University, Uji 611-0011 (Japan); Furuya, Ryosuke [Department of Nuclear Engineering, Kyoto University, Kyoto 615-8530 (Japan); Majima, Takuya; Itoh, Akio [Department of Nuclear Engineering, Kyoto University, Kyoto 615-8530 (Japan); Quantum Science and Engineering Center, Kyoto University, Uji 611-0011 (Japan)

    2016-12-15

    Fast heavy-ion radiolysis of biomolecules in aqueous solution is investigated for an atomistic understanding of radiation damage to normal cells during heavy-particle beam therapy. The smallest amino acid glycine was used as a model biomaterial. Microjets of aqueous glycine solutions under vacuum were irradiated with 4.0-MeV carbon ions corresponding to energies in the Bragg peak region. To understand the effects of the water environment on molecular damage, the yield of glycine dissociation was measured by secondary ion mass spectroscopy. The yield was significantly reduced relative to gas-phase glycine targets. This implies that the numerous water molecules surrounding a single glycine molecule act as a buffer that suppresses dissociation. This is an environmental effect similar to that observed for other biomolecular cluster targets.

  2. A min-max variational principle

    International Nuclear Information System (INIS)

    Georgiev, P.G.

    1995-11-01

    In this paper a variational principle for min-max problems is proved that is of the same spirit as Deville-Godefroy-Zizler's variational principle for minimization problems. A localization theorem in which the mini-max points for the perturbed function with respect top a given ε-min-max point are localized is presented. 3 refs

  3. Effect of sheep manure and phosphorus application on growth, yield, and N2 - fixation of inoculated soybean (Glycine max (L.) Merr) grown on Syrian arid soils using the 15N isotopic dilution technique

    International Nuclear Information System (INIS)

    Khalifa, Kh.; Al-Ain, F.; Al-Shamma'a, M.

    2003-10-01

    A field experiment was carried out in Syrian arid soils at Deir Al-Hajar research station to study the effect of different rates of sheep manure (0, 20, and 40 ton/ha) and levels of P- fertilizer (0, 40 and 80 kg P 2 O 5 /ha) on dry matter production and N 2 fixation by Soybean [(Glycine max) (SB171 variety)], of which seeds were inoculated by Bradyrhizobium japonicum-FA3 bacterial. Sorghum bicolor L. was employed as a reference crop ti evaluate N 2 -fixation using the 15 N-isotope dilution technique. In general, results indicated that, a positive effects were found to adding Sheep Manure or P-fertilizer on D.M production in different plants parts of soybean (shoots, roots, pods). This effect was more pronounced when adding sheep manure and phosphorus together especially under the optimum M40P80 treatment. Quantity of N-fixed by Soybean responds positively to sole application of Sheep Manure or P-fertilizer. Moreover, the optimum combined treatment showed significant increases in the quantity of nitrogen derived from the atmosphere (Qndfa), which were (3.29, 25.54, 53.49 kg N/ha) in roots, shoots, and pods respectively. P-fertilization resulted in a significant increase in the percentage of nitrogen use efficiency (NUE) with increasing phosphorus levels added to Sorghum plants; However, an adverse effect was noticed for the NUE when using sheep manure solely or in combination with P-fertilizer. (author)

  4. Glycine uptake by microvillous and basal plasma membrane vesicles from term human placentae.

    Science.gov (United States)

    Dicke, J M; Verges, D; Kelley, L K; Smith, C H

    1993-01-01

    Like most amino acids, glycine is present in higher concentrations in the fetus than in the mother. Unlike most amino acids, animal studies suggest fetal concentrations of glycine are minimally in excess of those required for protein synthesis. Abnormal glycine utilization has also been demonstrated in small-for-gestational age human fetuses. The mechanism(s) of glycine uptake in the human placenta are unknown. In other mammalian cells glycine is a substrate for the A, ASC and Gly amino acid transport systems. In this study human placental glycine uptake was characterized using microvillous and basal plasma membrane vesicles each prepared from the same placenta. In both membranes glycine uptake was mediated predominantly by the sodium-dependent A system. Competitive inhibition studies suggest that in microvillous vesicles the small percentage of sodium-dependent glycine uptake not inhibited by methylaminoisobutyric acid (MeAIB) shares a transport system with glycine methyl ester and sarcosine, substrates of the Gly system in other tissues. In addition there are mediated sodium-independent and non-selective transport mechanisms in both plasma membranes. If fetal glycine availability is primarily contingent upon the common and highly regulated A system, glycine must compete with many other substrates potentially resulting in marginal fetal reserves, abnormal utilization and impaired growth.

  5. Integrated operation of the photorespiratory cycle and cytosolic metabolism in the modulation of primary nitrogen assimilation and export of organic N-transport compounds from leaves: a hypothesis.

    Science.gov (United States)

    Misra, Jitendra B

    2014-02-15

    Photorespiration is generally considered to be an essentially dissipative process, although it performs some protective and essential functions. A theoretical appraisal indicates that the loss of freshly assimilated CO2 due to photorespiration in well-watered plants may not be as high as generally believed. Even under moderately adverse conditions, these losses may not exceed 10%. The photorespiratory metabolism of the source leaves of well-watered and well-nourished crop plants ought to be different from that of other leaves because the fluxes of the export of both carbohydrates and organic N-transport compounds in source leaves is quite high. With a heuristic approach that involved the dovetailing of certain metabolic steps with the photorespiratory cycle (PR-cycle), a novel network is proposed to operate in the source-leaves of well-watered and well-nourished plants. This network allows for the diversion of metabolites from their cyclic-routes in sizeable quantities. With the removal of considerable quantities of glycine and serine from the cyclic route, the number of RuBP oxygenation events would be several times those of the formation of hydroxypyruvate. Thus, to an extreme extent, photorespiratory metabolism would become open-ended and involve much less futile recycling of glycine and serine. Conversion of glyoxylate to glycine has been proposed to be a crucial step in the determination of the relative rates of the futile (cyclic) and anabolic (open-ended) routes. Thus, in the source leaves of well-watered and well-nourished plants, the importance of the cyclic route is limited to the salvaging of photorespiratory intermediates for the regeneration of RuBP. The proposed network is resilient enough to coordinate the rates of the assimilation of carbon and nitrogen in accordance with the moisture and N-fertility statuses of the soil. Copyright © 2013 Elsevier GmbH. All rights reserved.

  6. Screening of various botanical extracts for antioxidant activity using DPPH free radical method.

    Science.gov (United States)

    Waqas, Muhammad Khurram; Saqib, Najam-Us; Rashid, Saeed-Ur; Shah, Pervaiz Akhtar; Akhtar, Naveed; Murtaza, Ghulam

    2013-01-01

    Aiming at the exploration of herbal use by society, crude extracts of the seeds of some commonly used medicinal plants (Vitis vinifera, Tamarindus indica and Glycin max) were screened for their free radical scavenging properties using ascorbic acid as standard antioxidant. Free radical scavenging activity was evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical. The overall antioxidant activity of grape seeds (Vitis vinifera) was the strongest, followed in descending order by soybean (Glycin max) and tamarind (Tamarindus indica). The seeds extract of Vitis vinifera, Glycin max and Tamarindus indica showed 85.61%, 83.45% and 79.26%, DPPH scavenging activity respectively.

  7. Bacteria associated with cysts of the soybean cyst nematode (Heterodera glycines).

    Science.gov (United States)

    Nour, Sarah M; Lawrence, John R; Zhu, Hong; Swerhone, George D W; Welsh, Martha; Welacky, Tom W; Topp, Edward

    2003-01-01

    The soybean cyst nematode (SCN), Heterodera glycines, causes economically significant damage to soybeans (Glycine max) in many parts of the world. The cysts of this nematode can remain quiescent in soils for many years as a reservoir of infection for future crops. To investigate bacterial communities associated with SCN cysts, cysts were obtained from eight SCN-infested farms in southern Ontario, Canada, and analyzed by culture-dependent and -independent means. Confocal laser scanning microscopy observations of cyst contents revealed a microbial flora located on the cyst exterior, within a polymer plug region and within the cyst. Microscopic counts using 5-(4,6-dichlorotriazine-2-yl)aminofluorescein staining and in situ hybridization (EUB 338) indicated that the cysts contained (2.6 +/- 0.5) x 10(5) bacteria (mean +/- standard deviation) with various cellular morphologies. Filamentous fungi were also observed. Live-dead staining indicated that the majority of cyst bacteria were viable. The probe Nile red also bound to the interior polymer, indicating that it is lipid rich in nature. Bacterial community profiles determined by denaturing gradient gel electrophoresis analysis were simple in composition. Bands shared by all eight samples included the actinobacterium genera Actinomadura and STREPTOMYCES: A collection of 290 bacteria were obtained by plating macerated surface-sterilized cysts onto nutrient broth yeast extract agar or on actinomycete medium. These were clustered into groups of siblings by repetitive extragenic palindromic PCR fingerprinting, and representative isolates were tentatively identified on the basis of 16S rRNA gene sequence. Thirty phylotypes were detected, with the collection dominated by Lysobacter and Variovorax spp. This study has revealed the cysts of this important plant pathogen to be rich in a variety of bacteria, some of which could presumably play a role in the ecology of SCN or have potential as biocontrol agents.

  8. Production of 1-carbon units from glycine is extensive in healthy men and women.

    Science.gov (United States)

    Lamers, Yvonne; Williamson, Jerry; Theriaque, Douglas W; Shuster, Jonathan J; Gilbert, Lesa R; Keeling, Christine; Stacpoole, Peter W; Gregory, Jesse F

    2009-04-01

    Glycine undergoes decarboxylation in the glycine cleavage system (GCS) to yield CO(2), NH(3), and a 1-carbon unit. CO(2) also can be generated from the 2-carbon of glycine by 10-formyltetrahydrofolate-dehydrogenase and, after glycine-to-serine conversion by serine hydroxymethyltransferase, from the tricarboxylic acid cycle. To evaluate the relative fates of glycine carbons in CO(2) generation in healthy volunteers (3 male, 3 female, aged 21-26 y), primed, constant infusions were conducted using 9.26 micromol x h(-1) x kg(-1) of [1,2-(13)C]glycine and 1.87 micromol x h(-1) x kg(-1) of [5,5,5-(2)H(3)]leucine, followed by an infusion protocol using [1-(13)C]glycine as the glycine tracer. The time period between the infusion protocols was >6 mo. In vivo rates of whole-body glycine and leucine flux were nearly identical in protocols with [1,2-(13)C]glycine and [5,5,5-(2)H(3)]leucine and with [1-(13)C]glycine and [5,5,5-(2)H(3)]leucine tracers, which showed high reproducibility between the tracer protocols. Using the [1-(13)C]glycine tracer, breath CO(2) data showed a total rate of glycine decarboxylation of 96 +/- 8 micromol x h(-1) x kg(-1), which was 22 +/- 3% of whole-body glycine flux. In contrast, infusion of [1,2-(13)C]glycine yielded a glycine-to-CO(2) flux of 146 +/- 37 micromol x h(-1) x kg(-1) (P = 0.026). By difference, this implies a rate of CO(2) formation from the glycine 2-carbon of 51 +/- 40 micromol x h(-1) x kg(-1), which accounts for approximately 35% of the total CO(2) generated in glycine catabolism. These findings also indicate that approximately 65% of the CO(2) generation from glycine occurs by decarboxylation, primarily from the GCS. Further, these results suggest that the GCS is responsible for the entry of 5,10-methylenetetrahydrofolate into 1-carbon metabolism at a very high rate ( approximately 96 micromol x h(-1) x kg(-1)), which is approximately 20 times the demand for methyl groups for homocysteine remethylation.

  9. The symbiotic biofilm of Sinorhizobium fredii SMH12, necessary for successful colonization and symbiosis of Glycine max cv Osumi, is regulated by Quorum Sensing systems and inducing flavonoids via NodD1.

    Directory of Open Access Journals (Sweden)

    Francisco Pérez-Montaño

    Full Text Available Bacterial surface components, especially exopolysaccharides, in combination with bacterial Quorum Sensing signals are crucial for the formation of biofilms in most species studied so far. Biofilm formation allows soil bacteria to colonize their surrounding habitat and survive common environmental stresses such as desiccation and nutrient limitation. This mode of life is often essential for survival in bacteria of the genera Mesorhizobium, Sinorhizobium, Bradyrhizobium, and Rhizobium. The role of biofilm formation in symbiosis has been investigated in detail for Sinorhizobium meliloti and Bradyrhizobium japonicum. However, for S. fredii this process has not been studied. In this work we have demonstrated that biofilm formation is crucial for an optimal root colonization and symbiosis between S. fredii SMH12 and Glycine max cv Osumi. In this bacterium, nod-gene inducing flavonoids and the NodD1 protein are required for the transition of the biofilm structure from monolayer to microcolony. Quorum Sensing systems are also required for the full development of both types of biofilms. In fact, both the nodD1 mutant and the lactonase strain (the lactonase enzyme prevents AHL accumulation are defective in soybean root colonization. The impairment of the lactonase strain in its colonization ability leads to a decrease in the symbiotic parameters. Interestingly, NodD1 together with flavonoids activates certain quorum sensing systems implicit in the development of the symbiotic biofilm. Thus, S. fredii SMH12 by means of a unique key molecule, the flavonoid, efficiently forms biofilm, colonizes the legume roots and activates the synthesis of Nod factors, required for successfully symbiosis.

  10. Weed Control in Soybean (Glycine max)

    International Nuclear Information System (INIS)

    Kipkemoi, P.L.

    2002-01-01

    Weed Compete for limited growth factors with crop plants. This result in loss of crop vigour and hence reduces crop yields. A study was conducted in 1997 and 2001 to evaluate the use of herbicides and hand hoeing for weed control in soybeans. Crop establishment was by hand planting. The herbicides were applied using CP3 Knap sack sprayer calibrated to deliver a spray volume of 150l/ha. Hand weeding treatment were done as appropriate. The trial layout was randomised complete block design with four replications in both years. The tested herbicides did not satisfactorily control the weeds present at the experimental site in both years. Hand weeding on the other hand gave good control of the weeds which were reflected in high soybean yields. In these trials yields were negatively correlated with the number of weeds present. The tested herbicides alone appeared to be inadequate in controlling weeds in soybean. Compared with the weed-free treatment a single application of soil-applied or post-emergence herbicides did not control a broad spectrum of weeds and reduced soybean yields. It can also be inferred that soybean yield losses are minimised if they are kept weed free for at most 6 weeks after emergence

  11. Effects of elevated CO2 concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr

    International Nuclear Information System (INIS)

    Rodriguez, J.H.; Klumpp, A.; Fangmeier, A.; Pignata, M.L.

    2011-01-01

    The carbon dioxide (CO 2 ) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO 2 and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO 2 regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO 2 and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO 2 than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO 2 and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO 2 and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human health.

  12. Effects of elevated CO2 concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr.

    Science.gov (United States)

    Rodriguez, J H; Klumpp, A; Fangmeier, A; Pignata, M L

    2011-03-15

    The carbon dioxide (CO(2)) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO(2) and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO(2) regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO(2) and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO(2) than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO(2) and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO(2) and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human health. Copyright © 2010

  13. In silico comparison of genomic regions containing genes coding for enzymes and transcription factors for the phenylpropanoid pathway in Phaseolus vulgaris L. and Glycine max L. Merr

    Directory of Open Access Journals (Sweden)

    Yarmilla eReinprecht

    2013-09-01

    Full Text Available Legumes contain a variety of phytochemicals derived from the phenylpropanoid pathway that have important effects on human health as well as seed coat color, plant disease resistance and nodulation. However, the information about the genes involved in this important pathway is fragmentary in common bean (Phaseolus vulgaris L.. The objectives of this research were to isolate genes that function in and control the phenylpropanoid pathway in common bean, determine their genomic locations in silico in common bean and soybean, and analyze sequences of the 4CL gene family in two common bean genotypes. Sequences of phenylpropanoid pathway genes available for common bean or other plant species were aligned, and the conserved regions were used to design sequence-specific primers. The PCR products were cloned and sequenced and the gene sequences along with common bean gene-based (g markers were BLASTed against the Glycine max v.1.0 genome and the P. vulgaris v.1.0 (Andean early release genome. In addition, gene sequences were BLASTed against the OAC Rex (Mesoamerican genome sequence assembly. In total, fragments of 46 structural and regulatory phenylpropanoid pathway genes were characterized in this way and placed in silico on common bean and soybean sequence maps. The maps contain over 250 common bean g and SSR (simple sequence repeat markers and identify the positions of more than 60 additional phenylpropanoid pathway gene sequences, plus the putative locations of seed coat color genes. The majority of cloned phenylpropanoid pathway gene sequences were mapped to one location in the common bean genome but had two positions in soybean. The comparison of the genomic maps confirmed previous studies, which show that common bean and soybean share genomic regions, including those containing phenylpropanoid pathway gene sequences, with conserved synteny. Indels identified in the comparison of Andean and Mesoamerican common bean sequences might be used to develop

  14. Genetics Home Reference: glycine encephalopathy

    Science.gov (United States)

    ... seizures. As they get older, many develop intellectual disability, abnormal movements, and behavioral problems. Other atypical types of glycine encephalopathy appear later in childhood or adulthood ...

  15. First-principles study of the formation of glycine-producing radicals from common interstellar species

    Science.gov (United States)

    Sato, Akimasa; Kitazawa, Yuya; Ochi, Toshiro; Shoji, Mitsuo; Komatsu, Yu; Kayanuma, Megumi; Aikawa, Yuri; Umemura, Masayuki; Shigeta, Yasuteru

    2018-03-01

    Glycine, the simplest amino acid, has been intensively searched for in molecular clouds, and the comprehensive clarification of the formation path of interstellar glycine is now imperative. Among all the possible glycine formation pathways, we focused on the radical pathways revealed by Garrod (2013). In the present study, we have precisely investigated all the chemical reaction steps related to the glycine formation processes based on state-of-the-art density functional theory (DFT) calculations. We found that two reaction pathways require small activation barriers (ΔE‡ ≤ 7.75 kJ mol-1), which demonstrates the possibility of glycine formation even at low temperatures in interstellar space if the radical species are generated. The origin of carbon and nitrogen in the glycine backbone and their combination patterns are further discussed in relation to the formation mechanisms. According to the clarification of the atomic correspondence between glycine and its potential parental molecules, it is shown that the nitrogen and two carbons in the glycine can originate in three common interstellar molecules, methanol, hydrogen cyanide, and ammonia, and that the source molecules of glycine can be described by any of their combinations. The glycine formation processes can be categorized into six patterns. Finally, we discussed two other glycine formation pathways expected from the present DFT calculation results.

  16. Growth and antimicrobial studies of γ-glycine crystal grown using CuSO4

    Science.gov (United States)

    Vijayalakshmi, V.; Dhanasekaran, P.

    2018-05-01

    In the current work single crystals of pure and 1M of CuSO4-added glycine were grown by slow evaporation method and its optical and antimicrobial properties were studied. The Polymorph of glycine transforms from a-glycine to γ-glycine due to the incorporation of CuSO4 on glycine was affirmed by the PXRD and FTIR studies. The impact of CuSO4 on the antimicrobial action of the grown samples was deliberate by utilizing the agar diffusion method.

  17. Alterations in brain extracellular dopamine and glycine levels following combined administration of the glycine transporter type-1 inhibitor Org-24461 and risperidone.

    Science.gov (United States)

    Nagy, Katalin; Marko, Bernadett; Zsilla, Gabriella; Matyus, Peter; Pallagi, Katalin; Szabo, Geza; Juranyi, Zsolt; Barkoczy, Jozsef; Levay, Gyorgy; Harsing, Laszlo G

    2010-12-01

    The most dominant hypotheses for the pathogenesis of schizophrenia have focused primarily upon hyperfunctional dopaminergic and hypofunctional glutamatergic neurotransmission in the central nervous system. The therapeutic efficacy of all atypical antipsychotics is explained in part by antagonism of the dopaminergic neurotransmission, mainly by blockade of D(2) dopamine receptors. N-methyl-D-aspartate (NMDA) receptor hypofunction in schizophrenia can be reversed by glycine transporter type-1 (GlyT-1) inhibitors, which regulate glycine concentrations at the vicinity of NMDA receptors. Combined drug administration with D(2) dopamine receptor blockade and activation of hypofunctional NMDA receptors may be needed for a more effective treatment of positive and negative symptoms and the accompanied cognitive deficit in schizophrenia. To investigate this type of combined drug administration, rats were treated with the atypical antipsychotic risperidone together with the GlyT-1 inhibitor Org-24461. Brain microdialysis was applied in the striatum of conscious rats and determinations of extracellular dopamine, DOPAC, HVA, glycine, glutamate, and serine concentrations were carried out using HPLC/electrochemistry. Risperidone increased extracellular concentrations of dopamine but failed to influence those of glycine or glutamate measured in microdialysis samples. Org-24461 injection reduced extracellular dopamine concentrations and elevated extracellular glycine levels but the concentrations of serine and glutamate were not changed. When risperidone and Org-24461 were added in combination, a decrease in extracellular dopamine concentrations was accompanied with sustained elevation of extracellular glycine levels. Interestingly, the extracellular concentrations of glutamate were also enhanced. Our data indicate that coadministration of an antipsychotic with a GlyT-1 inhibitor may normalize hypofunctional NMDA receptor-mediated glutamatergic neurotransmission with reduced

  18. Structure-activity relationships of strychnine analogues at glycine receptors

    DEFF Research Database (Denmark)

    Mohsen, A.M.Y.; Heller, Eberhard; Holzgrabe, Ulrike

    2014-01-01

    Nine strychnine derivatives including neostrychnine, strychnidine, isostrychnine, 21,22-dihydro-21-hydroxy-22-oxo-strychnine, and several hydrogenated analogs were synthesized, and their antagonistic activities at human α1 and α1β glycine receptors were evaluated. Isostrychnine has shown the best...... pharmacological profile exhibiting an IC50 value of 1.6 μM at α1 glycine receptors and 3.7-fold preference towards the α1 subtype. SAR Analysis indicates that the lactam moiety and the C(21)[DOUBLE BOND]C(22) bond in strychnine are essential structural features for its high antagonistic potency at glycine...

  19. Mastering Autodesk 3ds Max 2013

    CERN Document Server

    Harper, Jeffrey

    2012-01-01

    Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides

  20. Acúmulo de massa seca e macronutrientes por plantas de Glycine max e Richardia brasiliensis Accumulation of biomass and macronutrients by Glycine max and Richardia brasiliensis

    Directory of Open Access Journals (Sweden)

    A.F.F. Pedrinho Júnior

    2004-03-01

    para a planta daninha. Levando em conta a média dos valores de pontos de inflexão observados para a cultura da soja, aos 78 DAE uma planta de soja acumula teoricamente 25,9 g de massa seca; 615,5 mg de N; 77,2 mg de P; 538,6 mg de K; 535,0 mg de Ca; 171,5 mg de Mg; e 39,5 mg de S. Para o mesmo período, uma planta de R. brasiliensis acumula teoricamente 3,7 g de massa seca; 50,8 mg de N; 3,2 mg de P; 104,4 mg de K; 127,8 mg de Ca; 18,8 mg de Mg; e 3,7 mg de S.Two greenhouse trials were carried out under greenhouse conditionsat the Department of Agricultural Biology at FCAV-UNESP in Jaboticabal, SP, Brazil to study tbiomass accumulation as well as macronutrient distribution and accumulation during the life cycle of the soybean cultivar BR 16 from October 2000 to February 2001, and Richardia brasiliensis (Brazilian pusley, from October 1998 to February 1999. Brazilian pusley is one of the most important weeds in the mid western soybean growing area, mainly under no tillage system. The studies were conducted in a randomized complete design with four replications. Four plants were grown in seven liter pots filled with sandy substrate irrigated daily with a nutritive solution. The treatments were represented by timing of sampling, performed at 14 day intervals, 22, 36, 50, 64, 78, 92, 106, 120, 134, 148, 162 and 176 days after emergence (DAE of R. brasiliensis plants; and 21, 35, 49, 63, 77, 91, 105 and 119 DAE of the soybean plants BR-16 (early maturity For both plants, the leaves had the highest biomass partition during seven weeks. For these data, partition was higher in reproductive structures in soybean and in the stems for Brazilian pusley. The maximumcritical biomass accumulation was estimated at 104 days for soybean (36.6 g plant-1 and at 146 days for R. brasiliensis (16.4 g planta-1. From emergence up to 50 DAE, the leaves presented higher participation in biomass accumulation, in both species. After 50 DAE, it was observed in both species an inversion in leaf

  1. A weak link in metabolism: the metabolic capacity for glycine ...

    Indian Academy of Sciences (India)

    Prakash

    2009-12-03

    Dec 3, 2009 ... glyoxylate, threonine and trimethyllysine (carnitine synthesis), most of them ...... Participation of glycine in porphyrin biosynthesis. Eight glycine ...... normal and streptozotocin-induced diabetic rats; J. Dent. Res. 63 23–27.

  2. Synthesis of water soluble glycine capped silver nanoparticles and their surface selective interaction

    International Nuclear Information System (INIS)

    Agasti, Nityananda; Singh, Vinay K.; Kaushik, N.K.

    2015-01-01

    Highlights: • Synthesis of water soluble silver nanoparticles at ambient reaction conditions. • Glycine as stabilizing agent for silver nanoparticles. • Surface selective interaction of glycine with silver nanoparticles. • Glycine concentration influences crystalinity and optical property of silver nanoparticles. - Abstract: Synthesis of biocompatible metal nanoparticles has been an area of significant interest because of their wide range of applications. In the present study, we have successfully synthesized water soluble silver nanoparticles assisted by small amino acid glycine. The method is primarily based on reduction of AgNO 3 with NaBH 4 in aqueous solution under atmospheric air in the presence of glycine. UV–vis spectroscopy, transmission electron microscopy (TEM), X–ray diffraction (XRD), Fourier transform infrared (FTIR) spectroscopy, thermogravimetry (TG) and differential thermal analysis (DTA) techniques used for characterization of resulting silver nanoparticles demonstrated that, glycine is an effective capping agent to stabilize silver nanoparticles. Surface selective interaction of glycine on (1 1 1) face of silver nanoparticles has been investigated. The optical property and crystalline behavior of silver nanoparticles were found to be sensitive to concentration of glycine. X–ray diffraction studies ascertained the phase specific interaction of glycine on silver nanoparticles. Silver nanoparticles synthesized were of diameter 60 nm. We thus demonstrated an efficient synthetic method for synthesis of water soluble silver nanoparticles capped by amino acid under mild reaction conditions with excellent reproducibility

  3. Influência de abelhas africanizadas na concentração de açúcares no néctar de soja (Glycine max L. Merrill var. Coodetec 207 = Influence of africanized honeybees on sugar concentration in the nectar of soybean (Glycine max L. Merrill var. Coodetec 207

    Directory of Open Access Journals (Sweden)

    Eloi Machado Alves

    2010-04-01

    Full Text Available O objetivo foi avaliar a concentração de açúcares no néctar de soja (Glycine max L. Merrill em áreas com ou sem a presença de abelhas Apis mellifera L. Foi utilizada a variedade Coodetec 207 em quatro tratamentos: área de 24 m2 coberta com colônia de abelhas africanizadas em seu interior; área semicoberta com livre acesso para insetos visitantes; área livre e área coberta sem abelhas. As flores foram coletadas durante três dias, a cada 2h. e a concentração dos açúcares totais por flor foi determinada por espectrofotometria. A área coberta com abelha apresentou maior concentração de açúcares totais em relação à área coberta sem abelhas e livre, contudo, aconcentração de açúcares totais na área livre não diferiu da concentração observada na área coberta sem abelhas. Houve redução na concentração média de sacarose na área livre, diferindo das concentrações nas demais áreas. A concentração média de glicose não diferiu entre os tratamentos, enquanto que a de frutose não apresentou diferença entre as áreas cobertas com abelhas, semicoberta e livre. A variedade Coodetec 207 da soja apresentou maior concentração total de açúcares e de frutose nas áreas cobertas com abelhas. Contudo, a presença de Apis mellifera não interferiu nesta concentração de açúcares no néctar das flores de soja desta variedade.This research was carried out to evaluate the sugar concentration in soybean nectar in areas with Africanized honeybee colonies. The var. Coodetec 207 was used in four treatments: 24 m2 covered area with Africanized honeybee colony inside, semi-covered area for free insect visitation, uncovered area, and covered area without insect visitation. Flowers were harvested for three days at two-hour intervals, and the total sugar concentration per flower was determined by spectrophotometry. The covered area with Africanized honeybee colony presented higher sugar concentration than the covered area

  4. Effects of elevated CO{sub 2} concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, J.H. [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina); Klumpp, A.; Fangmeier, A. [Institute of Landscape and Plant Ecology (320), Plant Ecology and Ecotoxicology, Universitaet Hohenheim, August-von-Hartmann-Str. 3, 70599 Stuttgart (Germany); Pignata, M.L., E-mail: pignata@com.uncor.edu [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina)

    2011-03-15

    The carbon dioxide (CO{sub 2}) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO{sub 2} and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO{sub 2} regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO{sub 2} and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO{sub 2} than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO{sub 2} and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO{sub 2} and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human

  5. Molecular characterisation of a recombinant bovine glycine N-acyltransferase / Christoffel Petrus Stephanus Badenhorst

    OpenAIRE

    Badenhorst, Christoffel Petrus Stephanus

    2010-01-01

    Conjugation of glycine to organic acids is an important detoxification mechanism. Metabolites of aspirin and industrial solvents, benzoic acid found in plant material and many endogenous metabolites are detoxified by conjugation to glycine. The enzyme responsible for glycine conjugation, glycine N-acyltransferase (GL YAT), is investigated in this study. The enzyme is also important for the management of organic acidemias which are inherited metabolic diseases. However, not all ...

  6. Interaction of Heterodera glycines and Glomus mosseae on Soybean.

    Science.gov (United States)

    Todd, T C; Winkler, H E; Wilson, G W

    2001-12-01

    The effects of the arbuscular mycorrhizal (AM) fungus Glomus mosseae on Heterodera glycines-soybean interactions were investigated in greenhouse experiments. Mycorrhizal and nonmycorrhizal soybean cultivars that were either resistant or susceptible to H. glycines were exposed to initial nematode population densities (Pi) of 0, 100, 1,000, or 10,000 eggs and infective juveniles. Soybean growth, nematode reproduction, and AM fungal colonization were determined after 35 (experiment I) and 83 (experiment II) days. Soybean shoot and root weights were reduced an average 29% across H. glycines Pi but were 36% greater overall in the presence of G. mosseae. Analyses of variance indicated that root colonization and stimulation of soybean growth by G. mosseae were inhibited at high H. glycines Pi, while the combined effects of the nematode and fungus on soybean growth were best described as additive in linear regression models. No evidence for increased nematode tolerance of mycorrhizal soybean plants was observed. Nematode population densities and reproduction were lower on a nematode-resistant soybean cultivar than on a susceptible cultivar, but reproduction was comparable on mycorrhizal and nonmycorrhizal plants. Root colonization by G. mosseae was reduced at high nematode Pi. The results suggest that nematode antagonism to the mycorrhizal symbiosis is a more likely consequence of interactions between H. glycines and AM fungi on soybean than is nematode suppression by the fungus.

  7. A Fast Numerical Method for Max-Convolution and the Application to Efficient Max-Product Inference in Bayesian Networks.

    Science.gov (United States)

    Serang, Oliver

    2015-08-01

    Observations depending on sums of random variables are common throughout many fields; however, no efficient solution is currently known for performing max-product inference on these sums of general discrete distributions (max-product inference can be used to obtain maximum a posteriori estimates). The limiting step to max-product inference is the max-convolution problem (sometimes presented in log-transformed form and denoted as "infimal convolution," "min-convolution," or "convolution on the tropical semiring"), for which no O(k log(k)) method is currently known. Presented here is an O(k log(k)) numerical method for estimating the max-convolution of two nonnegative vectors (e.g., two probability mass functions), where k is the length of the larger vector. This numerical max-convolution method is then demonstrated by performing fast max-product inference on a convolution tree, a data structure for performing fast inference given information on the sum of n discrete random variables in O(nk log(nk)log(n)) steps (where each random variable has an arbitrary prior distribution on k contiguous possible states). The numerical max-convolution method can be applied to specialized classes of hidden Markov models to reduce the runtime of computing the Viterbi path from nk(2) to nk log(k), and has potential application to the all-pairs shortest paths problem.

  8. Nitrogen functionality of glucose-glycine condensate; Glucose to glycine tono shukugo hanno (shukugobutsuchu no chisso kagobutsu no keitai bunseki)

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, C.; Yoshioka, T.; Komano, T.; Mashimo, K.; Wainai, T. [Nihon University, Tokyo (Japan). College of Science and Technology; Sugimoto, Y.; : Miki, Y. [National Institute of Materials and Chemical Research, Tsukuba (Japan)

    1996-10-28

    In order to clarify a humification process in the early stage of coalification, the nitrogen functionality of prepared glucose-glycine condensate was studied experimentally. In experiment, the condensate was prepared by heating the mixture of glucose, glycine and water in a autoclave at 130{degree}C for 50 hours, and furthermore heating the produced solid material in water at 300{degree}C. After the condensate was hydrocracked, the fraction, condensate and hydrocracking residue were analyzed by elementary analyzer, {sup 13}C-NMR, XPS, FT-IR, capillary GC-FID/NPD and GC-MS. As a result, the glucose-glycine condensate could be arranged on the basis of three types of nitrogen such as pyridine, pyrrole and quaternary amine type. Pyridine type nitrogen increased, while quaternary amine type one decreased with an increase in heating treatment temperature. Rich pyrrole type nitrogen and poor pyridine type one were found in light nitrogen compounds in hydrocracked products. 2 refs., 4 figs., 2 tabs.

  9. D-Serine and Glycine Differentially Control Neurotransmission during Visual Cortex Critical Period.

    Directory of Open Access Journals (Sweden)

    Claire N J Meunier

    Full Text Available N-methyl-D-aspartate receptors (NMDARs play a central role in synaptic plasticity. Their activation requires the binding of both glutamate and d-serine or glycine as co-agonist. The prevalence of either co-agonist on NMDA-receptor function differs between brain regions and remains undetermined in the visual cortex (VC at the critical period of postnatal development. Here, we therefore investigated the regulatory role that d-serine and/or glycine may exert on NMDARs function and on synaptic plasticity in the rat VC layer 5 pyramidal neurons of young rats. Using selective enzymatic depletion of d-serine or glycine, we demonstrate that d-serine and not glycine is the endogenous co-agonist of synaptic NMDARs required for the induction and expression of Long Term Potentiation (LTP at both excitatory and inhibitory synapses. Glycine on the other hand is not involved in synaptic efficacy per se but regulates excitatory and inhibitory neurotransmission by activating strychnine-sensitive glycine receptors, then producing a shunting inhibition that controls neuronal gain and results in a depression of synaptic inputs at the somatic level after dendritic integration. In conclusion, we describe for the first time that in the VC both D-serine and glycine differentially regulate somatic depolarization through the activation of distinct synaptic and extrasynaptic receptors.

  10. Glycine facilitates gamma-glutamylcysteinylethyl ester-mediated increase in liver glutathione level.

    Science.gov (United States)

    Nishida, K; Ohta, Y; Ishiguro, I

    1997-08-27

    gamma-Glutamylcysteinylethyl ester (gamma-GCE) increases reduced glutathione (GSH) levels in GSH-depleted rat hepatocytes. Because glycine, a constituent of GSH, exists at 0.3 to 0.4 mM in rat plasma, we examined the influence of glycine added to the medium on the action of gamma-GCE to increase GSH levels in the rat hepatocytes. Glycine (0.2-0.8 mM) dose-dependently enhanced gamma-GCE-mediated increase in intracellular GSH levels with an increase in intracellular gamma-GCE levels. These results indicate that exogenous glycine facilitates gamma-GCE-mediated increase in intracellular GSH levels in rat hepatocytes possibly by enhancing the uptake of gamma-GCE into the cells.

  11. Tukey max-stable processes for spatial extremes

    KAUST Repository

    Xu, Ganggang; Genton, Marc G.

    2016-01-01

    We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max

  12. Impaired absorption of marked oligopeptide Glycine-I Tyrosine-Glycine after successful autologous-allotopic ileal mucosa transplantation in beagles.

    Science.gov (United States)

    Beiler, H A; Steinorth, J; Witt, A; Mier, W; Mohammed, A; Waag, K L; Zachariou, Z

    2004-10-01

    After establishing a method for ileal mucosa transplantation in an animal model, the authors investigated the absorptive capacity for oligopeptides of the transplanted mucosa. In 14 beagle dogs the authors transplanted ileal mucosa in a vascularized demucosed segment of the transverse colon. The colonic wall-ileal mucosa complex then was integrated in the ileal continuity. Six animals were lost owing to operative complications. Absorptive capacity for oligopeptides was measured in the remaining 8 animals with the iodine 131 (131I)-marked tripeptide glycine-tyrosine-glycine before and 4 weeks after transplantation. The results were compared and analyzed with the Student's t test for matched pairs. Blood concentrations of the marked tripeptide with P value less than .05 were considered as a significant reduction in the absorptive capacity of the transplanted ileal mucosa. After fixation with glutaraldehyd graft, uptake of the colonic wall-ileal mucosa complex was evaluated histologically in 8 animals. In all 8 animals, a 100% graft uptake was verified in all sections. Fifteen minutes after application of 15 MBc Glycine-131I-Tyrosine-Glycine there was no significant difference in the absorption between normal and transplanted ileal mucosa. After 30 minutes, the absorption of the transplanted ileal mucosa showed a tendency (P < .1) for an impaired uptake of the marked tripeptide. However, 60 minutes after application the difference in the absorptive capacity of the transplanted ileal mucosa was significant (P < .05). Autologous allotopic ileal mucosa transplantation is feasible; however, an impaired absorption of oligopeptides of the transplanted mucosa 4 weeks after transplantation could be observed.

  13. Quantum Max-flow/Min-cut

    Science.gov (United States)

    Cui, Shawn X.; Freedman, Michael H.; Sattath, Or; Stong, Richard; Minton, Greg

    2016-06-01

    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  14. Quantum Max-flow/Min-cut

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Shawn X., E-mail: xingshan@math.ucsb.edu [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Quantum Architectures and Computation Group, Microsoft Research, Redmond, Washington 98052 (United States); Freedman, Michael H., E-mail: michaelf@microsoft.com [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Microsoft Research, Station Q, University of California, Santa Barbara, California 93106 (United States); Sattath, Or, E-mail: sattath@gmail.com [Computer Science Division, University of California, Berkeley, California 94720 (United States); Stong, Richard, E-mail: stong@ccrwest.org; Minton, Greg, E-mail: gtminto@ccrwest.org [Center for Communications Research, La Jolla, California 92121 (United States)

    2016-06-15

    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  15. Synthesis and Characterization of Novel Acyl-Glycine Inhibitors of GlyT2.

    Science.gov (United States)

    Mostyn, Shannon N; Carland, Jane E; Shimmon, Susan; Ryan, Renae M; Rawling, Tristan; Vandenberg, Robert J

    2017-09-20

    It has been demonstrated previously that the endogenous compound N-arachidonyl-glycine inhibits the glycine transporter GlyT2, stimulates glycinergic neurotransmission, and provides analgesia in animal models of neuropathic and inflammatory pain. However, it is a relatively weak inhibitor with an IC 50 of 9 μM and is subject to oxidation via cyclooxygenase, limiting its therapeutic value. In this paper we describe the synthesis and testing of a novel series of monounsaturated C18 and C16 acyl-glycine molecules as inhibitors of the glycine transporter GlyT2. We demonstrate that they are up to 28 fold more potent that N-arachidonyl-glycine with no activity at the closely related GlyT1 transporter at concentrations up to 30 μM. This novel class of compounds show considerable promise as a first generation of GlyT2 transport inhibitors.

  16. Ford C-Max plug-in hybrid; Ford C-Max mit Plug-in-Hybridtechnik

    Energy Technology Data Exchange (ETDEWEB)

    Schamel, Andreas; D' Annunzio, Julie; Iorio, Rob [Ford Motor Company, Dearborn, MI (United States); Schmitz, Peter [Ford-Forschungszentrum Aachen GmbH, Aachen (Germany)

    2013-03-01

    Ford provides consumers a broad choice of electrified vehicles globally, including full hybrids, plug-in hybrids and all-electric vehicles. The all-new 2013 model year C-Max Energi Plug-in Hybrid utilises the third generation of Ford hybrid technology. This article discusses the hybrid powersplit architecture and components, as well as the charging capability and human-machine interfaces, used in the C-Max Energi Plug-In Hybrid. (orig.)

  17. Selection individual on mutant genotype of soybean (Glycine maxl.merrill) in m5 generation based on resistance of stem rot disease Athelia rolfsii (curzi)

    Science.gov (United States)

    Rahmah, M.; Hanafiah, D. S.; Siregar, L. A. M.; Safni, I.

    2018-02-01

    This study was aimed to obtain selected individuals on soybean plant Glycine max L. (Merrill) in M5 generation based on high production character and tolerance of stem rot disease Athelia rolfsii (Curzi). This research was conducted in Plant Disease Laboratory and experimental field Faculty of Agriculture Universitas Sumatera Utara Medan, Indonesia. This research was conducted from December 2016 to June 2017. The treatments were 15 mutant lines genotypes and Anjasmoro variety. The results showed that some lines mutant genotypes can gave the good agronomic appearance character than Anjasmoro variety on inoculation treatment of stem rot disease. Selection performed on population M5 producesselected individuals with tolerance of stem rot disease from 100 and 200 Gy population.

  18. Light intensity affects the uptake and metabolism of glycine by pakchoi (Brassica chinensis L.)

    Science.gov (United States)

    Ma, Qingxu; Cao, Xiaochuang; Wu, Lianghuan; Mi, Wenhai; Feng, Ying

    2016-02-01

    The uptake of glycine by pakchoi (Brassica chinensis L.), when supplied as single N-source or in a mixture of glycine and inorganic N, was studied at different light intensities under sterile conditions. At the optimal intensity (414 μmol m-2 s-1) for plant growth, glycine, nitrate, and ammonium contributed 29.4%, 39.5%, and 31.1% shoot N, respectively, and light intensity altered the preferential absorption of N sources. The lower 15N-nitrate in root but higher in shoot and the higher 15N-glycine in root but lower in shoot suggested that most 15N-nitrate uptake by root transported to shoot rapidly, with the shoot being important for nitrate assimilation, and the N contribution of glycine was limited by post-uptake metabolism. The amount of glycine that was taken up by the plant was likely limited by root uptake at low light intensities and by the metabolism of ammonium produced by glycine at high light intensities. These results indicate that pakchoi has the ability to uptake a large quantity of glycine, but that uptake is strongly regulated by light intensity, with metabolism in the root inhibiting its N contribution.

  19. A kinetic model for the glucose/glycine Maillard reaction pathways

    NARCIS (Netherlands)

    Martins, S.I.F.S.; Boekel, van M.A.J.S.

    2005-01-01

    A comprehensive kinetic model for the glucose/glycine Maillard reaction is proposed based on an approach called multiresponse kinetic modelling. Special attention was paid to reactants, intermediates and end products: -fructose, N-(1-deoxy--fructos-1-yl)-glycine (DFG), 1-deoxy-2,3-hexodiulose and

  20. Max dD/Dt: A Novel Parameter to Assess Fetal Cardiac Contractility and a Substitute for Max dP/Dt.

    Science.gov (United States)

    Fujita, Yasuyuki; Kiyokoba, Ryo; Yumoto, Yasuo; Kato, Kiyoko

    2018-07-01

    Aortic pulse waveforms are composed of a forward wave from the heart and a reflection wave from the periphery. We focused on this forward wave and suggested a new parameter, the maximum slope of aortic pulse waveforms (max dD/dt), for fetal cardiac contractility. Max dD/dt was calculated from fetal aortic pulse waveforms recorded with an echo-tracking system. A normal range of max dD/dt was constructed in 105 healthy fetuses using linear regression analysis. Twenty-two fetuses with suspected fetal cardiac dysfunction were divided into normal and decreased max dD/dt groups, and their clinical parameters were compared. Max dD/dt of aortic pulse waveforms increased linearly with advancing gestational age (r = 0.93). The decreased max dD/dt was associated with abnormal cardiotocography findings and short- and long-term prognosis. In conclusion, max dD/dt calculated from the aortic pulse waveforms in fetuses can substitute for max dP/dt, an index of cardiac contractility in adults. Copyright © 2018 World Federation for Ultrasound in Medicine and Biology. Published by Elsevier Inc. All rights reserved.

  1. Rapid Methods to Distinguish Heterodera schachtii from Heterodera glycines Using PCR Technique

    Directory of Open Access Journals (Sweden)

    Hyoung Rai Ko

    2017-09-01

    Full Text Available The purpose of this study was to develop rapid methods for distinguishing between Heterodera schachtii and H. glycines detected from chinese cabbage fields of highland in Gangwon, Korea. To do this, we performed PCR-RFLP and PCR with the primers set developed in this study for GC147, GC408 and PM001 population, H. schachtii, and YS224, DA142 and BC115 population, H. glycines. Eight restriction enzymes generated RFLP profiles of mtDNA COI region for populations of H. schachtii and H. glycines, repectively. As a result, treatment of two restriction enzymes, RsaI and HinfI, were allowed to distinguish H. schachtii from H. glycines based on the differences of DNA band patterns. The primer set, #JBS1, #JBG1 and #JB3R, amplified specific fragments with 277 and 339 bp of H. schachtii, 339 bp of H. glycines, respectively, while it did not amplify fragments from three root-knot nematodes and two root-lesion nematodes. Thus, the primer set developed in this study could be a good method, which is used to distinguish between H. schachtii and H. glycines.

  2. A DFT study of adsorption of glycine onto the surface of BC_2N nanotube

    International Nuclear Information System (INIS)

    Soltani, Alireza; Azmoodeh, Zivar; Javan, Masoud Bezi; Lemeski, E. Tazikeh; Karami, Leila

    2016-01-01

    Highlights: • Glycine adsorption over the pristine BC_2N nanotubes is investigated by DFT calculations. • Adsorption of glycine in its zwitterionic form is stronger in comparison with the radical form. • Adsorption of glycine from its amine head on adsorbent leads to a significant decrease in the electronic properties. - Abstract: A theoretical study of structure and the energy interaction of amino acid glycine (NH_2CH_2COOH) with BC_2N nanotube is crucial for apperception behavior occurring at the nanobiointerface. Herein, we studied the adsorption of glycine in their radical and zwitterionic forms upon the surface of BC_2N nanotube using M06 functional and 6-311G** standard basis set. We also considered the different orientations of the glycine amino acid on the surface of adsorbent. Further, we found out that the stability of glycine from its carbonyl group is higher than hydroxyl and amine groups. Our results also indicated that the electronic structure of BC_2N nanotube on the adsorption of glycine from its amine group is more altered than the other groups. Our study exhibits that opto-electronic property of adsorbent is changed after the glycine adsorption.

  3. Assessment of the influence of different sample processing and cold storage duration on plant free proline content analyses.

    Science.gov (United States)

    Teklić, Tihana; Spoljarević, Marija; Stanisavljević, Aleksandar; Lisjak, Miroslav; Vinković, Tomislav; Parađiković, Nada; Andrić, Luka; Hancock, John T

    2010-01-01

    A method which is widely accepted for the analysis of free proline content in plant tissues is based on the use of 3% sulfosalicylic acid as an extractant, followed by spectrophotometric quantification of a proline-ninhydrin complex in toluene. However, sample preparation and storage may influence the proline actually measured. This may give misleading or difficult to compare data. To evaluate free proline levels fresh and frozen strawberry (Fragaria × ananassa Duch.) leaves and soybean [Glycine max (L.) Merr.] hypocotyl tissues were used. These were ground with or without liquid nitrogen and proline extracted with sulfosalicylic acid. A particular focus was the influence of plant sample cold storage duration (1, 4 and 12 weeks at -20°C) on tissue proline levels measured. The free proline content analyses, carried out in leaves of Fragaria × ananassa Duch. as well as in hypocotyls of Glycine max (L.) Merr., showed a significant influence of the sample preparation method and cold storage period. Long-term storage of up to 12 weeks at -20°C led to a significant increase in the measured proline in all samples analysed. The observed changes in proline content in plant tissue samples stored at -20°C indicate the likelihood of the over-estimation of the proline content if the proline analyses are delayed. Plant sample processing and cold storage duration seem to have an important influence on results of proline analyses. Therefore it is recommended that samples should be ground fresh and analysed immediately. Copyright © 2010 John Wiley & Sons, Ltd.

  4. Quinoa (Chenopodium quinoa Willd. versus soja (Glycine max [L.] Merr. en la nutrición humana: revisión sobre las características agroecológicas, de composición y tecnológicas

    Directory of Open Access Journals (Sweden)

    Diana Maria Chito Trujillo

    2017-07-01

    Full Text Available El diseño de alimentos funcionales a partir de productos vegetales muy estudiados como la soja (Glycine max [L.] Merr. y la potencialización de productos ancestrales como la quinoa (Chenopodium quinoa Willd. son estrategias factibles para contrarrestar la desnutrición mundial. El objetivo de la presente revisión es describir las características agroecológicas, de composición, nutricionales y tecnológicas de estas dos especies vegetales diferentes (leguminosa y pseudocereal, basado en las publicaciones previas. Se realizó una revisión en bases de datos (Scopus, Web of Science, Scielo y se complementó con una búsqueda manual en Google Scholar y páginas web de instituciones acreditadas. Los estudios incluidos (n=117 en esta revisión muestran que la soja se adapta mejor a altitudes bajas (~1.000 m s. n. m., mientras que la quinoa lo hace en un rango de mayores altitudes (500-4.000 m s. n. m. con mayor tolerancia a heladas. Ambas son fuente de una alta calidad proteica por suplir los requerimientos de aminoácidos esenciales sugeridos para niños y adultos sin diferencias significativas (p>0,05, particularmente triptófano y lisina y por los altos porcentajes de digestibilidad (>70%. Sus concentraciones bajas de prolaminas y aceptables de Fe, Zn, Ca, daidzeína y genisteína los convierten en productos de interés para la industria alimentaria.

  5. Zwitterionization of glycine in water environment: Stabilization mechanism and NMR spectral signatures

    Science.gov (United States)

    Valverde, Danillo; da Costa Ludwig, Zélia Maria; da Costa, Célia Regina; Ludwig, Valdemir; Georg, Herbert C.

    2018-01-01

    At physiological conditions, myriads of biomolecules (e.g., amino acids, peptides, and proteins) exist predominantly in the zwitterionic structural form and their biological functions will result in these conditions. However these geometrical structures are inaccessible energetically in the gas phase, and at this point, stabilization of amino-acids in physiological conditions is still under debate. In this paper, the electronic properties of a glycine molecule in the liquid environment were studied by performing a relaxation of the glycine geometry in liquid water using the free energy gradient method combined with a sequential quantum mechanics/molecular mechanics approach. A series of Monte Carlo Metropolis simulations of the glycine molecule embedded in liquid water, followed by only a quantum mechanical calculation in each of them were carried out. Both the local and global liquid environments were emphasized to obtain nuclear magnetic resonance (NMR) parameters for the glycine molecule in liquid water. The results of the equilibrium structure in solution and the systematic study of the hydrogen bonds were used to discard the direct proton transfer from the carboxyl group to the ammonium group of the glycine molecule in water solution. The calculations of the Density Functional Theory (DFT) were performed to study the polarization of the solvent in the parameters of nuclear magnetic resonance of the glycine molecule in liquid water. DFT calculations predicted isotropic chemical changes on the H, C, N, and O atoms of glycine in liquid water solution which agree with the available experimental data.

  6. A critical role for glycine transporters in hyperexcitability disorders

    Directory of Open Access Journals (Sweden)

    Robert J Harvey

    2008-03-01

    Full Text Available Defects in mammalian glycinergic neurotransmission result in a complex motor disorder characterized by neonatal hypertonia and an exaggerated startle refl ex, known as hyperekplexia (OMIM 149400. This affects newborn children and is characterized by noise or touch-induced seizures that result in muscle stiffness and breath-holding episodes. Although rare, this disorder can have serious consequences, including brain damage and/or sudden infant death. The primary cause of hyperekplexia is missense and nonsense mutations in the glycine receptor (GlyR α1 subunit gene (GLRA1 on chromosome 5q33.1, although we have also discovered rare mutations in the genes encoding the GlyR β subunit (GLRB and the GlyR clustering proteins gephyrin (GPNH and collybistin (ARHGEF9. Recent studies of the Na+ /Cl--dependent glycine transporters GlyT1 and GlyT2 using mouse knockout models and human genetics have revealed that mutations in GlyT2 are a second major cause of hyperekplexia, while the phenotype of the GlyT1 knockout mouse resembles a devastating neurological disorder known as glycine encephalopathy (OMIM 605899. These findings highlight the importance of these transporters in regulating the levels of synaptic glycine.

  7. Crystallization of glycine with ultrasound

    DEFF Research Database (Denmark)

    Louhi-Kultanen, Marjatta; Karjalainen, Milja; Rantanen, Jukka

    2006-01-01

    Sonocrystallization has proved to be an efficient tool to influence the external appearance and structure of a crystalline product obtained by various crystallization methods. The present work focuses on high intensity sonocrystallization of glycine by varying amplitude of ultrasound with an ultr...... ultrasound power. This study also showed, the higher the ultrasound amplitude the smaller the crystals obtained.......Sonocrystallization has proved to be an efficient tool to influence the external appearance and structure of a crystalline product obtained by various crystallization methods. The present work focuses on high intensity sonocrystallization of glycine by varying amplitude of ultrasound...... with an ultrasound frequency of 20kHz at two temperature ranges 40-50 and 20-30 degrees C in a jacketed 250-ml cooling crystallizer equipped with a stirrer. The polymorph composition of the obtained crystals was analyzed with a temperature variable X-ray powder diffractometer (XRPD). XRPD results showed that...

  8. Constitutive expression of feedback-insensitive cystathionine γ-synthase increases methionine levels in soybean leaves and seeds

    Institute of Scientific and Technical Information of China (English)

    YU Yang; HOU Wen-sheng; YaeI Hacham; SUN Shi; WU Cun-xiang; Ifat Matityahu; SONG Shikui; RacheI Amir; HAN Tian-fu

    2018-01-01

    Soybean (Glycine max (L.) Merr.) is a major crop that provides plant-origin protein and oil for humans and livestock. Although the soybean vegetative tissues and seeds provide a major source of high-quality protein, they suffer from low concentration of an essential sulfur-containing amino acid, methionine, which significantly limits their nutritional quality. The level of methionine is mainly controlled by the first unique enzyme of methionine synthesis, cystathione γ-synthase (CGS). Aiming to elevate methionine level in vegetative tissues and seeds, we constitutively over-expressed a feedback-insensitive Arabidopsis CGS (AtD-CGS) in soybean cultivars, Zigongdongdou (ZD) and Jilinxiaoli 1 (JX). The levels of soluble methionine increased remarkably in leaves of transgenic soybeans compared to wild-type plants (6.6- and 7.3-fold in two transgenic ZD lines, and 3.7-fold in one transgenic JX line). Furthermore, the total methionine contents were significantly increased in seeds of the transgenic ZD lines (1.5- to 4.8-fold increase) and the transgenic JX lines (1.3- to 2.3-fold increase) than in the wild type. The protein contents of the transgenic soybean seeds were significantly elevated compared to the wild type, suggesting that the scarcity of methionine in soybeans may limit protein accumulation in soybean seeds. The increased protein content did not alter the profile of major storage proteins in the seeds. Generally, this study provides a promising strategy to increase the levels of methionine and protein in soybean through the breeding programs.

  9. Kinetic study of carbon dioxide absorption into glycine promoted diethanolamine (DEA)

    Science.gov (United States)

    Pudjiastuti, Lily; Susianto, Altway, Ali; IC, Maria Hestia; Arsi, Kartika

    2015-12-01

    In industry, especially petrochemical, oil and natural gas industry, required separation process of CO2 gas which is a corrosive gas (acid gas). This characteristic can damage the plant utility and piping systems as well as reducing the caloric value of natural gas. Corrosive characteristic of CO2 will appear in areas where there is a decrease in temperature and pressure, such as at the elbow pipe, tubing, cooler and injector turbine. From disadvantages as described above, then it is important to do separation process in the CO2 gas stream, one of the method for remove CO2 from the gas stream is reactive absorption using alkanolamine based solution with promotor. Therefore, this study is done to determine the kinetics constant of CO2 absorption in diethanolamine (DEA) solution using a glycine promoter. Glycine is chosen as a promoter because glycine is a primary amine compound which is reactive, moreover, glycine has resistance to high temperatures so it will not easy to degradable and suitable for application in industry. The method used in this study is absorption using laboratory scale wetted wall column equipment at atmospheric of pressure. This study will to provide the reaction kinetics data information in order to optimize the separation process of CO2 in the industrialized world. The experimental results show that rising temperatures from 303,15 - 328,15 K and the increase of concentration of glycine from 1% - 3% weight will increase the absorption rate of carbon dioxide in DEA promoted with glycine by 24,2% and 59,764% respectively, also the reaction kinetic constant is 1.419 × 1012 exp (-3634/T) (m3/kmol.s). This result show that the addition of glycine as a promoter can increase absorption rate of carbon dioxide in diethanolamine solution and cover the weaknesses of diethanolamine solution.

  10. Anatomia foliar de soja infectada por Phakopsora pachyrhizi H. Sydow & Sydow e tratadas com extratos vegetais Leaf anatomy of soybean infected with Phakopsora pachyrhizi H. Sydow & Sydow and treated with plant extracts

    Directory of Open Access Journals (Sweden)

    R.M. Mussury

    2012-01-01

    Full Text Available Folhas de Glycine max (L. Merril,infectadas pelo fungo Phakopsora pachyrhizi H. Sydow & Sydow e tratadas com extratos vegetais foram avaliadas, visando determinar in vivo as modificações anatômicas nas diferentes estruturas/tecidos foliares, além de reconhecer prováveis mecanismos de defesa. Folhas de soja cultivar 181 provenientes do quinto nó foram inoculadas com fungo e tratadas com diferentes extratos vegetais, água e álcool 70%. Para comparação foram analisadas a anatomia das folhas sadia e infectada e realizadas medidas nas estruturas/tecidos foliares. Na folha infectada, observou-se destruição da epiderme e parênquima lacunoso, visível proliferação de tricomas e cutícula espessada, principalmente na face abaxial. Observou-se a presença de compostos fenólicos nas células da epiderme quando rompida, em função do crescimento micelial. Nas folhas infectadas e tratadas com os extratos vegetais de Azadirachta indica, Maytenus ilicifolia e Allium sativum, as estruturas/tecidos vegetais apresentaram aumento de espessura por alongamento celular.Glycine max (L. Merril leaves, infected by the fungus Phakopsora pachyrhizi H. Sydow & Sydow and treated with plant extracts, were evaluated with the aim of determining in vivo the anatomical modifications in different leaf structures and of identifying probable defense mechanisms. Leaves from the 181 soybean cultivar originated from the fifth node were inoculated with the fungus and treated with different plant extracts, water and alcohol at 70%. For comparison, the anatomy of the healthy and infected leaves was analyzed and the leaf structures were measured. In the infected leaf, there was destruction of the epidermis and lacunar parenchyma, apparent trichome proliferation and denser cuticle, especially on the abaxial surface. There were also phenolic compounds in ruptured epidermis cells, due to mycelium growth. In the infected leaves treated with Azadirachta indica, Maytenus

  11. L-Glycine Alleviates Furfural-Induced Growth Inhibition during Isobutanol Production in Escherichia coli.

    Science.gov (United States)

    Song, Hun-Suk; Jeon, Jong-Min; Choi, Yong Keun; Kim, Jun-Young; Kim, Wooseong; Yoon, Jeong-Jun; Park, Kyungmoon; Ahn, Jungoh; Lee, Hongweon; Yang, Yung-Hun

    2017-12-28

    Lignocellulose is now a promising raw material for biofuel production. However, the lignin complex and crystalline cellulose require pretreatment steps for breakdown of the crystalline structure of cellulose for the generation of fermentable sugars. Moreover, several fermentation inhibitors are generated with sugar compounds, majorly furfural. The mitigation of these inhibitors is required for the further fermentation steps to proceed. Amino acids were investigated on furfural-induced growth inhibition in E. coli producing isobutanol. Glycine and serine were the most effective compounds against furfural. In minimal media, glycine conferred tolerance against furfural. From the IC₅₀ value for inhibitors in the production media, only glycine could alleviate growth arrest for furfural, where 6 mM glycine addition led to a slight increase in growth rate and isobutanol production from 2.6 to 2.8 g/l under furfural stress. Overexpression of glycine pathway genes did not lead to alleviation. However, addition of glycine to engineered strains blocked the growth arrest and increased the isobutanol production about 2.3-fold.

  12. Effects of Methanol Spraying on Qualitative traits, Yield and Yield Components of Soybean (Glycine max L. under Drought Stress Conditions

    Directory of Open Access Journals (Sweden)

    J Esazadeh Panjali Kharabasi

    2017-12-01

    Full Text Available Introduction Soybean (Glycin max L. is one of the most important oilseed crops in the world. It can provide oil and vegetable protein suitable for feeding humans as well as animals. The productivity Increasing of this crop in Iran has been the subject of continuous investigation over the past few years. It is well known that adequate water supply is considered as a very important factor to affect the accumulation of dry matter in the plant as well as vegetative growth of most crops. Irrigation is an important factor affecting soybean growth and yield and its related components. Exposing soybean plants to soil moisture stress at any phase of its life cycle may lead to a detrimental effect on growth, yield and its components. The methanol spraying can lead to increase in yield, expediting in maturity and reduction in drought stress impacts and water requirement of crops. Material and Methods The experiment was conducted as split plots based on randomized complete block design with three replications at the Research Farm, Faculty of Agriculture of Moghan, Iran, in 2011. Treatments included three levels of drought stress as follows irrigation after, 40 (control, 55 and 70 percentage of available soil moisture depletion as main plots, and four levels of methanol spraying including 0 (control, 7, 21 and 35 volumetric percentage as sub plots. The studied traits were included plant height, leaf area, number of pod and seed per plant, 1000 seed weight, biological and seed yield, stomatal conductance and proline contents. Statistical analysis was carried out using SAS version 9.1 software. Significant difference was set at p ≤ 0.05 by using Duncan’s multiple range test. Results and Discussion The results showed that the plant height, leaf area, number of pod and seed per plant, 1000 seed weight, biological and seed yield, stomatal conductance and proline contents as well as number of leaf per plant significantly affected by drought stress and methanol

  13. Seleccion de cepas de rizobios en suelos promisorios para el cultivo de la soya (Glycine max (L Merril en Colombia

    Directory of Open Access Journals (Sweden)

    Sylvester Bradley Rosemary

    1989-06-01

    Full Text Available En el invernadero se evaluó la efectividad de las cepas preseleccionadas de B. japonicum (CIAT 199,209,3778,3874 y 3876 de la recomendada (CIAT51 y una de Rhizobium spp (CIAT 3779. En el suelo Fluventic Haplustoll, de reacción casi neutra, se presentó respuesta altamente significativa a la inoculación. El tratamiento fertilizado con 150 kg de N/ha produjo el mayor rendimiento de N. Las cepas más efectivas fueron CIAT 3778 y 51, que también presentaron el mayor indice de efectividad a la inoculación (IEI. En el suelo Typic Pellustert,de reacción alcalina, se presentó respuesta significativa a la inoculación. El mayor rendimiento de N se obtuvo con las cepas CIAT 3778 y 51, que fueron además estadísticamente iguales a las cepas CIAT 199 y 3876 en cuanto al IEI. En el suelo Arenic Haplustalf, de reacción ligeramente ácida, hubo respuesta altamente significativa a la inoculación y la cepa más efectiva fue la CJAT 199. En el suelo Fluventic Ustropept, de reacci6n ligeramente ácida, se presentaron diferencias significativas entre los tratamientos inoculados. El mayor rendimiento de N se presentó en el tratamiento fertilizado con N. Las mejores cepas fueron CIAT 3778,3779 y 209. En el suelo Vertic Ustropept, de reacción alcalina, se presentó respuesta altamente significativa a la inoculación. En cuanto al rendimiento de N no se encontraron diferencias entre el tratamiento fertilizado con N y las cepas CIAT 51, 209 y CIAT 3778, siendo también las más efectivas en cuanto al IEI, junto oon la cepa CIAT 199. En los suelos Tropentic Haplorthox y Typic Tropudult no se enoontró respuesta a la inoculación.Screening of Rhizobium strains in soils apt for soybean (Glycine max (L Merril cultivation in Colombia. Under greenhouse conditions were evaluated the effectivity of the preselected strains of the preselected strains of B. japonicum (CIAT 199, 209, 3778, 3874 and 3876, in addition to the recommended strain (CIAT 51 and one of

  14. Sublethal and hormesis effects of imidacloprid on the soybean aphid Aphis glycines.

    Science.gov (United States)

    Qu, Yanyan; Xiao, Da; Li, Jinyu; Chen, Zhou; Biondi, Antonio; Desneux, Nicolas; Gao, Xiwu; Song, Dunlun

    2015-04-01

    The soybean aphid, Aphis glycines Matsumura, is a major pest in soybean crop. Current management of this pest relies mainly on insecticides applications, and the neonicotinoid imidacloprid has been proposed as an effective insecticide to control A. glycines in soybean field. Imidacloprid at lethal concentrations not only exerts acute toxicity to A. glycines, but also cause various biological changes when aphids are chronically exposed to lower concentrations. In this study, we assessed the effects of a low-lethal (0.20 mg L(-1)) and two sublethal (0.05 and 0.10 mg L(-1)) imidacloprid concentrations on various A. glycines life history traits. Aphid exposure to 0.20 mg L(-1) imidacloprid caused slower juvenile development, shorter reproductive period, and reduced adult longevity, fecundity and total lifespan. Stimulatory effects, i.e. hormesis, on reproduction and immature development duration were observed in aphids exposed to the lower sublethal imidacloprid concentrations. Consequently, the net reproduction rate (R 0) was significantly higher than in the control aphids. These findings stress the importance of the actual imidacloprid concentration in its toxicological properties on A. glycines. Therefore, our results would be useful for assessing the overall effects of imidacloprid on A. glycines and for optimizing integrated pest management programs targeting this pest.

  15. WiMax network planning and optimization

    CERN Document Server

    Zhang, Yan

    2009-01-01

    This book offers a comprehensive explanation on how to dimension, plan, and optimize WiMAX networks. The first part of the text introduces WiMAX networks architecture, physical layer, standard, protocols, security mechanisms, and highly related radio access technologies. It covers system framework, topology, capacity, mobility management, handoff management, congestion control, medium access control (MAC), scheduling, Quality of Service (QoS), and WiMAX mesh networks and security. Enabling easy understanding of key concepts and technologies, the second part presents practical examples and illu

  16. The effects of glycine on subjective daytime performance in partially sleep-restricted healthy volunteers

    Directory of Open Access Journals (Sweden)

    Makoto eBannai

    2012-04-01

    Full Text Available Approximately 30% of the general population suffers from insomnia. Given that insomnia causes many problems, amelioration of the symptoms is crucial. Recently, we found that a nonessential amino acid, glycine subjectively and objectively improves sleep quality in humans who have difficulty sleeping. We evaluated the effects of glycine on daytime sleepiness, fatigue and performances in sleep-restricted healthy subjects. Sleep was restricted to 25% less than the usual sleep time for three consecutive nights. Before bedtime, 3 g of glycine or placebo were ingested, sleepiness and fatigue were evaluated using the visual analogue scale (VAS and a questionnaire, and performance were estimated by personal computer (PC performance test program on the following day. In subjects given glycine, the VAS data showed a significant reduction in fatigue and a tendency toward reduced sleepiness. These observations were also found via the questionnaire, indicating that glycine improves daytime sleepiness and fatigue induced by acute sleep restriction. PC performance test revealed significant improvement in psychomotor vigilance test. We also measured plasma melatonin and the expression of circadian-modulated genes expression in the rat suprachiasmatic nucleus (SCN to evaluate the effects of glycine on circadian rhythms. Glycine did not show significant effects on plasma melatonin concentrations during either the dark or light period. Moreover, the expression levels of clock genes such as Bmal1 and Per2 remained unchanged. However, we observed a glycine-induced increase in the neuropeptides arginine vasopressin and vasoactive intestinal polypeptide in the light period. Although no alterations in the circadian clock itself were observed, our results indicate that glycine modulated SCN function. Thus, glycine modulates certain neuropeptides in the SCN and this phenomenon may indirectly contribute to improving the occasional sleepiness and fatigue induced by sleep

  17. Localization of high affinity [3H]glycine transport sites in the cerebellar cortex

    International Nuclear Information System (INIS)

    Wilkin, G.P.; Csillag, A.; Balazs, R.; Kingsbury, A.E.; Wilson, J.E.; Johnson, A.L.

    1981-01-01

    A study was made of [ 3 H ]glycine uptake sites in a preparation greatly enriched in large pieces of the cerebellar glomeruli (glomerulus particles) and in morphologically well preserved slices of rat cerebellum. Electron microscopic autoradiography revealed that of the neurones in the cerebellar cortex only Golgi cells transported [ 3 H]glycine at the low concentration used. Glial cells also took up [ 3 H]glycine but to a lesser extent than the Golgi neurons. It was also confirmed that under comparable conditions Golgi cells transport [ 3 H]GABA. Kinetic studies utilizing the Golgi axon terminal-containing glomerulus particles showed that glycine is a weak non-competitive inhibitor of [ 3 H]GABA uptake (Ksub(i) over 600 μM vs the Ksub(t) of about 20 μM) and that GABA is an even weaker inhibitor of [ 3 H]glycine uptake. (Auth.)

  18. Effect of Glycine on Lead Mobilization, Lead-Induced Oxidative Stress, and Hepatic Toxicity in Rats

    Directory of Open Access Journals (Sweden)

    Yolanda Alcaraz-Contreras

    2011-01-01

    Full Text Available The effectiveness of glycine in treating experimental lead intoxication was examined in rats. Male Wistar rats were exposed to 3 g/L lead acetate in drinking water for 5 weeks and treated thereafter with glycine (100 and 500 mg/kg, orally once daily for 5 days or glycine (1000 mg/kg, orally once daily for 28 days. The effect of these treatments on parameters indicative of oxidative stress (glutathione and malondialdehyde levels, the activity of blood -aminolevulinic acid dehydratase, and lead concentration in blood, liver, kidney, brain, and bone were investigated. Liver samples were observed for histopathological changes. Glycine was found to be effective in (1 increasing glutathione levels; (2 reducing malondialdehyde levels; (3 decreasing lead levels in bone with the highest dose. However, glycine had no effect on lead mobilization when 100 and 500 mg/kg glycine were administered. In microscopic examination, glycine showed a protective effect against lead intoxication.

  19. No choice but to find resistance to soybean aphid biotype 4

    Science.gov (United States)

    Host plant resistance in soybean [Glycine max (L.) Merr] utilizes its natural defenses to limit soybean aphid (Aphis glycines Matsamura, SBA) injury, reducing insecticide reliance. Specific genes called Rag or Resistance to Aphis glycines are unfavorable to SBA and may suppress their development and...

  20. Transcriptome changes in the phenylpropanoid pathway of Glycine max in response to Pseudomonas syringae infection

    Directory of Open Access Journals (Sweden)

    Gonzalez Delkin O

    2006-11-01

    Full Text Available Abstract Background Reports of plant molecular responses to pathogenic infections have pinpointed increases in activity of several genes of the phenylpropanoid pathway leading to the synthesis of lignin and flavonoids. The majority of those findings were derived from single gene studies and more recently from several global gene expression analyses. We undertook a global transcriptional analysis focused on the response of genes of the multiple branches of the phenylpropanoid pathway to infection by the Pseudomonas syringae pv. glycinea with or without the avirulence gene avrB to characterize more broadly the contribution of the multiple branches of the pathway to the resistance response in soybean. Transcript abundance in leaves was determined from analysis of soybean cDNA microarray data and hybridizations to RNA blots with specific gene probes. Results The majority of the genes surveyed presented patterns of increased transcript accumulation. Some increased rapidly, 2 and 4 hours after inoculation, while others started to accumulate slowly by 8 – 12 hours. In contrast, transcripts of a few genes decreased in abundance 2 hours post inoculation. Most interestingly was the opposite temporal fluctuation in transcript abundance between early responsive genes in defense (CHS and IFS1 and F3H, the gene encoding a pivotal enzyme in the synthesis of anthocyanins, proanthocyanidins and flavonols. F3H transcripts decreased rapidly 2 hours post inoculation and increased during periods when CHS and IFS transcripts decreased. It was also determined that all but one (CHS4 family member genes (CHS1, CHS2, CHS3, CHS5, CHS6 and CHS7/8 accumulated higher transcript levels during the defense response provoked by the avirulent pathogen challenge. Conclusion Based on the mRNA profiles, these results show the strong bias that soybean has towards increasing the synthesis of isoflavonoid phytoalexins concomitant with the down regulation of genes required for the

  1. Kinetics and mechanism of oxidation of glycine by iron(III)

    Indian Academy of Sciences (India)

    Kinetics and mechanism of oxidation of glycine by iron(III)-1,10-phenanthroline complex has been studied in perchloric acid medium. The reaction is first order with respect to iron(III) and glycine. An increase in (phenanthroline) increases the rate, while increase in [H+] decreases the rate. Hence it can be inferred that the ...

  2. Acúmulo de massa seca e de macronutrientes por plantas de Glycine max e Solanum americanum Accumulation of dry mass and macronutrients by Glycine max and Solanum americanum plants

    Directory of Open Access Journals (Sweden)

    S. Bianco

    2012-03-01

    S.Soybean is one of the main crops in Brazil, but its productivity is very affected by weed competition. Two experiments were carried out in Jaboticabal, SP, Brazil, under greenhouse conditions to determine the accumulation and distribution of dry mass and macronutrients in soybean cv. BR-16, from October 2000 to February 2001, and Solanum americanum plants, from January to May 1995. Plants were grown in seven liter pots filled with river sand substrate and were daily irrigated with nutrient solution. The treatments were constituted by the times of samplings carried out at 14 day intervals, starting 21 days after emergence (DAE. Soybean evaluation was extended to 161 DAE, while S. americanum was extended to 119 DAE. The point of maximum theoretical accumulation of dry mass in soybean occurred at 104 DAE (35.00 g per plant while for S. americanum, it occurred at 143 DAE (179.62 g per plant. From emergence until 49 and 63 DAE, leaves showed higher participation in dry mass accumulation of soybean and S. americanum, respectively. After these periods, an inversion could be observed, with leaves being surpassed by stems for the weeds, and by stems and later, by reproductive structures, for the crop. Macronutrient uptake rate reached higher values between 69 to 87 DAE for soybean and between 105 to 119 DAE for S. americanum. Considering the mean inflexion point values observed in soybean crop, at 75 DAE, it can be evidenced that one soybean plant theoretically accumulated 23.90 g of dry mass, 564.40 mg of N, 7.10 mg of P, 490.80 mg of K, 487.00 mg of Ca, 156.60 mg of Mg and 36.00 mg of S, while one S. americanum plant theoretically accumulated 33.75 g of dry mass, 875.96 mg of N, 88.46 mg of P, 983.54 mg of K, 647.60 mg of Ca, 100.93 mg of Mg, and 42.15 mg of S.

  3. Equilibria in aqueous cadmium-chloroacetate-glycinate systems. A convolution-deconvolution cyclic voltammetric study

    International Nuclear Information System (INIS)

    Abdel-Hamid, R.; Rabia, M.K.M.

    1994-01-01

    Stability constants and composition of cadmium-glycinate binary complexes were determined using cyclic voltammetry. Furthermore, binary and ternary complex equilibria for chloroacetates and glycinate with cadmium in 0.1 M aqueous KNO 3 at pH 10.4 and 298 K were investigated. Cadmium forms binary complexes with chloroacetates of low stability and ternary ones with chloroacetate-glycinate of significant stability. (author)

  4. Secondary Emission From Synthetic Opal Infiltrated by Colloidal Gold and Glycine

    International Nuclear Information System (INIS)

    Dovbeshko, G.I.; Fesenko, O.M.; Boyko, V.V.; Romanyuk, V.R.; Gorelik, V.S.; Moiseyenko, V.N.; Sobolev, V.B.; Shvalagin, V.V.

    2012-01-01

    A comparison of the secondary emission (photoluminescence) and Bragg reflection spectra of photonic crystals (PC), namely, synthetic opals, opals infiltrated by colloidal gold, glycine, and a complex of colloidal gold with glycine is performed. The infiltration of colloidal gold and a complex of colloidal gold with glycine into the pores of PC causes a short-wavelength shift (about 5-15 nm) of the Bragg reflection and increases the intensity of this band by 1.5-3 times. In photoluminescence, the infiltration of PC by colloidal gold and colloidal gold with glycine suppresses the PC emission band near 375-450 nm and enhances the shoulder of the stop-zone band of PC in the region of 470-510 nm. The shape of the observed PC emission band connected with defects in synthetic opal is determined by the type of infiltrates and the excitation wavelength. Possible mechanisms of the effects are discussed.

  5. Tukey max-stable processes for spatial extremes

    KAUST Repository

    Xu, Ganggang

    2016-09-21

    We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max-stable process are demonstrated theoretically and numerically. Simulation studies and an application to Swiss rainfall data indicate the effectiveness of the proposed process. © 2016 Elsevier B.V.

  6. Gbu Glycine Betaine Porter and Carnitine Uptake in Osmotically Stressed Listeria monocytogenes Cells

    Science.gov (United States)

    Mendum, Mary Lou; Smith, Linda Tombras

    2002-01-01

    The food-borne pathogen Listeria monocytogenes grows actively under high-salt conditions by accumulating compatible solutes such as glycine betaine and carnitine from the medium. We report here that the dominant transport system for glycine betaine uptake, the Gbu porter, may act as a secondary uptake system for carnitine, with a Km of 4 mM for carnitine uptake and measurable uptake at carnitine concentrations as low as 10 μM. This porter has a Km for glycine betaine uptake of about 6 μM. The dedicated carnitine porter, OpuC, has a Km for carnitine uptake of 1 to 3 μM and a Vmax of approximately 15 nmol/min/mg of protein. Mutants lacking either opuC or gbu were used to study the effects of four carnitine analogs on growth and uptake of osmolytes. In strain DP-L1044, which had OpuC and the two glycine betaine porters Gbu and BetL, triethylglycine was most effective in inhibiting growth in the presence of glycine betaine, but trigonelline was best at inhibiting growth in the presence of carnitine. Carnitine uptake through OpuC was inhibited by γ-butyrobetaine. Dimethylglycine inhibited both glycine betaine and carnitine uptake through the Gbu porter. Carnitine uptake through the Gbu porter was inhibited by triethylglycine. Glycine betaine uptake through the BetL porter was strongly inhibited by trigonelline and triethylglycine. These results suggest that it is possible to reduce the growth of L. monocytogenes under osmotically stressful conditions by inhibiting glycine betaine and carnitine uptake but that to do so, multiple uptake systems must be affected. PMID:12406761

  7. Crystal lattice dependency of the free radicals found in irradiated glycine

    NARCIS (Netherlands)

    Bie, M.J.A. de; Braams, R.

    1969-01-01

    The EPR spectra, and hence the stable free radicals, are different for the - or γ-irradiated α-, β- and γ-crystal forms of polycrystalline glycone. Therefore comparisons of the trideutero-glycine EPR spectrum with the EPR spectra of non-deuterated glycine are open to question

  8. Approximation by max-product type operators

    CERN Document Server

    Bede, Barnabás; Gal, Sorin G

    2016-01-01

    This monograph presents a broad treatment of developments in an area of constructive approximation involving the so-called "max-product" type operators. The exposition highlights the max-product operators as those which allow one to obtain, in many cases, more valuable estimates than those obtained by classical approaches. The text considers a wide variety of operators which are studied for a number of interesting problems such as quantitative estimates, convergence, saturation results, localization, to name several. Additionally, the book discusses the perfect analogies between the probabilistic approaches of the classical Bernstein type operators and of the classical convolution operators (non-periodic and periodic cases), and the possibilistic approaches of the max-product variants of these operators. These approaches allow for two natural interpretations of the max-product Bernstein type operators and convolution type operators: firstly, as possibilistic expectations of some fuzzy variables, and secondly,...

  9. OaMAX2 of Orobanche aegyptiaca and Arabidopsis AtMAX2 share conserved functions in both development and drought responses.

    Science.gov (United States)

    Li, Weiqiang; Nguyen, Kien Huu; Watanabe, Yasuko; Yamaguchi, Shinjiro; Tran, Lam-Son Phan

    2016-09-16

    Previous studies in Arabidopsis reported that the MAX2 (more axillary growth 2) gene is a component of the strigolactone (SL) signaling pathway, which regulates a wide range of biological processes, from plant growth and development to environmental stress responses. Orobanche aegyptiaca is a harmful parasitic plant for many economically important crops. Seed germination of O. aegyptiaca is very sensitive to SLs, suggesting that O. aegyptiaca may contain components of the SL signaling pathway. To investigate this hypothesis, we identified and cloned a MAX2 ortholog from O. aegyptiaca for complementation analyses using the Arabidopsis Atmax2 mutant. The so-called OaMAX2 gene could rescue phenotypes of the Atmax2 mutant in various tested developmental aspects, including seed germination, shoot branching, leaf senescence and growth and development of hypocotyl, root hair, primary root and lateral root. More importantly, OaMAX2 could enhance the drought tolerance of Atmax2 mutant, suggesting its ability to restore the drought-tolerant phenotype of mutant plants defected in AtMAX2 function. Thus, this study provides genetic evidence that the functions of the MAX2 orthologs, and perhaps the MAX2 signaling pathways, are conserved in parasitic and non-parasitic plants. Furthermore, the results of our study enable us to develop a strategy to fight against parasitic plants by suppressing the MAX signaling, which ultimately leads to enhanced productivity of crop plants. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Characterization and regulation of glycine transport in Fusarium oxysporum var. lini.

    Science.gov (United States)

    Castro, I M; Lima, A A; Nascimento, A F; Ruas, M M; Nicoli, J R; Brandão, R L

    1996-08-01

    Glycine was transported in Fusarium oxysporum cells, grown on glycine as the sole source of carbon and nitrogen, by a facilitated diffusion transport system with a half-saturation constant (Ks) of 11 mM and a maximum velocity (Vmax) of 1.2 mM (g dry weight)-1 h-1 at pH 5.0 and 26 degrees C. Under conditions of nitrogen starvation, the same system was present together with a high-affinity one (Ks) of about 47 microM and Vmax of about 60 microM (g dry weight)-1 h-1). The low-affinity system was more specific than the high-affinity system. Cells grown on gelatine showed the same behavior. In cells grown on glucose-gelatine medium, the low-affinity system was poorly expressed even after carbon and nitrogen starvation. Moreover, addition of glucose to cells grown on glycine and resuspended in mineral medium caused an increase of the glycine transport probably due to a boost in protein synthesis. This stimulation did not affect the Ks of the low-affinity system. These results demonstrate that, as is the case for other eukaryotic systems, F. oxysporum glycine transport is under control of nitrogen sources but its regulation by carbon sources appears to be more complex.

  11. MAX Provider Characteristics

    Data.gov (United States)

    U.S. Department of Health & Human Services — The MAX Provider Characteristics (PC) File Implementation Report describes the design, implementation, and results of the MAXPC prototype, which was based on three...

  12. Introducing Autodesk 3ds Max 2011

    CERN Document Server

    Derakhshani, Dariush

    2010-01-01

    An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c

  13. Preferential Pathway for Glycine Formation in Star-Forming Regions

    Science.gov (United States)

    Pilling, S.; Boechat-Roberty, H. M.; Baptista, L.; Santos A. C., F.

    Interstellar clouds, similar to that from which the solar system was formed, contain many organic molecules including aldehydes, acids, ketones, and sugars Ehrenfreund & Charnley (2000). Those organic compounds have important functions in terrestrial biochemistry and could also have been important in prebiotic synthesis. The simplest amino acid, glycine (NH2CH2COOH), was recently detected in the hot molecular cores Sgr B2(N-LMH), Orion KL, and W51 e1/e2 Kuan et al. (2003). The formic acid (HCOOH) and acetic acid(CH3COOH) have also been detected in those regions Liu et al. (2002), Remijan et al. (2004). The goal of this work is to study experimentally photoionization and photodissociation processes of glycine precursor molecules, acetic acid and formic acid to elucidate a possible preferentially in the glycine synthesis between ice and gas phase. The measurements were taken at the Brazilian Synchrotron Light Laboratory (LNLS), employing soft X-ray photons from a toroidal grating monochromator TGM) beamline (100 - 310 eV). The experimental set up consists of a high vacuum chamber with a Time-Of-Flight Mass Spectrometer (TOF-MS). Mass spectra were obtained using PhotoElectron PhotoIon Coincidence (PEPICO) technique. Kinetic energy distributions and abundances for each ionic fragment have been obtained from the analysis of the corresponding peak shapes in the mass spectra. Dissociative and non-dissociative photoionization cross sections for both molecules were also determined Boechat-Roberty, Pilling & Santos (2005). Due to the high photodissociation cross section of formic acid it is possible that in PDRs regions, just after molecules evaporation from the grains surface, it is almost destructed by soft X-rays, justifying the observed low abundance of HCOOH in gaseous phase Ehrenfreund et al. (2001). Acetic acid have shown to be more stable to the ionizing field, and its main outcomes from dissociation process were the reactive ionic fragments COOH+ and CH3CO+. To

  14. Introduction of the rd29A: AtDREB2A CA gene into soybean (Glycine max L. Merril and its molecular characterization in leaves and roots during dehydration

    Directory of Open Access Journals (Sweden)

    Cibelle Engels

    2013-01-01

    Full Text Available The loss of soybean yield to Brazilian producers because of a water deficit in the 2011-2012 season was 12.9%. To reduce such losses, molecular biology techniques, including plant transformation, can be used to insert genes of interest into conventional soybean cultivars to produce lines that are more tolerant to drought. The abscisic acid (ABA-independent Dehydration Responsive Element Binding (DREB gene family has been used to obtain plants with increased tolerance to abiotic stresses. In the present study, the rd29A:AtDREB2A CA gene from Arabidopsis thaliana was inserted into soybean using biolistics. Seventy-eight genetically modified (GM soybean lines containing 2-17 copies of the AtDREB2A CA gene were produced. Two GM soybean lines (P1397 and P2193 were analyzed to assess the differential expression of the AtDREB2A CA transgene in leaves and roots submitted to various dehydration treatments. Both GM lines exhibited high expression of the transgene, with the roots of P2193 showing the highest expression levels during water deficit. Physiological parameters examined during water deficit confirmed the induction of stress. This analysis of AtDREB2A CA expression in GM soybean indicated that line P2193 had the greatest stability and highest expression in roots during water deficit-induced stress.

  15. A DFT study of adsorption of glycine onto the surface of BC{sub 2}N nanotube

    Energy Technology Data Exchange (ETDEWEB)

    Soltani, Alireza, E-mail: Alireza.soltani46@yahoo.com [Joints, Bones and Connective Tissue Research Center, Golestan University of Medical Sciences, Gorgan (Iran, Islamic Republic of); Young Researchers and Elite Club, Gorgan Branch, Islamic Azad University, Gorgan (Iran, Islamic Republic of); Azmoodeh, Zivar [Department of Physics, Payame Noor University, P.O. Box 19395-3697, Tehran (Iran, Islamic Republic of); Javan, Masoud Bezi [Physics Department, Faculty of Sciences, Golestan University, Gorgan (Iran, Islamic Republic of); Lemeski, E. Tazikeh [Department of Chemistry, Gorgan Branch, Islamic Azad University, Gorgan (Iran, Islamic Republic of); Karami, Leila [Institute of Biochemistry and Biophysics, University of Tehran, Tehran (Iran, Islamic Republic of)

    2016-10-30

    Highlights: • Glycine adsorption over the pristine BC{sub 2}N nanotubes is investigated by DFT calculations. • Adsorption of glycine in its zwitterionic form is stronger in comparison with the radical form. • Adsorption of glycine from its amine head on adsorbent leads to a significant decrease in the electronic properties. - Abstract: A theoretical study of structure and the energy interaction of amino acid glycine (NH{sub 2}CH{sub 2}COOH) with BC{sub 2}N nanotube is crucial for apperception behavior occurring at the nanobiointerface. Herein, we studied the adsorption of glycine in their radical and zwitterionic forms upon the surface of BC{sub 2}N nanotube using M06 functional and 6-311G** standard basis set. We also considered the different orientations of the glycine amino acid on the surface of adsorbent. Further, we found out that the stability of glycine from its carbonyl group is higher than hydroxyl and amine groups. Our results also indicated that the electronic structure of BC{sub 2}N nanotube on the adsorption of glycine from its amine group is more altered than the other groups. Our study exhibits that opto-electronic property of adsorbent is changed after the glycine adsorption.

  16. Effects of glycine on motor performance in rats after traumatic spinal cord injury.

    Science.gov (United States)

    Gonzalez-Piña, Rigoberto; Nuño-Licona, Alberto

    2007-01-01

    It has been reported that glycine improves some functions lost after spinal cord injury (SCI). In order to assess the effects of glycine administration on motor performance after SCI, we used fifteen male Wistar rats distributed into three groups: sham (n = 3), spinal-cord injury (n = 6,) and spinal cord injury + glycine (n = 6). Motor performance was assessed using the beam-walking paradigm and footprint analysis. Results showed that for all animals with spinal-cord injury, scores in the beam-walking increased, which is an indication of increased motor deficit. In addition, footprint analysis showed a decrease in stride length and an increase in stride angle, additional indicators of motor deficit. These effects trended towards recovery after 8 weeks of recording and trended toward improvement by glycine administration; the effect was not significant. These results suggest that glycine replacement alone is not sufficient to improve the motor deficits that occur after SCI.

  17. Activation of synaptic and extrasynaptic glycine receptors by taurine in preoptic hypothalamic neurons.

    Science.gov (United States)

    Bhattarai, Janardhan Prasad; Park, Soo Joung; Chun, Sang Woo; Cho, Dong Hyu; Han, Seong Kyu

    2015-11-03

    Taurine is an essential amino-sulfonic acid having a fundamental function in the brain, participating in both cell volume regulation and neurotransmission. Using a whole cell voltage patch clamp technique, the taurine-activated neurotransmitter receptors in the preoptic hypothalamic area (PHA) neurons were investigated. In the first set of experiments, different concentrations of taurine were applied on PHA neurons. Taurine-induced responses were concentration-dependent. Taurine-induced currents were action potential-independent and sensitive to strychnine, suggesting the involvement of glycine receptors. In addition, taurine activated not only α-homomeric, but also αβ-heteromeric glycine receptors in PHA neurons. Interestingly, a low concentration of taurine (0.5mM) activated glycine receptors, whereas a higher concentration (3mM) activated both glycine and gamma-aminobutyric acid A (GABAA) receptors in PHA neurons. These results suggest that PHA neurons are influenced by taurine and respond via glycine and GABAA receptors. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  18. Glycine receptor: light microscopic autoradiographic localization with [3H]strychnine

    International Nuclear Information System (INIS)

    Zarbin, M.A.; Wamsley, J.K.; Kuhar, M.J.

    1981-01-01

    Glycine receptors have been localized by autoradiography in the rat central nervous system (CNS) using [ 3 H]strychnine. The gross distribution of receptors is in excellent accord with the distribution determined by filtration binding assays. Specifically, the density of glycine receptors is greatest in the gray matter of the spinal cord and decreases progressively in regions more rostral in the neuraxis. Glycine receptors were found to be associated with both sensory and motor systems in the CNS. Moreover, there is a striking correlation between areas of high strychnine binding site density and areas in which glycine has been found to be electrophysiologically active. Finally, the anatomic localization of strychnine binding sites may help explain many of the signs and symptoms of strychnine ingestion. For example, individuals consuming subconvulsive doses of strychnine frequently experience altered cutaneous and auditory sensation. We have localized strychnine receptors in areas of the acoustic system known to influence discriminative aspects of audition and in areas of the spinal cord and trigeminal nuclei which modulate discriminative aspects of cutaneous sensation. The alteration of visceral functions (e.g., blood pressure and respiratory rate) associated with strychnine ingestion may be accounted for in a similar manner

  19. Affinity of hydroxyapatite for furfural and a brown pigment formed by furfural and glycine.

    Science.gov (United States)

    Nordbö, H; Eriksen, H M; Rölla, G

    1979-10-01

    The affinity of hydroxyapatite for furfural and a brown pigment formed by furfural and glycine was studied. A series of mixtures containing 1 M furfural and 0.25-2.0 M glycine were incubated at 37 degrees C and aliquots of hydroxyapatite added. The apatite showed a strong affinity for the brown pigment formed, and an excess of glycine in the mixtures appeared to enhance the binding. The adsorption of furfural to hydroxyapatite was estimated by a spectrophotometric method. The data revealed that pretreatment with CaCl2 and glycine significantly increased the adsorption of furfural.

  20. German science. Max Planck charts new path.

    Science.gov (United States)

    Koenig, R

    2000-06-09

    Germany's premier basic research organization, the Max Planck Society, released a long-awaited blueprint for change during its annual meeting this week, recommending that the society's nearly 3000 scientists embrace more interdisciplinary and international projects in a range of new research priorities. The report, called Max Planck 2000-Plus, is the product of an 18-month-long internal review. Its recommendations were formulated by some two dozen Max Planck researchers and administrators, who sought input from every institute.

  1. 4-Chloropropofol enhances chloride currents in human hyperekplexic and artificial mutated glycine receptors

    Directory of Open Access Journals (Sweden)

    de la Roche Jeanne

    2012-09-01

    Full Text Available Abstract Background The mammalian neurological disorder hereditary hyperekplexia can be attributed to various mutations of strychnine sensitive glycine receptors. The clinical symptoms of “startle disease” predominantly occur in the newborn leading to convulsive hypertonia and an exaggerated startle response to unexpected mild stimuli. Amongst others, point mutations R271Q and R271L in the α1-subunit of strychnine sensitive glycine receptors show reduced glycine sensitivity and cause the clinical symptoms of hyperekplexia. Halogenation has been shown to be a crucial structural determinant for the potency of a phenolic compound to positively modulate glycine receptor function. The aim of this in vitro study was to characterize the effects of 4-chloropropofol (4-chloro-2,6-dimethylphenol at four glycine receptor mutations. Methods Glycine receptor subunits were expressed in HEK 293 cells and experiments were performed using the whole-cell patch-clamp technique. Results 4-chloropropofol exerted a positive allosteric modulatory effect in a low sub-nanomolar concentration range at the wild type receptor (EC50 value of 0.08 ± 0.02 nM and in a micromolar concentration range at the mutations (1.3 ± 0.6 μM, 0.1 ± 0.2 μM, 6.0 ± 2.3 μM and 55 ± 28 μM for R271Q, L, K and S267I, respectively. Conclusions 4-chloropropofol might be an effective compound for the activation of mutated glycine receptors in experimental models of startle disease.

  2. Investigations on the nucleation kinetics of γ-glycine single crystal

    International Nuclear Information System (INIS)

    Yogambal, C.; Rajan Babu, D.; Ezhil Vizhi, R.

    2014-01-01

    Single crystals of γ-glycine were grown by slow evaporation technique. The crystalline system was confirmed by single crystal X-ray diffraction analysis. The optical absorption study has shown that the grown crystal possesses lower cut-off wavelength. Solubility and metastable zone width were estimated for different temperatures. The induction period of title compound was determined by varying the temperature and concentration. Nucleation parameters such as Gibbs volume free energy change (ΔG v ), interfacial tension (γ), critical free energy change of the nucleus (ΔG ⁎ ), nucleation rate (J), number of molecules in the critical nucleus (i ⁎ ) have been calculated for the aqueous solution grown γ-glycine single crystals. The second harmonic generation (SHG) of γ-glycine was confirmed by Q-switched Nd:YAG laser technique

  3. Removal of brownish-black tarnish on silver–copper alloy objects with sodium glycinate

    Energy Technology Data Exchange (ETDEWEB)

    Cura D’Ars de Figueiredo, João, E-mail: joaoc@ufmg.br; Asevedo, Samara Santos, E-mail: samaranix@hotmail.com; Barbosa, João Henrique Ribeiro, E-mail: joaohrb@yahoo.com.br

    2014-10-30

    Highlights: • The use of glycinate to remove brownish-black tarnish on silver–copper alloy objects is studied. • The method is easy to use and harmless. It is based in the coordination of Ag and Cu in tarnish with glycinate. • The surface of corroded silver objects and products of reaction were studied and glycinate showed to be very selective for Ag(I) and Cu(II). The selectivity for Ag(I) was studied by means of quantum chemical calculations. - Abstract: This article has the principal aim of presenting a new method of chemical cleaning of tarnished silver–copper alloy objects. The chemical cleaning must be harmless to the health, selective to tarnish removal, and easy to use. Sodium glycinate was selected for the study. The reactions of sodium glycinate with tarnish and the silver–copper alloy were evaluated. Products of the reaction, the lixiviated material, and the esthetics of silver–copper alloy coins (used as prototypes) were studied to evaluate if the proposed method can be applied to the cleaning of silver objects. Silver–copper alloys can be deteriorated through a uniform and superficial corrosion process that produces brownish-black tarnish. This tarnish alters the esthetic of the object. The cleaning of artistic and archeological objects requires more caution than regular cleaning, and it must take into account the procedures for the conservation and restoration of cultural heritage. There are different methods for cleaning silver–copper alloy objects, chemical cleaning is one of them. We studied two chemical cleaning methods that use sodium glycinate and sodium acetylglycinate solutions. Silver–copper alloy coins were artificially corroded in a basic thiourea solution and immersed in solutions of sodium glycinate and sodium acetylglycinate. After immersion, optical microscopy and scanning electron microscopy of the surfaces were studied. The sodium glycinate solution was shown to be very efficient in removing the brownish

  4. Removal of brownish-black tarnish on silver–copper alloy objects with sodium glycinate

    International Nuclear Information System (INIS)

    Cura D’Ars de Figueiredo, João; Asevedo, Samara Santos; Barbosa, João Henrique Ribeiro

    2014-01-01

    Highlights: • The use of glycinate to remove brownish-black tarnish on silver–copper alloy objects is studied. • The method is easy to use and harmless. It is based in the coordination of Ag and Cu in tarnish with glycinate. • The surface of corroded silver objects and products of reaction were studied and glycinate showed to be very selective for Ag(I) and Cu(II). The selectivity for Ag(I) was studied by means of quantum chemical calculations. - Abstract: This article has the principal aim of presenting a new method of chemical cleaning of tarnished silver–copper alloy objects. The chemical cleaning must be harmless to the health, selective to tarnish removal, and easy to use. Sodium glycinate was selected for the study. The reactions of sodium glycinate with tarnish and the silver–copper alloy were evaluated. Products of the reaction, the lixiviated material, and the esthetics of silver–copper alloy coins (used as prototypes) were studied to evaluate if the proposed method can be applied to the cleaning of silver objects. Silver–copper alloys can be deteriorated through a uniform and superficial corrosion process that produces brownish-black tarnish. This tarnish alters the esthetic of the object. The cleaning of artistic and archeological objects requires more caution than regular cleaning, and it must take into account the procedures for the conservation and restoration of cultural heritage. There are different methods for cleaning silver–copper alloy objects, chemical cleaning is one of them. We studied two chemical cleaning methods that use sodium glycinate and sodium acetylglycinate solutions. Silver–copper alloy coins were artificially corroded in a basic thiourea solution and immersed in solutions of sodium glycinate and sodium acetylglycinate. After immersion, optical microscopy and scanning electron microscopy of the surfaces were studied. The sodium glycinate solution was shown to be very efficient in removing the brownish

  5. Soybean (Glycine max L.) N-Turnover Effects on Sustainable Agriculture

    Science.gov (United States)

    László, Márton, ,, Dr.

    2010-05-01

    on account of its exceptional food value. Nowadays of planted area, it comes fifth after wheat, rice, maize and barley. World soya production is twice as great as that of all other grain legumes. It is a legume able to fix the atmospheric nitrogen it needs for growth through the agency of specific (Rhisobium japonicum) bacteria (Haberlandt 1878, Kurnik et al. 1987, Bódis et al. 1988). Soya is an exelent preparatory crop. It improves soil structure, it leaves considerable residues of nitrogen for the following crop (Walter et al. 1970, Marcus-Wuner 1983, Márton et al. 1990, Németh 1995): it is a first-class entry for winter wheat. It is harvested in good time to allow cultivations for winter wheat and also leaves the ground in good condition for direct drilling. It is a good break crop in cereal rotations, limiting the build-up of fungal diseases. Soya is a reliable crop, tolerant of temporary water excess, more tolerant of cold than sorghum at shooting and flowering and it is more drought resistant than maize. Soya is demanding crop and responds well to physical and chemical soil improvement. The grain of present-day varieties contains on average 40-43 % protein and 21 % oil in dry matter. The various uses for soybeans can be summarised thus: a; whole grain, ground or unground after cooking, for human and animal foods, b; oil in human nutrition, c; special oilseed cakes for human diet (low-fat flour) and on a larger scale, for animal nutrition as a complement to forages and cereals. In the subject of much soybean research has been to find means of improving yields (Norman 1963, Walter et al. 1970, Caldwell 1973, Hinson and Hartwig 1977, Mengel and Kirkby 1982, Marcus-Wuner 1983, Márton et al. 1990, Németh 1995). Among the means for yield improvement fertilizers (nitrogen) occupy a prime position. The nitrogen is indispensable to the plant, being a yield and an essential constituent of amino acids, proteins and nucleic acids (Fauconnier 1986). Soya uses some 300

  6. ELA-max: A new topical lidocaine formulation.

    Science.gov (United States)

    Goldman, Ran D

    2004-05-01

    To evaluate the role of a new formulation of lidocaine (ELA-max) in local anesthesia in children and compare it with the eutectic mixture of local anesthetics (EMLA). Relevant literature was identified by a MEDLINE search (1966-November 2003) using the search terms ELA-max and EMLA. Bibliographies of selected articles were also examined to include all relevant investigations. The product manufacturer was contacted for inclusion of the most recent data available. Topical anesthesia in children is clinically challenging. ELA-max has been shown to be as effective as EMLA for venipuncture in children, but with faster onset. Adverse effects, such as transient blanching with redness and erythema, have been reported. Further investigation is needed to determine the effectiveness of ELA-max on other painful procedures in children, as well as its safety.

  7. Glycine regulates the production of pro-inflammatory cytokines in lean and monosodium glutamate-obese mice.

    Science.gov (United States)

    Alarcon-Aguilar, F J; Almanza-Perez, Julio; Blancas, Gerardo; Angeles, Selene; Garcia-Macedo, Rebeca; Roman, Ruben; Cruz, Miguel

    2008-12-03

    Fat tissue plays an important role in the regulation of inflammatory processes. Increased visceral fat has been associated with a higher production of cytokines that triggers a low-grade inflammatory response, which eventually may contribute to the development of insulin resistance. In the present study, we investigated whether glycine, an amino acid that represses the expression in vitro of pro-inflammatory cytokines in Kupffer and 3T3-L1 cells, can affect in vivo cytokine production in lean and monosodium glutamate-induced obese mice (MSG/Ob mice). Our data demonstrate that glycine treatment in lean mice suppressed TNF-alpha transcriptional expression in fat tissue, and serum protein levels of IL-6 were suppressed, while adiponectin levels were increased. In MSG/Ob mice, glycine suppressed TNF-alpha and IL-6 gene expression in fat tissue and significantly reduced protein levels of IL-6, resistin and leptin. To determine the role of peroxisome proliferator-activated receptor-gamma (PPAR-gamma) in the modulation of this inflammatory response evoked by glycine, we examined its expression levels in fat tissue. Glycine clearly increased PPAR-gamma expression in lean mice but not in MSG/Ob mice. Finally, to identify alterations in glucose metabolism by glycine, we also examined insulin levels and other biochemical parameters during an oral glucose tolerance test. Glycine significantly reduced glucose tolerance and raised insulin levels in lean but not in obese mice. In conclusion, our findings suggest that glycine suppresses the pro-inflammatory cytokines production and increases adiponectin secretion in vivo through the activation of PPAR-gamma. Glycine might prevent insulin resistance and associated inflammatory diseases.

  8. Exact simulation of max-stable processes.

    Science.gov (United States)

    Dombry, Clément; Engelke, Sebastian; Oesting, Marco

    2016-06-01

    Max-stable processes play an important role as models for spatial extreme events. Their complex structure as the pointwise maximum over an infinite number of random functions makes their simulation difficult. Algorithms based on finite approximations are often inexact and computationally inefficient. We present a new algorithm for exact simulation of a max-stable process at a finite number of locations. It relies on the idea of simulating only the extremal functions, that is, those functions in the construction of a max-stable process that effectively contribute to the pointwise maximum. We further generalize the algorithm by Dieker & Mikosch (2015) for Brown-Resnick processes and use it for exact simulation via the spectral measure. We study the complexity of both algorithms, prove that our new approach via extremal functions is always more efficient, and provide closed-form expressions for their implementation that cover most popular models for max-stable processes and multivariate extreme value distributions. For simulation on dense grids, an adaptive design of the extremal function algorithm is proposed.

  9. Stereospecific assignments of glycine in proteins by stereospecific deuteration and {sup 15}N labeling

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, A.P.; Curley, R.W. Jr.; Panigot, M.J.; Fesik, S.W. [Ohio State Univ., Columbus, OH (United States)

    1994-12-01

    Stereospecific assignments are important for accurately determining the three-dimensional structures of proteins through the use of multidimensional NMR techniques. It is especially important to stereospecifically assign the glycine {alpha}-protons in proteins because of the potential for different backbone conformations of this residue. These stereospecific assignments are critical for interpreting the {sup 3}J{sub NH,{alpha}H} coupling constants and NOEs involving the glycine {alpha}-protons that determine the conformation of this part of the protein. However, it is often difficult to unambiguously obtain the stereospecific assignments for glycine residues by using only NOE data. In this poster, we present a method for unambiguous, stereospecific assignment of the {alpha}-protons of glycine residues. This method involves synthesis of stereo-specifically deuterated and {sup 15}N-labeled Gly using a slightly modified procedure originally described by Woodard and coworkers for the stereoselective deuteration of glycine. The stereospecifically deuterated and {sup 15}N-labeled Gy has been incorporated into recombinant proteins expressed in both bacterial systems (FKBP) and mammalian cells (u-PA). Two- and three-dimensional isotope-filtered and isotope-edited NMR experiments were used to obtain the stereospecific assignments of the glycine {alpha}-protons for these proteins.

  10. Differentiated human midbrain-derived neural progenitor cells express excitatory strychnine-sensitive glycine receptors containing α2β subunits.

    Directory of Open Access Journals (Sweden)

    Florian Wegner

    Full Text Available BACKGROUND: Human fetal midbrain-derived neural progenitor cells (NPCs may deliver a tissue source for drug screening and regenerative cell therapy to treat Parkinson's disease. While glutamate and GABA(A receptors play an important role in neurogenesis, the involvement of glycine receptors during human neurogenesis and dopaminergic differentiation as well as their molecular and functional characteristics in NPCs are largely unknown. METHODOLOGY/PRINCIPAL FINDINGS: Here we investigated NPCs in respect to their glycine receptor function and subunit expression using electrophysiology, calcium imaging, immunocytochemistry, and quantitative real-time PCR. Whole-cell recordings demonstrate the ability of NPCs to express functional strychnine-sensitive glycine receptors after differentiation for 3 weeks in vitro. Pharmacological and molecular analyses indicate a predominance of glycine receptor heteromers containing α2β subunits. Intracellular calcium measurements of differentiated NPCs suggest that glycine evokes depolarisations mediated by strychnine-sensitive glycine receptors and not by D-serine-sensitive excitatory glycine receptors. Culturing NPCs with additional glycine, the glycine-receptor antagonist strychnine, or the Na(+-K(+-Cl(- co-transporter 1 (NKCC1-inhibitor bumetanide did not significantly influence cell proliferation and differentiation in vitro. CONCLUSIONS/SIGNIFICANCE: These data indicate that NPCs derived from human fetal midbrain tissue acquire essential glycine receptor properties during neuronal maturation. However, glycine receptors seem to have a limited functional impact on neurogenesis and dopaminergic differentiation of NPCs in vitro.

  11. Medicaid Analytic eXtract (MAX) General Information

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Medicaid Analytic eXtract (MAX) data is a set of person-level data files on Medicaid eligibility, service utilization, and payments. The MAX data are created to...

  12. Interactions of Heterodera glycines, Macrophomina phaseolina, and Mycorrhizal Fungi on Soybean in Kansas.

    Science.gov (United States)

    Winkler, H E; Hetrick, B A; Todd, T C

    1994-12-01

    The impact of naturally occurring arbuscular mycorrhizal fungi on soybean growth and their interaction with Heterodera glycines were evaluated in nematode-infested and uninfested fields in Kansas. Ten soybean cultivars from Maturity Groups III-V with differential susceptibility to H. glycines were treated with the fungicide benomyl to suppress colonization by naturally occurring mycorrhizal fungi and compared with untreated control plots. In H. glycines-infested soil, susceptible cultivars exhibited 39% lower yields, 28% lower colonization by mycorrhizal fungi, and an eightfold increase in colonization by the charcoal rot fungus, Macrophomina phaseolina, compared with resistant cultivars. In the absence of the nematode, susceptible cultivars exhibited 10% lower yields than resistant cultivars, root colonization of resistant vs. susceptible soybean by mycorrhizal fungi varied with sampling date, and there were no differences in colonization by M. phaseolina between resistant and susceptible cultivars. Benomyl application resulted in 19% greater root growth and 9% higher seed yields in H. glycines-infested soil, but did not affect soybean growth and yield in the absence of the nematode. Colonization of soybean roots by mycorrhizal fungi was negatively correlated with H. glycines population densities due to nematode antagonism to the mycorrhizal fungi rather than suppression of nematode populations. Soybean yields were a function of the pathogenic effects of H. glycines and M. phaseolina, and, to a lesser degree, the stimulatory effects of mycorrhizal fungi.

  13. Max Jakobson õiendab arveid ajalooga / Imbi Paju

    Index Scriptorium Estoniae

    Paju, Imbi, 1959-

    2003-01-01

    Soome politoloogi ja diplomaadi Max Jakobsoni raamatust "Tilinpäätos" ("Arve sulgemine"), milles ta käsitleb Eesti ja Soome suhteid 20. sajandil. Vt samas: Lennart Meri meelitas Jakobsoni sõjakuritegusid uurima; lühiintervjuu Max Jakobsoniga

  14. Veteranpoliitik Max Jakobson õpetab ajalugu / Sirje Kiin

    Index Scriptorium Estoniae

    Kiin, Sirje, 1949-

    1998-01-01

    Soome sõltumatu välispoliitika konsultant ja ajakirjanik Max Jakobson. Ülevaade Max Jakobsoni intervjuust soomerootsi majandusajakirjale "Forum för ekonomi och teknik" 1998. aasta aprillinumbris Venemaa Baltimaade-vastasest propagandast ning EL-i ja NATO laienemisest

  15. Aspectos Bionômicos de Spodoptera eridania (Cramer: Uma Praga em Expansão na Cultura da Soja na Região do Cerrado Brasileiro

    Directory of Open Access Journals (Sweden)

    Bruno Sardinha de Souza

    2014-08-01

    Abstract. Soybean, Glycine max (L. Merril, represents one of the major economically important crops to Brazil, and is considered a national commodity because of its high yield and participation in international trade exportations. Among the insect pests that cause damage to this crop, Spodoptera eridania (Cramer larvae highlighted in the last agricultural seasons by feeding on leaves and pods of soybean plants, and hence causing economical losses to soybean growers, especially in the Cerrado areas located in the Midwest region of the country. We aimed with this review to provide information about bionomical aspects of S. eridania in order to give subsides for further researches on the management of this pest.

  16. Max Planck and modern physics

    International Nuclear Information System (INIS)

    Hoffmann, Dieter

    2010-01-01

    Max Planck (1858-1947) is according to the words of Max von Laue the ''father of quantum physics''. This characteristic has until today continuance, although Planck stood for long time sceptically in front of his quantum hypothesis and so became a revolutionary in spite of his wishes. Eclipted by this pioneer role of the scholar for the foundation of the quantum theory are the numerous further works of the scholer, by which he has in many other fields provided eminent things. Starting with his fundamental contribution to thermodynamics, which make him to an excellent researcher of the field, until the works in the early history of relativity theory and the promotion of the young Einstein, which let him become also to a pioneer of the second central pillar of modern physics. The present collection attempts to show the whole spectrum of the physical works of Max Planck and his role in the formation of modern physics. [de

  17. Exogenous Glycine Nitrogen Enhances Accumulation of Glycosylated Flavonoids and Antioxidant Activity in Lettuce (Lactuca sativa L.

    Directory of Open Access Journals (Sweden)

    Xiao Yang

    2017-12-01

    Full Text Available Glycine, the simplest amino acid in nature and one of the most abundant free amino acids in soil, is regarded as a model nutrient in organic nitrogen studies. To date, many studies have focused on the uptake, metabolism and distribution of organic nitrogen in plants, but few have investigated the nutritional performance of plants supplied with organic nitrogen. Lettuce (Lactuca sativa L., one of the most widely consumed leafy vegetables worldwide, is a significant source of antioxidants and bioactive compounds such as polyphenols, ascorbic acid and tocopherols. In this study, two lettuce cultivars, Shenxuan 1 and Lollo Rossa, were hydroponically cultured in media containing 4.5, 9, or 18 mM glycine or 9 mM nitrate (control for 4 weeks, and the levels of health-promoting compounds and antioxidant activity of the lettuce leaf extracts were evaluated. Glycine significantly reduced fresh weight compared to control lettuce, while 9 mM glycine significantly increased fresh weight compared to 4.5 or 18 mM glycine. Compared to controls, glycine (18 mM for Shenxuan 1; 9 mM for Lollo Rossa significantly increased the levels of most antioxidants (including total polyphenols, α-tocopherol and antioxidant activity, suggesting appropriate glycine supply promotes antioxidant accumulation and activity. Glycine induced most glycosylated quercetin derivatives and luteolin derivatives detected and decreased some phenolic acids compared to nitrate treatment. This study indicates exogenous glycine supplementation could be used strategically to promote the accumulation of health-promoting compounds and antioxidant activity of hydroponically grown lettuce, which could potentially improve human nutrition.

  18. Exogenous Glycine Nitrogen Enhances Accumulation of Glycosylated Flavonoids and Antioxidant Activity in Lettuce (Lactuca sativa L.).

    Science.gov (United States)

    Yang, Xiao; Cui, Xiaoxian; Zhao, Li; Guo, Doudou; Feng, Lei; Wei, Shiwei; Zhao, Chao; Huang, Danfeng

    2017-01-01

    Glycine, the simplest amino acid in nature and one of the most abundant free amino acids in soil, is regarded as a model nutrient in organic nitrogen studies. To date, many studies have focused on the uptake, metabolism and distribution of organic nitrogen in plants, but few have investigated the nutritional performance of plants supplied with organic nitrogen. Lettuce ( Lactuca sativa L.), one of the most widely consumed leafy vegetables worldwide, is a significant source of antioxidants and bioactive compounds such as polyphenols, ascorbic acid and tocopherols. In this study, two lettuce cultivars, Shenxuan 1 and Lollo Rossa, were hydroponically cultured in media containing 4.5, 9, or 18 mM glycine or 9 mM nitrate (control) for 4 weeks, and the levels of health-promoting compounds and antioxidant activity of the lettuce leaf extracts were evaluated. Glycine significantly reduced fresh weight compared to control lettuce, while 9 mM glycine significantly increased fresh weight compared to 4.5 or 18 mM glycine. Compared to controls, glycine (18 mM for Shenxuan 1; 9 mM for Lollo Rossa) significantly increased the levels of most antioxidants (including total polyphenols, α-tocopherol) and antioxidant activity, suggesting appropriate glycine supply promotes antioxidant accumulation and activity. Glycine induced most glycosylated quercetin derivatives and luteolin derivatives detected and decreased some phenolic acids compared to nitrate treatment. This study indicates exogenous glycine supplementation could be used strategically to promote the accumulation of health-promoting compounds and antioxidant activity of hydroponically grown lettuce, which could potentially improve human nutrition.

  19. Biological control of Heterodera glycines by spore-forming plant growth-promoting rhizobacteria (PGPR on soybean.

    Directory of Open Access Journals (Sweden)

    Ni Xiang

    Full Text Available Heterodera glycines, the soybean cyst nematode, is the most economically important plant-parasitic nematode on soybean production in the U.S. The objectives of this study were to evaluate the potential of plant growth-promoting rhizobacteria (PGPR strains for mortality of H. glycines J2 in vitro and for reducing nematode population density on soybean in greenhouse, microplot, and field trials. The major group causing mortality to H. glycines in vitro was the genus Bacillus that consisted of 92.6% of the total 663 PGPR strains evaluated. The subsequent greenhouse, microplot, and field trials indicated that B. velezensis strain Bve2 consistently reduced H. glycines cyst population density at 60 DAP. Bacillus mojavensis strain Bmo3 suppressed H. glycines cyst and total H. glycines population density under greenhouse conditions. Bacillus safensis strain Bsa27 and Mixture 1 (Bve2 + Bal13 reduced H. glycines cyst population density at 60 DAP in the field trials. Bacillus subtilis subsp. subtilis strains Bsssu2 and Bsssu3, and B. velezensis strain Bve12 increased early soybean growth including plant height and plant biomass in the greenhouse trials. Bacillus altitudinis strain Bal13 increased early plant growth on soybean in the greenhouse and microplot trials. Mixture 2 (Abamectin + Bve2 + Bal13 increased early plant growth in the microplot trials at 60 DAP, and also enhanced soybean yield at harvest in the field trials. These results demonstrated that individual PGPR strains and mixtures can reduce H. glycines population density in the greenhouse, microplot, and field conditions, and increased yield of soybean.

  20. Biological control of Heterodera glycines by spore-forming plant growth-promoting rhizobacteria (PGPR) on soybean.

    Science.gov (United States)

    Xiang, Ni; Lawrence, Kathy S; Kloepper, Joseph W; Donald, Patricia A; McInroy, John A

    2017-01-01

    Heterodera glycines, the soybean cyst nematode, is the most economically important plant-parasitic nematode on soybean production in the U.S. The objectives of this study were to evaluate the potential of plant growth-promoting rhizobacteria (PGPR) strains for mortality of H. glycines J2 in vitro and for reducing nematode population density on soybean in greenhouse, microplot, and field trials. The major group causing mortality to H. glycines in vitro was the genus Bacillus that consisted of 92.6% of the total 663 PGPR strains evaluated. The subsequent greenhouse, microplot, and field trials indicated that B. velezensis strain Bve2 consistently reduced H. glycines cyst population density at 60 DAP. Bacillus mojavensis strain Bmo3 suppressed H. glycines cyst and total H. glycines population density under greenhouse conditions. Bacillus safensis strain Bsa27 and Mixture 1 (Bve2 + Bal13) reduced H. glycines cyst population density at 60 DAP in the field trials. Bacillus subtilis subsp. subtilis strains Bsssu2 and Bsssu3, and B. velezensis strain Bve12 increased early soybean growth including plant height and plant biomass in the greenhouse trials. Bacillus altitudinis strain Bal13 increased early plant growth on soybean in the greenhouse and microplot trials. Mixture 2 (Abamectin + Bve2 + Bal13) increased early plant growth in the microplot trials at 60 DAP, and also enhanced soybean yield at harvest in the field trials. These results demonstrated that individual PGPR strains and mixtures can reduce H. glycines population density in the greenhouse, microplot, and field conditions, and increased yield of soybean.

  1. Deterministic algorithms for multi-criteria Max-TSP

    NARCIS (Netherlands)

    Manthey, Bodo

    2012-01-01

    We present deterministic approximation algorithms for the multi-criteria maximum traveling salesman problem (Max-TSP). Our algorithms are faster and simpler than the existing randomized algorithms. We devise algorithms for the symmetric and asymmetric multi-criteria Max-TSP that achieve ratios of

  2. Ligand-specific conformational changes in the alpha1 glycine receptor ligand-binding domain

    DEFF Research Database (Denmark)

    Pless, Stephan Alexander; Lynch, Joseph W

    2009-01-01

    , and by the antagonist, strychnine. Voltage-clamp fluorometry involves labeling introduced cysteines with environmentally sensitive fluorophores and inferring structural rearrangements from ligand-induced fluorescence changes. In the inner beta-sheet, we labeled residues in loop 2 and in binding domain loops D and E....... At each position, strychnine and glycine induced distinct maximal fluorescence responses. The pre-M1 domain responded similarly; at each of four labeled positions glycine produced a strong fluorescence signal, whereas strychnine did not. This suggests that glycine induces conformational changes...... in the inner beta-sheet and pre-M1 domain that may be important for activation, desensitization, or both. In contrast, most labeled residues in loops C and F yielded fluorescence changes identical in magnitude for glycine and strychnine. A notable exception was H201C in loop C. This labeled residue responded...

  3. Novel Approaches to Enhance Mobile WiMAX Security

    Directory of Open Access Journals (Sweden)

    Taeshik Shon

    2010-01-01

    Full Text Available The IEEE 802.16 Working Group on Broadband Wireless Access Standards released IEEE 802.16-2004 which is a standardized technology for supporting broadband and wireless communication with fixed and nomadic access. After the IEEE 802.16-2004 standard, a new advanced and revised standard was released as the IEEE 802.16e-2005 amendment which is foundation of Mobile WiMAX network supporting handover and roaming capabilities. In the area of security aspects, compared to IEEE 802.16-2004, IEEE 802.16e, called Mobile WiMAX, adopts improved security architecture—PKMv2 which includes EAP authentication, AES-based authenticated encryption, and CMAC or HMAC message protection. However, there is no guarantee that PKMv2-based Mobile WiMAX network will not have security flaws. In this paper, we investigate the current Mobile WiMAX security architecture focusing mainly on pointing out new security vulnerabilities such as a disclosure of security context in network entry, a lack of secure communication in network domain, and a necessity of efficient handover supporting mutual authentication. Based on the investigation results, we propose a novel Mobile WiMAX security architecture, called RObust and Secure MobilE WiMAX (ROSMEX, to prevent the new security vulnerabilities.

  4. Somatic embryogenesis in cell cultures of Glycine species.

    Science.gov (United States)

    Gamborg, O L; Davis, B P; Stahlhut, R W

    1983-08-01

    This report describes the development of procedures for the production of somatic embryos in cell cultures of Glycine species including soybean. The conditions for callus induction and initiation of rapidly growing cell suspension cultures were defined. Methods for inducing embryogenesis were tested on 16 lines of several Glycine species and cultivars of soybean. The SB-26 Culture of a G. soja gave the best results and was used in the experiments. Embryogenesis required the presence of picloram or 2,4-D. AMO 1618, CCC, PP-333 and Ancymidol enhanced the embryogenesis frequency. Plants of the G. soja (SB-26) were grown to maturity from seed-derived shoot tips. Characteristics of the plants are discussed.

  5. Improvements of ModalMax High-Fidelity Piezoelectric Audio Device

    Science.gov (United States)

    Woodard, Stanley E.

    2005-01-01

    ModalMax audio speakers have been enhanced by innovative means of tailoring the vibration response of thin piezoelectric plates to produce a high-fidelity audio response. The ModalMax audio speakers are 1 mm in thickness. The device completely supplants the need to have a separate driver and speaker cone. ModalMax speakers can perform the same applications of cone speakers, but unlike cone speakers, ModalMax speakers can function in harsh environments such as high humidity or extreme wetness. New design features allow the speakers to be completely submersed in salt water, making them well suited for maritime applications. The sound produced from the ModalMax audio speakers has sound spatial resolution that is readily discernable for headset users.

  6. WiMAX network performance monitoring & optimization

    DEFF Research Database (Denmark)

    Zhang, Qi; Dam, H

    2008-01-01

    frequency reuse, capacity planning, proper network dimensioning, multi-class data services and so on. Furthermore, as a small operator we also want to reduce the demand for sophisticated technicians and man labour hours. To meet these critical demands, we design a generic integrated network performance......In this paper we present our WiMAX (worldwide interoperability for microwave access) network performance monitoring and optimization solution. As a new and small WiMAX network operator, there are many demanding issues that we have to deal with, such as limited available frequency resource, tight...... this integrated network performance monitoring and optimization system in our WiMAX networks. This integrated monitoring and optimization system has such good flexibility and scalability that individual function component can be used by other operators with special needs and more advanced function components can...

  7. Effects of proton beam irradiation on seed germination and growth of soybean ( Glycine max L. Merr.)

    Science.gov (United States)

    Im, Juhyun; Kim, Woon Ji; Kim, Sang Hun; Ha, Bo-Keun

    2017-12-01

    The present study aimed to evaluate the morphological effects of proton beam irradiation on the seed germination, seedling survival, and plant growth of soybean. Seeds of three Korean elite cultivars (Kwangankong, Daepungkong, and Pungsannamulkong) were irradiated with a 57-MeV proton beam in the range of 50 - 400 Gy. The germination rates of all the varieties increased to > 95%; however, the survival rates were significantly reduced. At doses of > 300 Gy irradiation, the Daepungkong, Kwangankong, and Pungsannamulkong cultivars exhibited 39, 75, and 71% survival rates, respectively. In addition, plant height and the fresh weight of shoots and roots were significantly decreased by doses of > 100 Gy irradiation, as were the dry weights of the shoots and roots. However, SPAD values increased with increasing doses of irradiation. Abnormal plants with atypically branched stems, modified leaves, and chlorophyll mutations were observed. Based on the survival rate, plant growth inhibition, and mutation frequency, it appears that the optimum dosage of proton beam irradiation for soybean mutation breeding is between 250 and 300 Gy.

  8. Resolving the limitations of using glycine as EPR dosimeter in the intermediate level of gamma dose

    Science.gov (United States)

    Aboelezz, E.; Hassan, G. M.

    2018-04-01

    The dosimetric properties of the simplest amino acid "glycine"- using EPR technique- were investigated in comparison to reference standard alanine dosimeter. The EPR spectrum of glycine at room temperature is complex, but immediately after irradiation, it appears as a triplet hyperfine structure probably due to the dominant contribution of the (•CH2COO-) radical. The dosimetric peak of glycine is at g-factor 2.0026 ± 0.0015 and its line width is 9 G at large modulation amplitude (7 G). The optimum microwave was studied and was found to be as alanine 8 mW; the post-irradiation as well as the dose rate effects were discussed. Dosimetric peak intensity of glycine fades rapidly to be about one quarter of its original value during 20 days for dried samples and it stabilizes after that. The dose response study in an intermediate range (2-1000 Gy) reveals that the glycine SNR is about 2 times more than that of alanine pellets when measured immediately after irradiation and 4 times more than that of glycine itself after 22 days of irradiation. The effect of energy dependence was studied and interpreted theoretically by calculation of mass energy absorption coefficient. The calculated combined uncertainties for glycine and alanine are nearly the same and were found to be 2.42% and 2.33%, respectively. Glycine shows interesting dosimetric properties in the range of ionizing radiation doses investigated.

  9. Co-localization of glycine and gaba immunoreactivity in interneurons in Macaca monkey cerebellar cortex.

    Science.gov (United States)

    Crook, J; Hendrickson, A; Robinson, F R

    2006-09-15

    Previous work demonstrates that the cerebellum uses glycine as a fast inhibitory neurotransmitter [Ottersen OP, Davanger S, Storm-Mathisen J (1987) Glycine-like immunoreactivity in the cerebellum of rat and Senegalese baboon, Papio papio: a comparison with the distribution of GABA-like immunoreactivity and with [3H]glycine and [3H]GABA uptake. Exp Brain Res 66(1):211-221; Ottersen OP, Storm-Mathisen J, Somogyi P (1988) Colocalization of glycine-like and GABA-like immunoreactivities in Golgi cell terminals in the rat cerebellum: a postembedding light and electron microscopic study. Brain Res 450(1-2):342-353; Dieudonne S (1995) Glycinergic synaptic currents in Golgi cells of the rat cerebellum. Proc Natl Acad Sci U S A 92:1441-1445; Dumoulin A, Triller A, Dieudonne S (2001) IPSC kinetics at identified GABAergic and mixed GABAergic and glycinergic synapses onto cerebellar Golgi cells. J Neurosci 21(16):6045-6057; Dugue GP, Dumoulin A, Triller A, Dieudonne S (2005) Target-dependent use of coreleased inhibitory transmitters at central synapses. J Neurosci 25(28):6490-6498; Zeilhofer HU, Studler B, Arabadzisz D, Schweizer C, Ahmadi S, Layh B, Bosl MR, Fritschy JM (2005) Glycinergic neurons expressing enhanced green fluorescent protein in bacterial artificial chromosome transgenic mice. J Comp Neurol 482(2):123-141]. In the rat cerebellum glycine is not released by itself but is released together with GABA by Lugaro cells onto Golgi cells [Dumoulin A, Triller A, Dieudonne S (2001) IPSC kinetics at identified GABAergic and mixed GABAergic and glycinergic synapses onto cerebellar Golgi cells. J Neurosci 21(16):6045-6057] and by Golgi cells onto unipolar brush and granule cells [Dugue GP, Dumoulin A, Triller A, Dieudonne S (2005) Target-dependent use of coreleased inhibitory transmitters at central synapses. J Neurosci 25(28):6490-6498]. Here we report, from immunolabeling evidence in Macaca cerebellum, that interneurons in the granular cell layer are glycine+ at a density

  10. Synthesis of Nb-doped SrTiO3 by a modified glycine-nitrate process

    DEFF Research Database (Denmark)

    Blennow Tullmar, Peter; Kammer Hansen, Kent; Wallenberg, L.R.

    2007-01-01

    The objective of the present investigation was to develop a technique to synthesize submicronic particles of Nb-doped strontium titanate with a homogeneous composition. This was achieved by a modified glycine-nitrate process, using Ti-lactate, Nb-oxalate, and Sr(NO3)(2) as starting materials....... A combination of both citric acid and glycine was needed in order to integrate the useful features of both complexation and combustion natures of citric acid and glycine, respectively. The amount of citric acid, glycine, and nitrates in the starting solution, as well as the source for extra nitrates...

  11. Effect of amount of glycine as fuel in obtaining nanocomposite Ni/NiO

    International Nuclear Information System (INIS)

    Simoes, A.N.; Simoes, V.N.; Neiva, L.S.; Quirino, M.R.; Vieira, D.A.; Gama, L.

    2010-01-01

    This paper proposes to investigate the effect of the amount of glycine in obtaining nanocomposite Ni/NiO synthesized by combustion reaction technique. The amount of glycine used was calculated on the stoichiometric composition of 50% and 100%. Characterizations by X-ray diffraction (XRD), N2 adsorption by the BET method and scanning electron microscopy (SEM) were performed with powder of Ni/NiO result. The analysis of X-ray diffraction showed the presence of crystalline NiO phase in the presence of nickel as a secondary phase, whose amount increased with the amount of glycine. Increasing the concentration of glycine also caused an increase in surface area, which ranged from 1.1 to 1.4 m 2 /g. The micrographs revealed the formation of soft agglomerates with porous appearance and easy dispersions. It can be concluded that the synthesis is effective to obtain nanosized powders. (author)

  12. Protein (Viridiplantae): 147464 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ursor Glycine max MKKASAMHCALLRFWVPLLLLASFSFAPSVLAKAEISGNEVNTHGKVVSEELTKSSLKEQNEEEKFKGFFPKPIPIIKPISKPI...PIIKPIPKSIPIVKPIPIPVYKPISKPIPIVKPIPKPFLIVKPIPNDEEKFKGVFPKPIPIVKPIPKPIPIVKPIPIPIYKPIPKSVPIVKPIPIIKPILKPNPIVKPI...PKLIPIVKPIPNPLRVKKSIPAFGSEEFLKPKPFFEKPIPKLPLDPKFKKPLLPPLPIHKPIPTP

  13. Protein (Viridiplantae): 147466 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ursor Glycine max MRMRKQSTMQCALFRFWVPLLLLASFSYAPSVLATTEISGNQVNMDGKVVNEELGKPNLKGQDEEEKFKGLFPKPI...PIVKPFPKLIPIIKPIPKPIPVVKPIPIPLYKPFPKSIPIVKPIPKPIPNGKPIPTEEAKFKGFFPKPIPIVKPIPVAKPIPIVKPFPKLIPIIKPIPKPIPIVKPIPIPVYKPI...PKSIPIVKPIPNGKPIPTEEAKFKGFFLKPIPIVKPIPVAKSIPIVKPIPITVYKPITKSFPTVKPIPKPIPILKPIPKPISIVKPISKPFIVQKPIPAVEPEKFLKPKPFFKKPLPKFPLNPKFKKPLLPPFPIHKAIPTP

  14. Metabolism of L-leucine-U-14C in young rats fed excess glycine diets

    International Nuclear Information System (INIS)

    Takeuchi, Hisanao; Tadauchi, Nobuo; Muramatsu, Keiichiro

    1975-01-01

    As reported previously, while the growth-depressing effect of excess glycine was prevented by supplementing L-arginine and L-methionine, the degradation of glycine-U-(SUP 14)C into expired carbon dioxide was not accelerated by the supplement of both amino acids. However, it was found that the incorporation of the isotope into the lipids of livers and carcasses increased in the rats fed the excess glycine diet containing both amino acids. The lipid synthesis utilizing excess glycine may be accelerated by adding both amino acids to the 10% casein diet containing excess glycine. In the present experiment, the metabolic fate of L-leucine-U-(SUP 14)C was studied with the rats fed the excess glycine diet with or without L-arginine and L-methionine. 10% casein (10C), 10% casein diet containing 7% glycine (10C7G), or 10C7G Supplemented with 1.4% L-arginine-HCL and 0.9% L-methionine (10C7GArgMet) was fed to each rat, and the diet suspension containing 4 sup(μ)Ci of L-leucine-U-(SUP 14)C per 100 g of body weight was fed forcibly after 12 hr fast. The radioactivity in expired carbon dioxide, TCA soluble fraction, protein, glycogen, lipids and urine, and the concentration of free amino acids in blood plasma, livers and urine were measured. The body weight gain and food intake of the 10C7G group were much smaller than those of the other groups. The recovery of (SUP 14)C-radioactivity in expired carbon dioxide was much lower in the 10C7GArgMet group than that of the other groups. (Kako, I.)

  15. Mechanism of action of the insecticides, lindane and fipronil, on glycine receptor chloride channels.

    Science.gov (United States)

    Islam, Robiul; Lynch, Joseph W

    2012-04-01

    Docking studies predict that the insecticides, lindane and fipronil, block GABA(A) receptors by binding to 6' pore-lining residues. However, this has never been tested at any Cys-loop receptor. The neurotoxic effects of these insecticides are also thought to be mediated by GABA(A) receptors, although a recent morphological study suggested glycine receptors mediated fipronil toxicity in zebrafish. Here we investigated whether human α1, α1β, α2 and α3 glycine receptors were sufficiently sensitive to block by either compound as to represent possible neurotoxicity targets. We also investigated the mechanisms by which lindane and fipronil inhibit α1 glycine receptors. Glycine receptors were recombinantly expressed in HEK293 cells and insecticide effects were studied using patch-clamp electrophysiology. Both compounds completely inhibited all tested glycine receptor subtypes with IC(50) values ranging from 0.2-2 µM, similar to their potencies at vertebrate GABA(A) receptors. Consistent with molecular docking predictions, both lindane and fipronil interacted with 6' threonine residues via hydrophobic interactions and hydrogen bonds. In contrast with predictions, we found no evidence for lindane interacting at the 2' level. We present evidence for fipronil binding in a non-blocking mode in the anaesthetic binding pocket, and for lindane as an excellent pharmacological tool for identifying the presence of β subunits in αβ heteromeric glycine receptors. This study implicates glycine receptors as novel vertebrate toxicity targets for fipronil and lindane. Furthermore, lindane interacted with pore-lining 6' threonine residues, whereas fipronil may have both pore and non-pore binding sites. © 2011 The Authors. British Journal of Pharmacology © 2011 The British Pharmacological Society.

  16. [3H]CGP 61594, the first photoaffinity ligand for the glycine site of NMDA receptors

    International Nuclear Information System (INIS)

    Benke, D.; Honer, M.; Mohler, H.; Heckendorn, R.; Pozza, M.F.; Allgeier, H.; Angst, C.

    1999-01-01

    Activation of NMDA receptors requires the presence of glycine as a coagonist which binds to a site that is allosterically linked to the glutamate binding site. To identify the protein constituents of the glycine binding site in situ the photoaffinity label [ 3 H]CGP 61594 was synthesized. In reversible binding assays using crude rat brain membranes, [ 3 H]CGP 61594 labeled with high affinity (K D =23 nM) the glycine site of the NMDA receptor. This was evident from the Scatchard analysis, the displacing potencies of various glycine site ligands and the allosteric modulation of [ 3 H]CGP 61594 binding by ligands of the glutamate and polyamine sites. Electrophysiological experiments in a neocortical slice preparation identified CGP 61594 as a glycine antagonist. Upon UV-irradiation, a protein band of 115 kDa was specifically photolabeled by [ 3 H]CGP 61594 in brain membrane preparations. The photolabeled protein was identified as the NR1 subunit of the NMDA receptor by NR1 subunit-specific immunoaffinity chromatography. Thus, [ 3 H]CGP 61594 is the first photoaffinity label for the glycine site of NMDA receptors. It will serve as a tool for the identification of structural elements that are involved in the formation of the glycine binding domain of NMDA receptors in situ and will thereby complement the mutational analysis of recombinant receptors. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  17. The lipoxygenase gene family: a genomic fossil of shared polyploidy between Glycine max and Medicago truncatula

    Directory of Open Access Journals (Sweden)

    Choi Beom-Soon

    2008-12-01

    Full Text Available Abstract Background Soybean lipoxygenases (Lxs play important roles in plant resistance and in conferring the distinct bean flavor. Lxs comprise a multi-gene family that includes GmLx1, GmLx2 and GmLx3, and many of these genes have been characterized. We were interested in investigating the relationship between the soybean lipoxygenase isozymes from an evolutionary perspective, since soybean has undergone two rounds of polyploidy. Here we report the tetrad genome structure of soybean Lx regions produced by ancient and recent polyploidy. Also, comparative genomics with Medicago truncatula was performed to estimate Lxs in the common ancestor of soybean and Medicago. Results Two Lx regions in Medicago truncatula showing synteny with soybean were analyzed. Differential evolutionary rates between soybean and Medicago were observed and the median Ks values of Mt-Mt, Gm-Mt, and Gm-Gm paralogs were determined to be 0.75, 0.62, and 0.46, respectively. Thus the comparison of Gm-Mt paralogs (Ks = 0.62 and Gm-Mt orthologs (Ks = 0.45 supports the ancient duplication of Lx regions in the common ancestor prior to the Medicago-Glycine split. After speciation, no Lx regions generated by another polyploidy were identified in Medicago. Instead tandem duplication of Lx genes was observed. On the other hand, a lineage-specific duplication occurred in soybean resulting in two pairs of Lx regions. Each pair of soybean regions was co-orthologous to one Lx region in Medicago. A total of 34 Lx genes (15 MtLxs and 19 GmLxs were divided into two groups by phylogenetic analysis. Our study shows that the Lx gene family evolved from two distinct Lx genes in the most recent common ancestor. Conclusion This study analyzed two pairs of Lx regions generated by two rounds of polyploidy in soybean. Each pair of soybean homeologous regions is co-orthologous to one region of Medicago, demonstrating the quartet structure of the soybean genome. Differential evolutionary rates between

  18. Potentiation of glycine-gated NR1/NR3A NMDA receptors relieves Ca2+-dependent outward rectification

    Directory of Open Access Journals (Sweden)

    Christian Madry

    2010-03-01

    Full Text Available Glycine has diverse functions within the mammalian central nervous system. It inhibits postsynaptic neurons via strychnine-sensitive glycine receptors (GlyRs and enhances neuronal excitation through co-activation of N-methyl-D-aspartate (NMDA receptors. Classical Ca2+-permeable NMDA receptors are composed of glycine-binding NR1 and glutamate-binding NR2 subunits, and hence require both glutamate and glycine for efficient activation. In contrast, recombinant receptors composed of NR1 and the glycine binding NR3A and/or NR3B subunits lack glutamate binding sites and can be activated by glycine alone. Therefore these receptors are also named excitatory glycine receptors. Co-application of antagonists of the NR1 glycine-binding site or of the divalent cation Zn2+ markedly enhances the glycine responses of these receptors. To gain further insight into the properties of these glycine-gated NMDA receptors, we investigated their current-voltage (I-V dependence. Whole-cell current-voltage relations of glycine currents recorded from NR1/NR3B and NR1/NR3A/NR3B expressing oocytes were found to be linear under our recording conditions. In contrast, NR1/NR3A receptors displayed a strong outwardly rectifying I-V relation. Interestingly, the voltage-dependent inward current block was abolished in the presence of NR1 antagonists, Zn2+ or a combination of both. Further analysis revealed that Ca2+ (1.8 mM present in our recording solutions was responsible for the voltage-dependent inhibition of ion flux through NR1/NR3A receptors. Since physiological concentrations of the divalent cation Mg2+ did not affect the I-V dependence, our data suggest that relief of the voltage-dependent Ca2+ block of NR1/NR3A receptors by Zn2+ may be important for the regulation of excitatory glycinergic transmission, according to the Mg2+-block of conventional NR1/NR2 NMDA receptors.

  19. FLECH PowerMax Service Requirement Specification

    DEFF Research Database (Denmark)

    It is expected that in the future, ancillary services will be required at distribution level. This work describes how one of these ancillary services, the PowerMax service, must be spec ified within a market framework. The basis of this work is the Flexibility Clearing House (FLE CH) platform...... and the Distribution System Operator (DSO) services defined in [1]. The PowerMax service has been further discussed in [2], and this technical report seeks to clarify the implementation details first discussed in that paper. The aim of the PowerMax service it to relieve congestion issue s in the distribution system...... by establishing a maximum power that a cluster of consumer devices may draw from the syste m. The consumers will receive a payment for providing this service, and the DSO will be able to postpone grid reinfo rcement...

  20. Thermodynamics of proton dissociations from aqueous glycine at temperatures from 278.15 to 393.15 K, molalities from 0 to 1.0 mol . kg-1, and at the pressure 0.35 MPa: Apparent molar heat capacities and apparent molar volumes of glycine, glycinium chloride, and sodium glycinate

    International Nuclear Information System (INIS)

    Ziemer, S.P.; Niederhauser, T.L.; Merkley, E.D.; Price, J.L.; Sorenson, E.C.; McRae, B.R.; Patterson, B.A.; Origlia-Luster, M.L.; Woolley, E.M.

    2006-01-01

    We have measured the densities of aqueous solutions of glycine, glycine plus equimolal HCl, and glycine plus equimolal NaOH at temperatures 278.15 ≤ T/K ≤ 368.15, molalities 0.01 ≤ m/mol . kg -1 ≤ 1.0, and at p = 0.35 MPa, using a vibrating tube densimeter. We have also measured the heat capacities of these solutions at 278.15 ≤ T/K ≤ 393.15 and at the same m and p using a fixed-cell differential scanning calorimeter. We used the densities to calculate apparent molar volumes V φ and the heat capacities to calculate apparent molar heat capacities C p,φ for these solutions. We used our results and values of V φ (T, m) and C p,φ (T, m) for HCl(aq), NaOH(aq), NaCl(aq) from the literature to calculate parameters for Δ r C p,m (T, m) for the first and second proton dissociations from protonated aqueous cationic glycine. We then integrated this value of Δ r C p,m (T, m) in an iterative algorithm, using Young's Rule to account for the effects of speciation and chemical relaxation on the observed V φ and C p,φ of the solutions. This procedure yielded parameters for V φ (T, m) and C p,φ (T, m) for glycinium chloride {H 2 Gly + Cl - (aq)} and sodium glycinate {Na + Gly - (aq)} which successfully modeled our observed results. We have then calculated values of Δ r C p,m , Δ r H m , Δ r V m , and pQ a for the first and second proton dissociations from protonated aqueous glycine as functions of T and m

  1. THE INCORPORATION OF RADIOACTIVITY FROM GLYCINE-C$sup 14$ BY MAMMALIAN SPERMATOZOA

    Energy Technology Data Exchange (ETDEWEB)

    Graves, C. N.

    1962-05-15

    The metabolic pathways of glycine incorporation were investigated by biochemical and radibautographic methods. Results show that glycine is utilized hy bovine spermatoza and is incorporated into all fractions of the sperm cell. Incorporation into the nucleic acid fraction and especially into thymine indicates that there is a turnover in the desoxyribenucleic acid during storage of bovine spermatoza. (C.H.)

  2. The Effects of Different Irrigation Regimes on the Morphological and Physiological Characteristics of Three Soybean Cultivars (Glycine max

    Directory of Open Access Journals (Sweden)

    N. Razmi

    2013-11-01

    Full Text Available To study the effect of different irrigation regimes on morphological and physiological characteristics of soybean cultivars, this experiment was conducted at Moghan Agricultural Research Center during 2009-2010 in Iran. The experiment was split plot based on randomized complete block design, with 3 replications. The main plots consisted of four irrigation regimes: I1, I2, I3 and I4 indicating irrigation after 60, 100, 140 and 180 mm evaporation from class A pan respectively and 3 soybean cultivars named Linford, L17 and Williams assigned in the sub plots. Results of combined analysis showed that with increasing irrigation intervals from I1 to I4 reduced growth period, plant height and leaf area index (LAI, number of nodes, branches and internodes significantly. Physiologic characteristics such as chlorophyll contain of leaves and relative water content (RWC were also affected by irrigation regimes. LAI in I1 was 4.94 reduced inI4to 3.70.Plant height of soybean cultivars were declined by 21% in I4 (irrigation after 180 mm evaporation as compared to I1 (irrigation after 60 mm evaporation. Soluble proline content of the leaves and electric conduction (EC on the other hand increases significantly. There was significant differences among cultivars concerning the vegetative and physiological characteristics. Willams and L17 cultivars produced the highest numbers of nodes (15.5 and internode length (4.95cm receptivity. The maximum proline content (65.6 µmol/F.W and relative water content (67.65% belonged to Linford cultivar. Interaction of irrigation regimes and cultivars was significant on plant hieght, LAI and proline content. Linford cultivar had more soluble proline under water limited condition and maintained higher LAI and plant height in I4 treatment as compared other treatments.

  3. Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson ; interv. Kai Tänavsuu

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2002-01-01

    Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni esimees Max Jakobson oma suhtumisest talle Maarjamaa Risti I klassi teenetemärgi andmisse, tema juhitava komisjoni tööst, eestlaste püüdlusest ühineda NATOga, kommunismi ja natsismi hukkamõistust

  4. MAX and Survey Linkages

    Data.gov (United States)

    U.S. Department of Health & Human Services — CMS is interested in linking MAX files with survey data, including four surveys conducted by the National Center for Health Statistics (NCHS) - the National Health...

  5. Dorsoventral variations in dark chilling effects on photosynthesis and stomatal function in Paspalum dilatatum leaves.

    Science.gov (United States)

    Soares-Cordeiro, Ana Sofia; Driscoll, Simon P; Arrabaça, Maria Celeste; Foyer, Christine H

    2011-01-01

    The effects of dark chilling on the leaf-side-specific regulation of photosynthesis were characterized in the C(4) grass Paspalum dilatatum. CO(2)- and light-response curves for photosynthesis and associated parameters were measured on whole leaves and on each leaf side independently under adaxial and abaxial illumination before and after plants were exposed to dark chilling for one or two consecutive nights. The stomata closed on the adaxial sides of the leaves under abaxial illumination and no CO(2) uptake could be detected on this surface. However, high rates of whole leaf photosynthesis were still observed because CO(2) assimilation rates were increased on the abaxial sides of the leaves under abaxial illumination. Under adaxial illumination both leaf surfaces contributed to the inhibition of whole leaf photosynthesis observed after one night of chilling. After two nights of chilling photosynthesis remained inhibited on the abaxial side of the leaf but the adaxial side had recovered, an effect related to increased maximal ribulose-1,5-bisphosphate carboxylation rates (V(cmax)) and enhanced maximal electron transport rates (J(max)). Under abaxial illumination, whole leaf photosynthesis was decreased only after the second night of chilling. The chilling-dependent inhibition of photosynthesis was located largely on the abaxial side of the leaf and was related to decreased V(cmax) and J(max), but not to the maximal phosphoenolpyruvate carboxylase carboxylation rate (V(pmax)). Each side of the leaf therefore exhibits a unique sensitivity to stress and recovery. Side-specific responses to stress are related to differences in the control of enzyme and photosynthetic electron transport activities.

  6. Expression profiling on soybean leaves reveals integration of ER- and osmotic-stress pathways

    Directory of Open Access Journals (Sweden)

    Dewey Ralph E

    2007-11-01

    downstream targets were inversely regulated by osmotic stress. Conclusion The present ER-stress- and osmotic-stress-induced transcriptional studies demonstrate a clear predominance of stimulus-specific positive changes over shared responses on soybean leaves. This scenario indicates that polyethylene glycol (PEG-induced cellular dehydration and ER stress elicited very different up-regulated responses within a 10-h stress treatment regime. In addition to identifying ER-stress and osmotic-stress-specific responses in soybean (Glycine max, our global expression-profiling analyses provided a list of candidate regulatory components, which may integrate the osmotic-stress and ER-stress signaling pathways in plants.

  7. Unlike pregnant adult women, pregnant adolescent girls cannot maintain glycine flux during late pregnancy because of decreased synthesis from serine.

    Science.gov (United States)

    Hsu, Jean W; Thame, Minerva M; Gibson, Raquel; Baker, Tameka M; Tang, Grace J; Chacko, Shaji K; Jackson, Alan A; Jahoor, Farook

    2016-03-14

    During pregnancy, glycine and serine become more important because they are the primary suppliers of methyl groups for the synthesis of fetal DNA, and more glycine is required for fetal collagen synthesis as pregnancy progresses. In an earlier study, we reported that glycine flux decreased by 39% from the first to the third trimester in pregnant adolescent girls. As serine is a primary precursor for glycine synthesis, the objective of this study was to measure and compare glycine and serine fluxes and inter-conversions in pregnant adolescent girls and adult women in the first and third trimesters. Measurements were made after an overnight fast by continuous intravenous infusions of 2H2-glycine and 15N-serine in eleven adolescent girls (17·4 (se 0·1) years of age) and in ten adult women (25·8 (se 0·5) years of age) for 4 h. Adolescent girls had significantly slower glycine flux and they made less glycine from serine in the third (Padolescent girls (P=0·04) and was significantly associated with third trimester glycine flux. These findings suggest that the pregnant adolescent cannot maintain glycine flux in late pregnancy compared with early pregnancy because of decreased synthesis from serine. It is possible that the inability to maintain glycine synthesis makes her fetus vulnerable to impaired cartilage synthesis, and thus linear growth.

  8. Mini MAX - Medicaid Sample

    Data.gov (United States)

    U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...

  9. Gamma-ray induction of a mutant soybean [Glycine max (L.) Merrill] line lacking all seed lipoxygenases

    International Nuclear Information System (INIS)

    Hajika, Makita; Suda, Ikuo; Sakai, Shinji; Takahashi, Masakazu

    1997-01-01

    Induction of a soybean line lacking all isozymes of seed lipoxygenase was attempted using γ-radiation and of 1,813 seeds in M 3 generation, only one was identified as a seed lacking all the isozymes by SDS-PAGE. This line did not present any physiological abnormality over 10 generations or more (M 4 -M 14 ) and no significant influence of the enzyme on the agricultural traits was observed during the performance test in fields. In the resistance test against insect pests, significant differences were not found among the varieties and the lines tested. These results suggest that deletion of all lipoxygenase isozymes would not affect the soybean production in practice. The lipoxygenase activity was not detected in the leaves as well as the seeds of this line, suggesting that this enzyme are not indispensable for the soybean growth. The validity of this line in food processing fields was examined through determining the levels of hexanal production and DETBA. This line was found able to improve the taste of soybean cookies and use in combination with other materials as flour, egg, etc. because the line has no lipoxygenase activity. (M.N.)

  10. 15N-labelled glycine synthesis

    International Nuclear Information System (INIS)

    Tavares, Claudineia R.O.; Bendassolli, Jose A.; Sant'Ana Filho, Carlos R.; Prestes, Clelber V.; Coelho, Fernando

    2006-01-01

    This work describes a method for 15 N-isotope-labeled glycine synthesis, as well as details about a recovery line for nitrogen residues. To that effect, amination of α-haloacids was performed, using carboxylic chloroacetic acid and labeled aqueous ammonia ( 15 NH 3 ). Special care was taken to avoid possible 15 NH 3 losses, since its production cost is high. In that respect, although the purchase cost of the 13 N-labeled compound (radioactive) is lower, the stable tracer produced constitutes an important tool for N cycling studies in living organisms, also minimizing labor and environmental hazards, as well as time limitation problems in field studies. The tests were carried out with three replications, and variable 15 NH 3(aq) volumes in the reaction were used (50, 100, and 150 mL), in order to calibrate the best operational condition; glycine masses obtained were 1.7, 2, and 3.2 g, respectively. With the development of a system for 15 NH 3 recovery, it was possible to recover 71, 83, and 87% of the ammonia initially used in the synthesis. With the required adaptations, the same system was used to recover methanol, and 75% of the methanol initially used in the amino acid purification process were recovered. (author)

  11. Max Jakobsoni saatuseaastad, soomlased ja meie / Imbi Paju

    Index Scriptorium Estoniae

    Paju, Imbi, 1959-

    2008-01-01

    Soome politoloogist ja diplomaadist Max Jakobsonist ja tema uuest raamatust "Saatuseaastad. Soome tõusis, andis Venemaale järele ja pääses". Artiklis on juttu ka Max Jakobsoni suhetest Eesti presidentide Lennart Meri ja Toomas Hendrik Ilvesega

  12. REMINDER Saved Leave Scheme (SLS) : Transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2002-01-01

    Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'*) annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No. 22B) can be transferred to the saved leave account at the end of the leave year (30 September). We remind you that, since last year, unused leave of all those taking part in the saved leave scheme at the closure of the leave-year accounts is transferred automatically to the saved leave account on that date. Therefore, staff members have no administrative steps to take. In addition, the transfer, which eliminates the risk of omitting to request leave transfers and rules out calculation errors in transfer requests, will be clearly shown in the list of leave transactions that can be consulted in EDH from October 2002 onwards. Furthermore, this automatic leave transfer optimizes staff members' chances of benefiting from a saved leave bonus provided that they are still participants in the schem...

  13. Max-Plus Stochastic Control and Risk-Sensitivity

    International Nuclear Information System (INIS)

    Fleming, Wendell H.; Kaise, Hidehiro; Sheu, Shuenn-Jyi

    2010-01-01

    In the Maslov idempotent probability calculus, expectations of random variables are defined so as to be linear with respect to max-plus addition and scalar multiplication. This paper considers control problems in which the objective is to minimize the max-plus expectation of some max-plus additive running cost. Such problems arise naturally as limits of some types of risk sensitive stochastic control problems. The value function is a viscosity solution to a quasivariational inequality (QVI) of dynamic programming. Equivalence of this QVI to a nonlinear parabolic PDE with discontinuous Hamiltonian is used to prove a comparison theorem for viscosity sub- and super-solutions. An example from mathematical finance is given, and an application in nonlinear H-infinity control is sketched.

  14. Electrodeposition of CoNiMo thin films using glycine as additive: anomalous and induced codeposition

    International Nuclear Information System (INIS)

    Esteves, Marcos C.; Sumodjo, Paulo T.A.; Podlaha, Elizabeth J.

    2011-01-01

    Highlights: → Mixed/induced codeposition of CoNiMo from a glycine containing bath. → Deposition in a rotating cylinder Hull cell. → The mechanism is explained in term of the complex species that can be formed. - Abstract: The present study focuses on the behavior of the CoNiMo mixed anomalous/induced codeposition process, using glycine as a probe to influence the coverage of adsorbed intermediates. In order to facilitate the investigation of a wide variation of parameters the electrodeposition of the alloy films was performed using a rotating cylinder Hull cell. Alloy composition, current efficiency and partial currents of each metal were analyzed. The partial current densities and hence alloy composition was affected by the amount of glycine in the electrolyte: increasing glycine enhanced both cobalt and molybdenum deposition rates and hindered nickel deposition. It is suggested that the glycine facilitates the adsorption of M(I) adsorbed intermediates that control the anomalous and induced codeposition behavior. The current efficiency ranged from 30 up to 75% and was only slightly affected by glycine at high applied current densities. Films with a tridimensional porous structure were obtained applying current densities higher than 200 mA cm -2 , formed as a consequence of the large hydrogen evolution side reaction, presenting conditions for a novel Mo-alloy electrode structure.

  15. [{sup 3}H]CGP 61594, the first photoaffinity ligand for the glycine site of NMDA receptors

    Energy Technology Data Exchange (ETDEWEB)

    Benke, D.; Honer, M.; Mohler, H. [Institute of Pharmacology, ETH and University of Zurich, Winterthurerstrasse 190, CH-8057 Zurich (Switzerland); Heckendorn, R.; Pozza, M.F.; Allgeier, H.; Angst, C. [NS Research, Novartis Pharma AG, CH-4002 Basle (Switzerland)

    1999-02-01

    Activation of NMDA receptors requires the presence of glycine as a coagonist which binds to a site that is allosterically linked to the glutamate binding site. To identify the protein constituents of the glycine binding site in situ the photoaffinity label [{sup 3}H]CGP 61594 was synthesized. In reversible binding assays using crude rat brain membranes, [{sup 3}H]CGP 61594 labeled with high affinity (K{sub D}=23 nM) the glycine site of the NMDA receptor. This was evident from the Scatchard analysis, the displacing potencies of various glycine site ligands and the allosteric modulation of [{sup 3}H]CGP 61594 binding by ligands of the glutamate and polyamine sites. Electrophysiological experiments in a neocortical slice preparation identified CGP 61594 as a glycine antagonist. Upon UV-irradiation, a protein band of 115 kDa was specifically photolabeled by [{sup 3}H]CGP 61594 in brain membrane preparations. The photolabeled protein was identified as the NR1 subunit of the NMDA receptor by NR1 subunit-specific immunoaffinity chromatography. Thus, [{sup 3}H]CGP 61594 is the first photoaffinity label for the glycine site of NMDA receptors. It will serve as a tool for the identification of structural elements that are involved in the formation of the glycine binding domain of NMDA receptors in situ and will thereby complement the mutational analysis of recombinant receptors. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  16. Glycine max and Moringa oleifera : nutritional values, processing ...

    African Journals Online (AJOL)

    For fighting malnutrition in the developing countries, using soybean and Moringa oleifera plant materials can be considered as the cheaper and the most sustainable approach. The objective of our review is to identify and present the nutritional potential of these two agro-resources. We conducted a literature review on the ...

  17. Digital logic circuit design with ALTERA MAX+PLUS II

    International Nuclear Information System (INIS)

    Lee, Seung Ho; Park, Yong Su; Park, Gun Jong; Lee, Ju Heon

    2006-09-01

    This book is composed of five parts. The first part has introduction of ALTERA MAX+PLUS II and graphic editor, text editor, compiler, waveform editor simulator and timing analyzer of it. The second part is about direction of digital logic circuit design with training kit. The third part has grammar and practice of VHDL in ALTERA MAX+PLUS II including example and history of VHDL. The fourth part shows the design example of digital logic circuit by VHDL of ALTERA MAX+PLUS II which lists designs of adder and subtractor, code converter, counter, state machine and LCD module. The last part explains design example of digital logic circuit by graphic editor in ALTERA MAX+PLUS II.

  18. Max Weber Visits America: A Review of the Video

    Directory of Open Access Journals (Sweden)

    Michael Wise

    2006-11-01

    Full Text Available The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976 to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided using the .mp4 format. The video should appeal to students and professors interested in Max Weber. It can be included in courses ranging from introductory sociology to theory.

  19. Trimethylamine N-oxide stabilizes proteins via a distinct mechanism compared with betaine and glycine

    Science.gov (United States)

    Liao, Yi-Ting; Manson, Anthony C.; DeLyser, Michael R.; Noid, William G.; Cremer, Paul S.

    2017-01-01

    We report experimental and computational studies investigating the effects of three osmolytes, trimethylamine N-oxide (TMAO), betaine, and glycine, on the hydrophobic collapse of an elastin-like polypeptide (ELP). All three osmolytes stabilize collapsed conformations of the ELP and reduce the lower critical solution temperature (LSCT) linearly with osmolyte concentration. As expected from conventional preferential solvation arguments, betaine and glycine both increase the surface tension at the air–water interface. TMAO, however, reduces the surface tension. Atomically detailed molecular dynamics (MD) simulations suggest that TMAO also slightly accumulates at the polymer–water interface, whereas glycine and betaine are strongly depleted. To investigate alternative mechanisms for osmolyte effects, we performed FTIR experiments that characterized the impact of each cosolvent on the bulk water structure. These experiments showed that TMAO red-shifts the OH stretch of the IR spectrum via a mechanism that was very sensitive to the protonation state of the NO moiety. Glycine also caused a red shift in the OH stretch region, whereas betaine minimally impacted this region. Thus, the effects of osmolytes on the OH spectrum appear uncorrelated with their effects upon hydrophobic collapse. Similarly, MD simulations suggested that TMAO disrupts the water structure to the least extent, whereas glycine exerts the greatest influence on the water structure. These results suggest that TMAO stabilizes collapsed conformations via a mechanism that is distinct from glycine and betaine. In particular, we propose that TMAO stabilizes proteins by acting as a surfactant for the heterogeneous surfaces of folded proteins. PMID:28228526

  20. The interactional foundations of MaxEnt: Open questions

    Energy Technology Data Exchange (ETDEWEB)

    Harré, Michael S., E-mail: michael.harre@sydney.edu.au [Complex Systems Research Group, School of Civil Engineering, The University of Sydney, Sydney NSW 2006 (Australia)

    2014-12-05

    One of the simplest and potentially most useful techniques to be developed in the 20{sup th} century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals.

  1. The interactional foundations of MaxEnt: Open questions

    International Nuclear Information System (INIS)

    Harré, Michael S.

    2014-01-01

    One of the simplest and potentially most useful techniques to be developed in the 20 th century, a century noted for an ever more mathematically sophisticated formulation of the sciences, is that of maximising the entropy of a system in order to generate a descriptive, stochastic model of that system in closed form, often abbreviated to MaxEnt. The extension of MaxEnt to systems beyond the physics from which it originated is hampered by the fact that the microscopic physical interactions that are not justified or justifiable within the MaxEnt framework need to be falsifiably evaluated in each new field of application. It is not obvious that such justification exists for many systems in which the interactions are not directly based on physics. For example what is the justification for the use of MaxEnt in biology, climate modelling or economics? Is it simply a useful heuristic or is there some deeper connection with the foundations of some systems? Without further critical examination of the microscopic foundations that give rise to the success of the MaxEnt principle it is difficult to motivate the use of such techniques in other fields except through theoretically an practically unsatisfying analogical arguments. This article briefly presents the basis of MaxEnt principles as originally introduced in statistical mechanics in the Jaynes form, the Tsallis form and the Rényi form. Several different applications are introduced including that of ecological diversity where maximising the different diversity measures is equivalent to maximising different entropic functionals

  2. High efficient removal of chromium (VI) using glycine doped polypyrrole adsorbent from aqueous solution

    CSIR Research Space (South Africa)

    Ballav, N

    2012-08-01

    Full Text Available Glycine doped polypyrrole (PPy-gly) adsorbent was prepared via in situ polymerization of pyrrole (Py) monomer in the presence of glycine (gly) for the removal of Cr(VI). Formation of PPy homopolymer and inclusion of gly in the PPy matrix were...

  3. A glycine residue essential for high ivermectin sensitivity in Cys-loop ion channel receptors

    DEFF Research Database (Denmark)

    Lynagh, Timothy; Lynch, Joseph W.

    2010-01-01

    Ivermectin exerts its anthelmintic effect by activating nematode Cys-loop glutamate-gated receptors. Here we show that a glycine residue at a specific transmembrane domain location is essential for high ivermectin sensitivity in both glycine- and glutamate-gated Cys-loop receptors. We also show...

  4. Nutritional requirements for soybean cyst nematode

    Science.gov (United States)

    Soybeans [Glycine max] are the second largest cash crop in US Agriculture, but the soybean yield is compromised by infections from Heterodera glycines, also known as Soybean Cyst Nematodes [SCN]. SCN are the most devastating pathogen or plant disease soybean producers confront. This obligate parasi...

  5. Application of Glycine-TTC dosimeter in gamma radiation processing facility

    International Nuclear Information System (INIS)

    Shinde, S.H.; Mondal, S.; Kulkarni, M.S.

    2018-01-01

    Glycine-TTC dosimeter was found to have a useful dose range of 5 to 30 kGy using spectro-photometric read-out method. Potential use of this dosimeter was demonstrated by measuring dose-rate in gamma chamber GC 900. The aim of the present study was to verify the performance of this dosimeter in actual industrial processing conditions encountered in radiation processing facility such as Gamma Radiation Processing Plant for Spices (GRPPS), BRIT, Vashi. Accordingly, glycine-TTC dosimeters were irradiated along with routine dosimeter viz. ceric-cerous of GRPPS and reference standard dosimeter viz. alanine EPR

  6. Characterisation of the human NMDA receptor subunit NR3A glycine binding site

    DEFF Research Database (Denmark)

    Nilsson, A; Duan, J; Mo-Boquist, L-L

    2007-01-01

    In this study, we characterise the binding site of the human N-methyl-d-aspartate (NMDA) receptor subunit NR3A. Saturation radioligand binding of the NMDA receptor agonists [(3)H]-glycine and [(3)H]-glutamate showed that only glycine binds to human NR3A (hNR3A) with high affinity (K(d)=535nM (277...

  7. New insights into the catalytic mechanism of human glycine N-acyltransferase.

    Science.gov (United States)

    van der Sluis, Rencia; Ungerer, Vida; Nortje, Carla; A van Dijk, Alberdina; Erasmus, Elardus

    2017-11-01

    Even though the glycine conjugation pathway was one of the first metabolic pathways to be discovered, this pathway remains very poorly characterized. The bi-substrate kinetic parameters of a recombinant human glycine N-acyltransferase (GLYAT, E.C. 2.3.1.13) were determined using the traditional colorimetric method and a newly developed HPLC-ESI-MS/MS method. Previous studies analyzing the kinetic parameters of GLYAT, indicated a random Bi-Bi and/or ping-pong mechanism. In this study, the hippuric acid concentrations produced by the GLYAT enzyme reaction were analyzed using the allosteric sigmoidal enzyme kinetic module. Analyses of the initial rate (v) against substrate concentration plots, produced a sigmoidal curve (substrate activation) when the benzoyl-CoA concentrations was kept constant, whereas the plot with glycine concentrations kept constant, passed through a maximum (substrate inhibition). Thus, human GLYAT exhibits mechanistic kinetic cooperativity as described by the Ferdinand enzyme mechanism rather than the previously assumed Michaelis-Menten reaction mechanism. © 2017 Wiley Periodicals, Inc.

  8. De Max-Planck medaille

    NARCIS (Netherlands)

    Heijmans, H.G.; van Woerkom, P.Th.L.M.; Ankersmit, W.; Hagman, R.; Heijmans, H.G.; Olsder, G.J.; van de Schootbrugge, G.

    2017-01-01

    De Max-Planck-Medaille is een onderscheiding die sinds 1929 jaarlijks wordt uitgereikt door de toentertijd grootste vereniging van natuurkundigen ter wereld: de Deutsche Physikalische Gesellschaft. Het is als het ware de Nobelprijs voor de theoretische natuurkunde, volgens de natuurkundigen zelf. In

  9. Intertextuality and Television Discourse: The Max Headroom Story.

    Science.gov (United States)

    Braddlee

    Max Headroom, the computer-generated media personality, presents a good opportunity for an investigation of the degree of intertextuality in television. Max combines narrative genres (science fiction and film noir), television program types (prime-time episodic narrative, made-for-TV movie, talkshows), advertising and programming, and electronic…

  10. ald of Mycobacterium tuberculosis Encodes both the Alanine Dehydrogenase and the Putative Glycine Dehydrogenase

    Science.gov (United States)

    Giffin, Michelle M.; Modesti, Lucia; Raab, Ronald W.; Wayne, Lawrence G.

    2012-01-01

    The putative glycine dehydrogenase of Mycobacterium tuberculosis catalyzes the reductive amination of glyoxylate to glycine but not the reverse reaction. The enzyme was purified and identified as the previously characterized alanine dehydrogenase. The Ald enzyme was expressed in Escherichia coli and had both pyruvate and glyoxylate aminating activities. The gene, ald, was inactivated in M. tuberculosis, which resulted in the loss of all activities. Both enzyme activities were found associated with the cell and were not detected in the extracellular filtrate. By using an anti-Ald antibody, the protein was localized to the cell membrane, with a smaller fraction in the cytosol. None was detected in the extracellular medium. The ald knockout strain grew without alanine or glycine and was able to utilize glycine but not alanine as a nitrogen source. Transcription of ald was induced when alanine was the sole nitrogen source, and higher levels of Ald enzyme were measured. Ald is proposed to have several functions, including ammonium incorporation and alanine breakdown. PMID:22210765

  11. Sorption of fluoride using chemically modified Moringa oleifera leaves

    Science.gov (United States)

    Dan, Shabnam; Chattree, Amit

    2018-05-01

    Contamination of drinking water due to fluoride is a severe health hazard problem. Excess of fluoride (> 1.5 mg/L) in drinking water is harmful to human health. Various treatment technologies for removing fluoride from groundwater have been investigated. The present study showed that the leaves of Moringa oleifera, a herbal plant is an effective adsorbent for the removal of fluoride from aqueous solution. Acid treated Moringa oleifera leaves powder showed good adsorption capacity than alkali treated Moringa oleifera leaves powder. Batch sorptive defluoridation was conducted under the variable experimental condition such as pH, contact time, adsorbent dose and initial fluoride ion concentration. Maximum defluoridation was achieved at pH 1. The percentage of fluoride removal increases with adsorbent dose. The equilibrium sorption data were fitted into Langmuir, Freundlich and Temkin isotherms. Of the three adsorption isotherms, the R 2 value of Langmuir isotherm model was the highest. The maximum monolayer coverage ( Q max) from Langmuir isotherm model was determined to be 1.1441 mg/g, the separation factor indicating a favorable sorption experiment is 0.035. It was also discovered that the adsorption did not conform to the Freundlich adsorption isotherm. The heat of sorption process was estimated from Temkin Isotherm model to be - 0.042 J/mol which vividly proved that the adsorption experiment followed a physical process.

  12. Autodesk 3ds Max 2012 Essentials

    CERN Document Server

    Derakhshani, Randi L

    2011-01-01

    Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,

  13. Isolation, Characterization, and Distribution of a Biocontrol Fungus from Cysts of Heterodera glycines.

    Science.gov (United States)

    Kim, D G; Riggs, R D; Correll, J C

    1998-05-01

    ABSTRACT Seventy-six populations of Heterodera glycines were collected from 33 counties in 10 states of the United States along the Mississippi and Missouri Rivers in 1992 and 1993. A sterile hyphomycete fungus of an unnamed taxon, designated ARF18 and shown to be a parasite of eggs of H. glycines, was isolated from eggs and cysts of 10 of the populations from Kentucky, Louisiana, Mississippi, and Tennessee. Ten isolates of ARF18 obtained in this study and seven isolates obtained in earlier studies were characterized for cultural morphology on several growth media, the ability to produce sclerotium-like structures (SLS) on cornmeal agar, growth rates, pathogenicity to eggs of H. glycines in vitro, and mitochondrial (mt) DNA restriction fragment length polymorphisms (RFLPs). All 17 isolates of ARF18 readily grew on potato dextrose agar, cornmeal agar, and nutrient agar. Based on colony morphology and SLS appearance on cornmeal agar, the isolates could be grouped into two morphological phenotypes. Isolates that produced SLS that were composed of a compact mass of hyphae were designated ARF18-C, whereas isolates that produced SLS composed of a mass of loosely clumped hyphae were designated ARF18-L. Only minor differences in growth rates were detected among the ARF18-C and ARF18-L isolates. All 10 ARF18-C isolates, which were from Arkansas, Louisiana, Mississippi, and Tennessee, belonged to a single mtDNA RFLP haplotype. The seven ARF18-L isolates shared many comigrating mtDNA restriction fragments with one another, but belonged to three distinct mtDNA RFLP haplotypes. Ability to infect eggs of H. glycines in vitro varied considerably among the various isolates of ARF18. In particular, several of the ARF18-C isolates were consistently able to infect over 50% (mean = 70.0%, standard deviation = 16%) of the eggs of H. glycines, whereas ARF18-L infected eggs to a lesser degree (mean = 25%, standard deviation = 27%). ARF18-C was isolated only from H. glycines populations

  14. Temporal alteration of spreading depression by the glycine transporter type-1 inhibitors NFPS and Org-24461 in chicken retina.

    Science.gov (United States)

    Kertesz, Szabolcs; Szabo, Geza; Udvari, Szabolcs; Levay, Gyorgy; Matyus, Peter; Harsing, Laszlo G

    2013-01-25

    We used isolated chicken retina to induce spreading depression by the glutamate receptor agonist N-methyl-d-aspartate. The N-methyl-d-aspartate-induced latency time of spreading depression was extended by the glycine(B) binding site competitive antagonist 7-chlorokynurenic acid. Addition of the glycine transporter type-1 inhibitors NFPS and Org-24461 reversed the inhibitory effect of 7-chlorokynurenic acid on N-methyl-d-aspartate-evoked spreading depression. The glycine uptake inhibitory activity of Org-24461, NFPS, and some newly synthesized analogs of NFPS was determined in CHO cells stably expressing human glycine transporter type-1b isoform. Compounds, which failed to inhibit glycine transporter type-1, also did not have effect on retinal spreading depression. These experiments indicate that the spreading depression model in chicken retina is a useful in vitro test to determine activity of glycine transporter type-1 inhibitors. In addition, our data serve further evidence for the role of glycine transporter type-1 in retinal neurotransmission and light processing. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Biokinetic Analysis and Metabolic Fate of 2,4-D in 2,4-D-Resistant Soybean (Glycine max).

    Science.gov (United States)

    Skelton, Joshua J; Simpson, David M; Peterson, Mark A; Riechers, Dean E

    2017-07-26

    The Enlist weed control system allows the use of 2,4-D in soybean but slight necrosis in treated leaves may be observed in the field. The objectives of this research were to measure and compare uptake, translocation, and metabolism of 2,4-D in Enlist (E, resistant) and non-AAD-12 transformed (NT, sensitive) soybeans. The adjuvant from the Enlist Duo herbicide formulation (ADJ) increased 2,4-D uptake (36%) and displayed the fastest rate of uptake (U 50 = 0.2 h) among treatments. E soybean demonstrated a faster rate of 2,4-D metabolism (M 50 = 0.2 h) compared to NT soybean, but glyphosate did not affect 2,4-D metabolism. Metabolites of 2,4-D in E soybean were qualitatively different than NT. Applying 2,4-D-ethylhexyl ester instead of 2,4-D choline (a quaternary ammonium salt) eliminated visual injury to E soybean, likely due to the time required for initial de-esterification and bioactivation. Excessive 2,4-D acid concentrations in E soybean resulting from ADJ-increased uptake may significantly contribute to foliar injury.

  16. Overexpression of a soybean salicylic acid methlyltransferase gene confers resistance to soybean cyst nematode

    Science.gov (United States)

    Soybean cyst nematode (Heterodera glycines Ichinohe, SCN) is the most pervasive pest of soybean [Glycine max (L.) Merr.] in the USA and worldwide. SCN reduced soybean yields worldwide by an estimated billion dollars annually. These losses remained stable with the use of resistant cultivars but over ...

  17. Impact of no-till cover cropping of Italian ryegrass on above and below ground faunal communities inhabiting a soybean field with special emphasis on soybean cyst nematodes

    Science.gov (United States)

    Two field trials were conducted in Maryland to evaluate the ability of an Italian ryegrass (IR) (Lolium multiflorum) cover crop in a no-till soybean (Glycine max) planting to 1) reduce populations of plant-parasitic nematodes (i.e., the soybean cyst nematode, Heterodera glycines and lesion nematodes...

  18. The discovery of glycine and related amino acid-based factor Xa inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Kohrt, Jeffrey T.; Filipski, Kevin J.; Cody, Wayne L.; Bigge, Christopher F.; La, Frances; Welch, Kathleen; Dahring, Tawny; Bryant, John W.; Leonard, Daniele; Bolton, Gary; Narasimhan, Lakshmi; Zhang, Erli; Peterson, J. Thomas; Haarer, Staci; Sahasrabudhe, Vaishali; Janiczek, Nancy; Desiraju, Shrilakshmi; Hena, Mostofa; Fiakpui, Charles; Saraswat, Neerja; Sharma, Raman; Sun, Shaoyi; Maiti, Samarendra N.; Leadley, Robert; Edmunds, Jeremy J. (Naeja); (Pfizer)

    2010-12-03

    Herein, we report on the identification of three potent glycine and related amino acid-based series of FXa inhibitors containing a neutral P1 chlorophenyl pharmacophore. A X-ray crystal structure has shown that constrained glycine derivatives with optimized N-substitution can greatly increase hydrophobic interactions in the FXa active site. Also, the substitution of a pyridone ring for a phenylsulfone ring in the P4 sidechain resulted in an inhibitor with enhanced oral bioavailability.

  19. Kinetics and mechanism of oxidation of glycine by iron(III)–1,10 ...

    Indian Academy of Sciences (India)

    Unknown

    An increase in (phenanthroline) increases the rate, while increase in [H+] decreases the rate. ... bon dioxide and ammonia with K2S2O8, KMnO4, po- ... 2. Experimental. A 1⋅0 mol dm–3 solution of glycine is prepared afresh by dissolving glycine (E-Merck) in water and its strength is determined by the acetuous perchloric.

  20. Max Weber Visits America: A Review of the Video

    OpenAIRE

    Michael Wise

    2006-01-01

    The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976) to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided...

  1. Glycine Receptor α2 Subunit Activation Promotes Cortical Interneuron Migration

    Directory of Open Access Journals (Sweden)

    Ariel Avila

    2013-08-01

    Full Text Available Glycine receptors (GlyRs are detected in the developing CNS before synaptogenesis, but their function remains elusive. This study demonstrates that functional GlyRs are expressed by embryonic cortical interneurons in vivo. Furthermore, genetic disruption of these receptors leads to interneuron migration defects. We discovered that extrasynaptic activation of GlyRs containing the α2 subunit in cortical interneurons by endogenous glycine activates voltage-gated calcium channels and promotes calcium influx, which further modulates actomyosin contractility to fine-tune nuclear translocation during migration. Taken together, our data highlight the molecular events triggered by GlyR α2 activation that control cortical tangential migration during embryogenesis.

  2. The effect of dietary glycine on the hepatic tumor promoting activity of polychlorinated biphenyls (PCBs) in rats

    International Nuclear Information System (INIS)

    Bunaciu, Rodica Petruta; Tharappel, Job C.; Lehmler, Hans-Joachim; Kania-Korwel, Izabela; Robertson, Larry W.; Srinivasan, Cidambi; Spear, Brett T.; Glauert, Howard P.

    2007-01-01

    Polychlorinated biphenyls (PCBs) are ubiquitious lipophilic environmental pollutants. Some of the PCB congeners and mixtures of congeners have tumor promoting activity in rat liver. The mechanism of their activity is not fully understood and is likely to be multifactorial. The aim of this study was to investigate if the resident liver macrophages, Kupffer cells, are important in the promoting activity of PCBs. The hypothesis of this study was that the inhibition of Kupffer cell activity would inhibit hepatic tumor promotion by PCBs in rats. To test our hypothesis, we studied the effects of Kupffer cell inhibition by dietary glycine (an inhibitor of Kupffer cell secretory activity) in a rat two-stage hepatocarcinogenesis model using 2,2',4,4',5,5'-hexachlorobiphenyl (PCB-153, a non-dioxin-like PCB) or 3,3',4,4'-tetrachlorobiphenyl (PCB-77, a dioxin-like PCB) as promoters. Diethylnitrosamine (DEN, 150 mg/kg) was administered to female Sprague-Dawley rats, which were then placed on an unrefined diet containing 5% glycine (or casein as nitrogen control) starting two weeks after DEN administration. On the third day after starting the diets, rats received PCB-77 (300 μmol/kg), PCB-153 (300 μmol/kg), or corn oil by i.p. injection. The rats received a total of 4 PCB injections, administered every 14 days. The rats were euthanized on the 10th day after the last PCB injection, and the formation of altered hepatic foci expressing placental glutathione S-transferase (PGST) and the rate of DNA synthesis in these foci and in the normal liver tissue were determined. Glycine did not significantly affect foci number or volume. PCB-153 did not significantly increase the focal volume, but increased the number of foci per liver, but only in the rats not fed glycine; PCB-77 increased both the foci number and their volume in both glycine-fed and control rats. Glycine did not alter the PCB content of the liver, but did increase the activity of 7-benzyloxyresorufin O-dealkylase (BROD

  3. Autodesk 3ds Max 2013 essentials

    CERN Document Server

    Derakhshani, Dariush

    2012-01-01

    A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.

  4. Autodesk 3ds Max 2014 bible

    CERN Document Server

    Murdock, Kelly L

    2013-01-01

    A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty

  5. Soybean SAT1 (Symbiotic Ammonium Transporter 1) encodes a bHLH transcription factor involved in nodule growth and NH4+ transport.

    Science.gov (United States)

    Chiasson, David M; Loughlin, Patrick C; Mazurkiewicz, Danielle; Mohammadidehcheshmeh, Manijeh; Fedorova, Elena E; Okamoto, Mamoru; McLean, Elizabeth; Glass, Anthony D M; Smith, Sally E; Bisseling, Ton; Tyerman, Stephen D; Day, David A; Kaiser, Brent N

    2014-04-01

    Glycine max symbiotic ammonium transporter 1 was first documented as a putative ammonium (NH4(+)) channel localized to the symbiosome membrane of soybean root nodules. We show that Glycine max symbiotic ammonium transporter 1 is actually a membrane-localized basic helix-loop-helix (bHLH) DNA-binding transcription factor now renamed Glycine max bHLH membrane 1 (GmbHLHm1). In yeast, GmbHLHm1 enters the nucleus and transcriptionally activates a unique plasma membrane NH4(+) channel Saccharomyces cerevisiae ammonium facilitator 1. Ammonium facilitator 1 homologs are present in soybean and other plant species, where they often share chromosomal microsynteny with bHLHm1 loci. GmbHLHm1 is important to the soybean rhizobium symbiosis because loss of activity results in a reduction of nodule fitness and growth. Transcriptional changes in nodules highlight downstream signaling pathways involving circadian clock regulation, nutrient transport, hormone signaling, and cell wall modification. Collectively, these results show that GmbHLHm1 influences nodule development and activity and is linked to a novel mechanism for NH4(+) transport common to both yeast and plants.

  6. Apple F-box Protein MdMAX2 Regulates Plant Photomorphogenesis and Stress Response

    Directory of Open Access Journals (Sweden)

    Jian-Ping An

    2016-11-01

    Full Text Available MAX2 (MORE AXILLARY GROWTH2 is involved in diverse physiological processes, including photomorphogenesis, the abiotic stress response, as well as karrikin and strigolactone signaling-mediated shoot branching. In this study, MdMAX2, an F-box protein that is a homolog of Arabidopsis MAX2, was identified and characterized. Overexpression of MdMAX2 in apple calli enhanced the accumulation of anthocyanin. Ectopic expression of MdMAX2 in Arabidopsis exhibited photomorphogenesis phenotypes, including increased anthocyanin content and decreased hypocotyl length. Further study indicated that MdMAX2 might promote plant photomorphogenesis by affecting the auxin signaling as well as other plant hormones. Transcripts of MdMAX2 were noticeably up-regulated in response to NaCl and Mannitol treatments. Moreover, compared with the wild type, the MdMAX2-overexpressing apple calli and Arabidopsis exhibited increased tolerance to salt and drought stresses. Taken together, these results suggest that MdMAX2 plays a positive regulatory role in plant photomorphogenesis and stress response.

  7. Max Scheler's Phenomenology of Interrelation

    African Journals Online (AJOL)

    denise

    German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy .... process of deliberation or ask myself how the other person might be feeling .... Scheler believes that Nietzsche mistakenly identifies.

  8. President Ilves kohtus Max Jakobsoniga

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilves ja Soome tuntud diplomaat Max Jakobson arutasid 16. septembril 2008 Tallinnas toimunud kohtumisel julgeolekuolukorda Euroopas pärast Venemaa-Gruusia sõda, Euroopa Liidu suhteid Venemaaga ja NATO tulevikku

  9. Absorption, transport, and chemical fate of plutonium in soybean plants

    International Nuclear Information System (INIS)

    Garland, T.R.; Cataldo, D.A.; Wildung, R.E.

    1981-01-01

    Absorption of plutonium (Pu) by soybean plants (Glycine max cv. Williams) is limited by Pu solubility in soils. Changes in Pu concentration in different tissues with time to senescence indicate Pu is freely transported through the xylem during growth but not subject to remobilization on flowering. Studies in which the DTPA complex of 238 Pu was supplied to the plant suggest a change in chemical form following root absorption. Of the Pu in roots, stems, and leaves at senescence, 28, 54, and 67%, respectively, were soluble. The Pu in the solluble fraction was primarily associated with components of >10000 equivalent molecular weight in leaves and roots, whereas stems exhibited an equal distribution between components in the >10000 and <500 molecular weight fractions. Plutonium associated with mature seeds is concentrated in the seed hull (85%) and cotyledons (14%). The Pu associated with the cotyledon was primarily in the insoluble residues and soluble soy whey

  10. Max Weber's Critique of the Bureaucratisation of Education

    Science.gov (United States)

    Madan, Amman

    2014-01-01

    In this commentary, the author discusses the critique by Max Weber and his views on bureaucratisation of education. The modern school, said Max Weber (1864-1920) over a hundred years ago, has as its educational ideal the bureaucrat and no longer the cultivated elite of older times. The shift to modernity and to its characteristic institution, the…

  11. Characterization of Human and Yeast Mitochondrial Glycine Carriers with Implications for Heme Biosynthesis and Anemia.

    Science.gov (United States)

    Lunetti, Paola; Damiano, Fabrizio; De Benedetto, Giuseppe; Siculella, Luisa; Pennetta, Antonio; Muto, Luigina; Paradies, Eleonora; Marobbio, Carlo Marya Thomas; Dolce, Vincenza; Capobianco, Loredana

    2016-09-16

    Heme is an essential molecule in many biological processes, such as transport and storage of oxygen and electron transfer as well as a structural component of hemoproteins. Defects of heme biosynthesis in developing erythroblasts have profound medical implications, as represented by sideroblastic anemia. The synthesis of heme requires the uptake of glycine into the mitochondrial matrix where glycine is condensed with succinyl coenzyme A to yield δ-aminolevulinic acid. Herein we describe the biochemical and molecular characterization of yeast Hem25p and human SLC25A38, providing evidence that they are mitochondrial carriers for glycine. In particular, the hem25Δ mutant manifests a defect in the biosynthesis of δ-aminolevulinic acid and displays reduced levels of downstream heme and mitochondrial cytochromes. The observed defects are rescued by complementation with yeast HEM25 or human SLC25A38 genes. Our results identify new proteins in the heme biosynthetic pathway and demonstrate that Hem25p and its human orthologue SLC25A38 are the main mitochondrial glycine transporters required for heme synthesis, providing definitive evidence of their previously proposed glycine transport function. Furthermore, our work may suggest new therapeutic approaches for the treatment of congenital sideroblastic anemia. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  12. Glycine receptors support excitatory neurotransmitter release in developing mouse visual cortex

    Science.gov (United States)

    Kunz, Portia A; Burette, Alain C; Weinberg, Richard J; Philpot, Benjamin D

    2012-01-01

    Glycine receptors (GlyRs) are found in most areas of the brain, and their dysfunction can cause severe neurological disorders. While traditionally thought of as inhibitory receptors, presynaptic-acting GlyRs (preGlyRs) can also facilitate glutamate release under certain circumstances, although the underlying molecular mechanisms are unknown. In the current study, we sought to better understand the role of GlyRs in the facilitation of excitatory neurotransmitter release in mouse visual cortex. Using whole-cell recordings, we found that preGlyRs facilitate glutamate release in developing, but not adult, visual cortex. The glycinergic enhancement of neurotransmitter release in early development depends on the high intracellular to extracellular Cl− gradient maintained by the Na+–K+–2Cl− cotransporter and requires Ca2+ entry through voltage-gated Ca2+ channels. The glycine transporter 1, localized to glial cells, regulates extracellular glycine concentration and the activation of these preGlyRs. Our findings demonstrate a developmentally regulated mechanism for controlling excitatory neurotransmitter release in the neocortex. PMID:22988142

  13. Collective vibrational spectra of α- and γ-glycine studied by terahertz and Raman spectroscopy

    International Nuclear Information System (INIS)

    Shi Yulei; Wang Li

    2005-01-01

    Terahertz time-domain spectroscopy is used to investigate the absorption and dispersion of polycrystalline α- and γ-glycine in the spectral region 0.5-3.0 THz. The spectra exhibit distinct features in these two crystalline phases. The observed far-infrared responses are attributed to intermolecular vibrational modes mediated by hydrogen bonds. We also measure the Raman spectra of the polycrystalline and dissolved glycine in the frequency range 28-3900 cm -1 . The results show that all the vibrational modes below 200 cm -1 are nonlocalized but are of a collective (phonon-like) nature. Furthermore, the temperature dependence of the Raman spectra of α-glycine agrees with the anharmonicity mechanism of the vibrational potentials

  14. Computer simulation and experimental self-assembly of irradiated glycine amino acid under magnetic fields: Its possible significance in prebiotic chemistry.

    Science.gov (United States)

    Heredia, Alejandro; Colín-García, María; Puig, Teresa Pi I; Alba-Aldave, Leticia; Meléndez, Adriana; Cruz-Castañeda, Jorge A; Basiuk, Vladimir A; Ramos-Bernal, Sergio; Mendoza, Alicia Negrón

    2017-12-01

    Ionizing radiation may have played a relevant role in chemical reactions for prebiotic biomolecule formation on ancient Earth. Environmental conditions such as the presence of water and magnetic fields were possibly relevant in the formation of organic compounds such as amino acids. ATR-FTIR, Raman, EPR and X-ray spectroscopies provide valuable information about molecular organization of different glycine polymorphs under static magnetic fields. γ-glycine polymorph formation increases in irradiated samples interacting with static magnetic fields. The increase in γ-glycine polymorph agrees with the computer simulations. The AM1 semi-empirical simulations show a change in the catalyst behavior and dipole moment values in α and γ-glycine interaction with the static magnetic field. The simulated crystal lattice energy in α-glycine is also affected by the free radicals under the magnetic field, which decreases its stability. Therefore, solid α and γ-glycine containing free radicals under static magnetic fields might have affected the prebiotic scenario on ancient Earth by causing the oligomerization of glycine in prebiotic reactions. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Microbial assisted phyto extraction of metals and growth of soybean (glycine max l. merrill) on industrial waste water contaminated soil

    International Nuclear Information System (INIS)

    Ali, I.; Bano, A.

    2012-01-01

    Pots experiments were made to investigate the role of effective microorganisms (EM) in improving phyto extraction of metals (Cd/sup +2/ and Mn/sup +2/) and growth of soybean plant in industrial waste water polluted soil. Waste water applications to soil were made in four different dilutions (i.e. 25%, 50%, 75% and 100%). Effective microorganisms were added into waste water prior to application. Effect of treatments on growth parameters was studied. The Cd/sup +2/ and Mn/sup +2/ concentrations in different parts of plant were measured by Atomic Absorption Spectrophotometer. Plant height significantly increased at all treatments except at 25% waste water treatment. Plant dry biomass and oil contents in seed significantly increased with all treatments compared to control but were higher at low concentration of waste water. Waste water treatments significantly increased the Cd and Mn accumulation in plant while inoculation of EM further enhanced the metals accumulation. The maximum accumulation of Cd and Mn found in plant treated with 100% waste water in combination with effective microorganisms. At harvest, the Cd/sup +2/ concentration decreased in leaves but increased in roots followed by stem > seeds, while, Mn/sup +2/ accumulation increased in leaves followed by roots > stem > seeds. Conclusively, EM enhanced the phyto extraction of Cd and Mn and also increased the oil contents in soybean on polluted soil. These findings suggest further investigation to find out a suitable concentration of industrial waste water in combination with EM for better growth of soybean and improving phyto extraction of metals. (author)

  16. MaxSynBio - Avenues towards creating cells from the bottom up.

    Science.gov (United States)

    Schwille, Petra; Spatz, Joachim; Landfester, Katharina; Bodenschatz, Eberhard; Herminghaus, Stephan; Sourjik, Victor; Erb, Tobias; Bastiaens, Philippe; Lipowsky, Reinhard; Hyman, Anthony; Dabrock, Peter; Baret, Jean-Christophe; Vidakovic-Koch, Tanja; Bieling, Peter; Dimova, Rumiana; Mutschler, Hannes; Robinson, Tom; Tang, Dora; Wegner, Seraphine; Sundmacher, Kai

    2018-05-11

    A large Max Planck-based German research consortium ('MaxSynBio') was formed to investigate living systems from a fundamental perspective. The research program of MaxSynBio relies solely on the bottom-up approach to Synthetic Biology. MaxSynBio focuses on the detailed analysis and understanding of essential processes of life, via their modular reconstitution in minimal synthetic systems. The ultimate goal is to construct a basic living unit entirely from non-living components. The fundamental insights gained from the activities in MaxSynBio can eventually be utilized for establishing a new generation of biotechnological processes, which would be based on synthetic cell constructs that replace natural cells currently used in conventional biotechnology. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance.

    Science.gov (United States)

    Kim, Dohoon; Fiske, Brian P; Birsoy, Kivanc; Freinkman, Elizaveta; Kami, Kenjiro; Possemato, Richard L; Chudnovsky, Yakov; Pacold, Michael E; Chen, Walter W; Cantor, Jason R; Shelton, Laura M; Gui, Dan Y; Kwon, Manjae; Ramkissoon, Shakti H; Ligon, Keith L; Kang, Seong Woo; Snuderl, Matija; Vander Heiden, Matthew G; Sabatini, David M

    2015-04-16

    Cancer cells adapt their metabolic processes to support rapid proliferation, but less is known about how cancer cells alter metabolism to promote cell survival in a poorly vascularized tumour microenvironment. Here we identify a key role for serine and glycine metabolism in the survival of brain cancer cells within the ischaemic zones of gliomas. In human glioblastoma multiforme, mitochondrial serine hydroxymethyltransferase (SHMT2) and glycine decarboxylase (GLDC) are highly expressed in the pseudopalisading cells that surround necrotic foci. We find that SHMT2 activity limits that of pyruvate kinase (PKM2) and reduces oxygen consumption, eliciting a metabolic state that confers a profound survival advantage to cells in poorly vascularized tumour regions. GLDC inhibition impairs cells with high SHMT2 levels as the excess glycine not metabolized by GLDC can be converted to the toxic molecules aminoacetone and methylglyoxal. Thus, SHMT2 is required for cancer cells to adapt to the tumour environment, but also renders these cells sensitive to glycine cleavage system inhibition.

  18. Serum glycine is associated with regional body fat and insulin resistance in functionally-limited older adults.

    Directory of Open Access Journals (Sweden)

    Michael S Lustgarten

    Full Text Available Metabolic profiling may provide insight into biologic mechanisms related to age-related increases in regional adiposity and insulin resistance.The objectives of the current study were to characterize the association between mid-thigh intermuscular and subcutaneous adipose tissue (IMAT, SCAT, respectively and, abdominal adiposity with the serum metabolite profile, to identify significant metabolites as further associated with the homeostasis model assessment of insulin resistance (HOMA-IR, and, to develop a HOMA-IR associated metabolite predictor set representative of regional adiposity, in 73 functionally-limited (short physical performance battery ≤10; SPPB older adults (age range, 70-85 y.Fasting levels of 181 total metabolites, including amino acids, fatty acids and acylcarnitines were measured with use of an untargeted mass spectrometry-based metabolomic approach. Multivariable-adjusted linear regression was used in all analyses.Thirty-two, seven and one metabolite(s were found to be associated with IMAT, abdominal adiposity and, SCAT, respectively, including the amino acid glycine, which was positively associated with SCAT and, negatively associated with both IMAT and abdominal adiposity. Glycine and four metabolites found to be significantly associated with regional adiposity were additionally associated with HOMA-IR. Separate stepwise regression models identified glycine as a HOMA-IR associated marker of both IMAT (model R(2 = 0.51, p<0.0001 and abdominal adiposity (model R(2 = 0.41, p<0.0001.Our findings for a positive association between glycine with SCAT but, a negative association between glycine with IMAT and abdominal adiposity supports the hypothesis that SCAT metabolic processes are different from that found in other fat depots. In addition, because of the significant associations found between glycine with HOMA-IR, IMAT, SCAT and abdominal adiposity, our results suggest glycine as a serum biomarker of both insulin sensitivity

  19. Tip-induced domain structures and polarization switching in ferroelectric amino acid glycine

    Energy Technology Data Exchange (ETDEWEB)

    Seyedhosseini, E., E-mail: Seyedhosseini@ua.pt; Ivanov, M. [CICECO-Aveiro Institute of Materials and Department of Physics, University of Aveiro, 3810-193 Aveiro (Portugal); Bdikin, I. [TEMA and Department of Mechanical Engineering, University of Aveiro, 3810-193 Aveiro (Portugal); Vasileva, D. [Institute of Natural Sciences, Ural Federal University, 620000 Ekaterinburg (Russian Federation); Kudryavtsev, A. [Moscow State Institute of Radioengineering, Electronics and Automation, 119454 Moscow (Russian Federation); Rodriguez, B. J. [Conway Institute of Biomolecular and Biomedical Research and School of Physics, University College Dublin, Dublin (Ireland); Kholkin, A. L. [CICECO-Aveiro Institute of Materials and Department of Physics, University of Aveiro, 3810-193 Aveiro (Portugal); Institute of Natural Sciences, Ural Federal University, 620000 Ekaterinburg (Russian Federation)

    2015-08-21

    Bioorganic ferroelectrics and piezoelectrics are becoming increasingly important in view of their intrinsic compatibility with biological environment and biofunctionality combined with strong piezoelectric effect and a switchable polarization at room temperature. Here, we study tip-induced domain structures and polarization switching in the smallest amino acid β-glycine, representing a broad class of non-centrosymmetric amino acids. We show that β-glycine is indeed a room-temperature ferroelectric and polarization can be switched by applying a bias to non-polar cuts via a conducting tip of atomic force microscope (AFM). Dynamics of these in-plane domains is studied as a function of an applied voltage and pulse duration. The domain shape is dictated by polarization screening at the domain boundaries and mediated by growth defects. Thermodynamic theory is applied to explain the domain propagation induced by the AFM tip. Our findings suggest that the properties of β-glycine are controlled by the charged domain walls which in turn can be manipulated by an external bias.

  20. The use and misuse of V(c,max) in Earth System Models.

    Science.gov (United States)

    Rogers, Alistair

    2014-02-01

    Earth System Models (ESMs) aim to project global change. Central to this aim is the need to accurately model global carbon fluxes. Photosynthetic carbon dioxide assimilation by the terrestrial biosphere is the largest of these fluxes, and in many ESMs is represented by the Farquhar, von Caemmerer and Berry (FvCB) model of photosynthesis. The maximum rate of carboxylation by the enzyme Rubisco, commonly termed V c,max, is a key parameter in the FvCB model. This study investigated the derivation of the values of V c,max used to represent different plant functional types (PFTs) in ESMs. Four methods for estimating V c,max were identified; (1) an empirical or (2) mechanistic relationship was used to relate V c,max to leaf N content, (3) V c,max was estimated using an approach based on the optimization of photosynthesis and respiration or (4) calibration of a user-defined V c,max to obtain a target model output. Despite representing the same PFTs, the land model components of ESMs were parameterized with a wide range of values for V c,max (-46 to +77% of the PFT mean). In many cases, parameterization was based on limited data sets and poorly defined coefficients that were used to adjust model parameters and set PFT-specific values for V c,max. Examination of the models that linked leaf N mechanistically to V c,max identified potential changes to fixed parameters that collectively would decrease V c,max by 31% in C3 plants and 11% in C4 plants. Plant trait data bases are now available that offer an excellent opportunity for models to update PFT-specific parameters used to estimate V c,max. However, data for parameterizing some PFTs, particularly those in the Tropics and the Arctic are either highly variable or largely absent.

  1. Characterization of Natural and Simulated Herbivory on Wild Soybean (Glycine soja Seib. et Zucc. for Use in Ecological Risk Assessment of Insect Protected Soybean.

    Directory of Open Access Journals (Sweden)

    Hidetoshi Goto

    Full Text Available Insect-protected soybean (Glycine max (L. Merr. was developed to protect against foliage feeding by certain Lepidopteran insects. The assessment of potential consequences of transgene introgression from soybean to wild soybean (Glycine soja Seib. et Zucc. is required as one aspect of the environmental risk assessment (ERA in Japan. A potential hazard of insect-protected soybean may be hypothesized as transfer of a trait by gene flow to wild soybean and subsequent reduction in foliage feeding by Lepidopteran insects that result in increased weediness of wild soybean in Japan. To assess this potential hazard two studies were conducted. A three-year survey of wild soybean populations in Japan was conducted to establish basic information on foliage damage caused by different herbivores. When assessed across all populations and years within each prefecture, the total foliage from different herbivores was ≤ 30%, with the lowest levels of defoliation (< 2% caused by Lepidopteran insects. A separate experiment using five levels of simulated defoliation (0%, 10%, 25%, 50% and 100% was conducted to assess the impact on pod and seed production and time to maturity of wild soybean. The results indicated that there was no decrease in wild soybean plants pod or seed number or time to maturity at defoliation rates up to 50%. The results from these experiments indicate that wild soybean is not limited by lepidopteran feeding and has an ability to compensate for defoliation levels observed in nature. Therefore, the potential hazard to wild soybean from the importation of insect-protected soybean for food and feed into Japan is negligible.

  2. Quantitative evaluation of the biosynthetic pathways leading to δ-aminolevulinic acid from the Shemin precursor glycine via the C5 pathway in Arthrobacter hyalinus by analysis of 13C-labeled coproporphyrinogen III biosynthesized from [2-13C]glycine, [1-13C]acetate, and [2-13C]acetate using 13C NMR spectroscopy

    International Nuclear Information System (INIS)

    Katsumi Iida

    2013-01-01

    The biosynthetic pathways leading to δ-aminolevulinic acid (ALA) from the Shemin precursor glycine via the C5 pathway in Arthrobacter hyalinus were quantitatively evaluated by means of feeding experiments with [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate, followed by analysis of the labeling patterns of coproporphyrinogen III (Copro'gen III) (biosynthesized from ALA) using 13 C NMR spectroscopy. Two biosynthetic pathways leading to ALA from glycine via the C5 pathway were identified: i.e., transformation of glycine to l-serine catalyzed by glycine hydroxymethyltransferase, and glycine synthase-catalyzed catabolism of glycine to N 5 , N 10 -methylene-tetrahydrofolic acid (THF), which reacts with another molecule of glycine to afford l-serine. l-Serine is transformed to acetyl-CoA via pyruvic acid. Acetyl-CoA enters the tricarboxylic acid cycle, affording 2-oxoglutaric acid, which in turn is transformed to l-glutamic acid. The l-glutamic acid enters the C5 pathway, affording ALA in A. hyalinus. A 13 C NMR spectroscopic comparison of the labeling patterns of Copro'gen III obtained after feeding of [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate showed that [2- 13 C]glycine transformation and [2- 13 C]glycine catabolism in A. hyalinus proceed in the ratio of 52 and 48 %. The reaction of [2- 13 C]glycine and N 5 , N 10 -methylene-THF, that of glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF generated from the [2- 13 C]glycine catabolism, and that of [2- 13 C]glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF transformed the fed [2- 13 C]glycine to [1- 13 C]acetyl-CoA, [2- 13 C]acetyl-CoA, and [1,2- 13 C 2 ]acetyl-CoA in the ratios of 42, 37, and 21 %, respectively. These labeled acetyl-CoAs were then incorporated into ALA. Our results provide a quantitative picture of the pathways of biosynthetic transformation to ALA from glycine in A. hyalinus. (author)

  3. Conformational variability of the glycine receptor M2 domain in response to activation by different agonists

    DEFF Research Database (Denmark)

    Pless, Stephan Alexander; Dibas, Mohammed I; Lester, Henry A

    2007-01-01

    change. Although taurine and beta-alanine were weak partial agonists at the alpha1R19'C glycine receptor, they induced large fluorescence changes. Propofol, which drastically enhanced these currents, did not induce a glycine-like blue shift in the spectral emission peak. The inhibitors strychnine...... and picrotoxin elicited fluorescence and current changes as expected for a competitive antagonist and an open channel blocker, respectively. Glycine and taurine (or beta-alanine) also produced an increase and a decrease, respectively, in the fluorescence of a label attached to the nearby L22'C residue. Thus...

  4. Digital logic circuit design with ALTERA MAX+PLUS II

    International Nuclear Information System (INIS)

    Lee, Seung Ho; Park, Yong Su; Lee, Ju Heon

    2006-03-01

    Contents of this book are the kinds of integrated circuit, design process of integrated circuit, introduction of ALTERA MAX+PLUS II, designing logic circuit with VHDL of ALTERA MAX+PLUS II, grammar and practice of VHDL of ALTERA MAX+PLUS II, design for adder, subtractor, parallel binary subtractor, BCD design, CLA design, code converter design, ALU design, register design, counter design, accumulator design, state machine design, frequency divider design, circuit design with TENMILLION counter, LCD module, circuit design for control the outside RAM in training kit and introduction for HEB-DTK-20K-240/HBE-DTK-IOK.

  5. Glycine as Alternative Fuel in Making Hydrotalcite Compound by Means of Combustion Method

    International Nuclear Information System (INIS)

    Shamsudin, I.K.; Helwani, Z.; Abdullah, A.Z.

    2013-01-01

    Hydrotalcite is anion compound capable of exchanging ions; it has the potential as a catalyst and adsorbent for variety of applications. Hydrotalcite can be prepared through several approaches, depending on the specific need and the characteristics of the compound. In this study, hydrotalcite was prepared through combustion method using glycine as fuel for the first time. Glycine was selected as opposed to urea so that hydrotalcite is safe for use in food processing or health. Hydrotalcite that was successfully obtained via combustion technique using glycine as fuel showed interesting characteristics. The compound demonstrated high thermal endurance and highest alkalinity, which suited the application for bio diesel production from vegetable oil and hydrogenation in the making of fats. However, the surface area was low in comparison with the same compound obtained from co-precipitation and sol-gel techniques. (author)

  6. Max Reinharz (1923-2012)

    CERN Multimedia

    2013-01-01

    Max Reinharz was born in Vienna, Austria, in 1923. In 1939 he was obliged to emigrate to the UK. At the beginning of the Second World War he was interned as an enemy alien and then deported to Australia at a time when the British feared an invasion by Germany. He returned to the UK in 1943 and joined the British Army. After he was demobbed in 1947, he studied physics in Vienna, where he took his doctorate in 1953.   Max Reinharz (centre) with Gordon Munday (left) and Henri Laporte (right) in 1979. After working in Brussels, at the physics Institute of Genoa and the University of Pisa, he joined CERN in 1960 as a fellow and in 1964 became a senior physicist in the NP Division. His name is associated with many publications, such as those of the CERN neutrino experiment and the CERN-Geneva-Lund collaboration to verify T symmetry conservation in lambda decays. He then joined a small team in the Proton Synchrotron Division (MPS) responsible for assisting external physics groups to prepare and i...

  7. Carbon dioxide concentrations are very high in developing oilseeds.

    Science.gov (United States)

    Goffman, Fernando D; Ruckle, Mike; Ohlrogge, John; Shachar-Hill, Yair

    2004-09-01

    A new method has been developed to rapidly determine the total inorganic carbon concentration (gaseous [CO2] + aqueous [CO(2)] + [HCO3-] + [CO3(2)-]) in developing seeds. Seeds are rapidly dissected and homogenized in 1 N HCl in gas-tight vials. The headspace gas is then analyzed by infrared gas analysis. Developing rapeseed (Brassica napus L.) and soybean [Glycine max (L.) Merr.] seeds were analyzed and found to have up to 40 and 12 mM total inorganic carbon, respectively. These concentrations are ca. 600-2000-fold higher than in ambient air or values reported for leaves. Carbon dioxide concentrations in rapeseed peaked during the stage of maximum oil synthesis and declined as seeds matured. The consequences for seed metabolism, physiology and carbon economy are discussed.

  8. V-dotO2max prediction from multi-frequency bioelectrical impedance analysis

    International Nuclear Information System (INIS)

    Stahn, Alexander; Strobel, Günther; Terblanche, Elmarie

    2008-01-01

    Bioelectrical impedance analysis (BIA) has been shown to be highly related to skeletal muscle mass and blood volume, both of which are important determinants of maximal oxygen uptake (V-dotO 2max ). The aim of the present study was therefore to investigate the ability of whole-body and segmental multi-frequency BIA to improve current nonexercise V-dotO 2max prediction models. Data for V-dotO 2max (mL min −1 ), anthropometry, self-reported physical activity (PA-R) and BIA were collected in 115 men and women. Multiple linear regression analysis (MLR) was used to develop the most parsimonious prediction model. Segmental BIA was not superior to whole-body measurements. Correlation coefficients between V-dotO 2max and resistance indices were significantly higher at 500 kHz compared to 50 kHz (p 2max (r = 0.89). After adjusting for age, gender and PA-R, MLR revealed that the inclusion of intracellular resistance index was slightly, but significantly (p 2max ( −1 ). In short, whole-body BIA marginally improves the accuracy of nonexercise V-dotO 2max prediction models and its advantage is most pronounced in individuals with particularly low V-dotO 2max

  9. Compositions of (max, +) automata

    Czech Academy of Sciences Publication Activity Database

    Lahaye, S.; Komenda, Jan; Boimond, J.-L.

    2015-01-01

    Roč. 25, 1-2 (2015), s. 323-344 ISSN 0924-6703 R&D Projects: GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : (max,+) automata * synchronous product * asynchronous product Subject RIV: BA - General Mathematics Impact factor: 1.268, year: 2015 http://link.springer.com/article/10.1007/s10626-014-0186-6

  10. Contributions of Fusarium virguliforme and Heterodera glycines to the Disease Complex of Sudden Death Syndrome of Soybean

    Science.gov (United States)

    Westphal, Andreas; Li, Chunge; Xing, Lijuan; McKay, Alan; Malvick, Dean

    2014-01-01

    Background Sudden death syndrome (SDS) of soybean caused by Fusarium virguliforme spreads and reduces soybean yields through the North Central region of the U.S. The fungal pathogen and Heterodera glycines are difficult to manage. Methodology/Principal Findings The objective was to determine the contributions of H. glycines and F. virguliforme to SDS severity and effects on soybean yield. To quantify DNA of F. virguliforme in soybean roots and soil, a specific real time qPCR assay was developed. The assay was used on materials from soybean field microplots that contained in a four-factor factorial-design: (i) untreated or methyl bromide-fumigated; (ii) non-infested or infested with F. virguliforme; (iii) non-infested or infested with H. glycines; (iv) natural precipitation or additional weekly watering. In years 2 and 3 of the trial, soil and watering treatments were maintained. Roots of soybean ‘Williams 82’ were collected for necrosis ratings at the full seed growth stage R6. Foliar symptoms of SDS (area under the disease progress curve, AUDPC), root necrosis, and seed yield parameters were related to population densities of H. glycines and the relative DNA concentrations of F. virguliforme in the roots and soil. The specific and sensitive real time qPCR was used. Data from microplots were introduced into models of AUDPC, root necrosis, and seed yield parameters with the frequency of H. glycines and F. virguliforme, and among each other. The models confirmed the close interrelationship of H. glycines with the development of SDS, and allowed for predictions of disease risk based on populations of these two pathogens in soil. Conclusions/Significance The results modeled the synergistic interaction between H. glycines and F. virguliforme quantitatively in previously infested field plots and explained previous findings of their interaction. Under these conditions, F. virguliforme was mildly aggressive and depended on infection of H. glycines to cause highly

  11. Intramolecular synergistic effect of glutamic acid, cysteine and glycine against copper corrosion in hydrochloric acid solution

    International Nuclear Information System (INIS)

    Zhang Daquan; Xie Bin; Gao Lixin; Cai Qirui; Joo, Hyung Goun; Lee, Kang Yong

    2011-01-01

    The corrosion protection of copper by glutamic acid, cysteine, glycine and their derivative (glutathione) in 0.5 M hydrochloric acid solution has been studied by the electrochemical impedance spectroscopy and cyclic voltammetry. The inhibition efficiency of the organic inhibitors on copper corrosion increases in the order: glutathione > cysteine > cysteine + glutamic acid + glycine > glutamic acid > glycine. Maximum inhibition efficiency for cysteine reaches about 92.9% at 15 mM concentration level. The glutathione can give 96.4% inhibition efficiency at a concentration of 10 mM. The molecular structure parameters were obtained by PM3 (Parametric Method 3) semi-empirical calculation. The intramolecular synergistic effect of glutamic acid, cysteine and glycine moieties in glutathione is attributed to the lower energy of the lowest unoccupied molecular orbital (E LUMO ) level and to the excess hetero-atom adsorption centers and the bigger coverage on the copper surface.

  12. Reachability analysis for timed automata using max-plus algebra

    DEFF Research Database (Denmark)

    Lu, Qi; Madsen, Michael; Milata, Martin

    2012-01-01

    We show that max-plus polyhedra are usable as a data structure in reachability analysis of timed automata. Drawing inspiration from the extensive work that has been done on difference bound matrices, as well as previous work on max-plus polyhedra in other areas, we develop the algorithms needed...

  13. Main: 1FHF [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available oat Peroxidase; Glycine Max Molecule: Seed Coat Peroxidase; Chain: A, B, C; Engineered: Yes Oxidoreductase 1...LFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAI

  14. Melatonin potentiates glycine currents through a PLC/PKC signalling pathway in rat retinal ganglion cells.

    Science.gov (United States)

    Zhao, Wen-Jie; Zhang, Min; Miao, Yanying; Yang, Xiong-Li; Wang, Zhongfeng

    2010-07-15

    In vertebrate retina, melatonin regulates various physiological functions. In this work we investigated the mechanisms underlying melatonin-induced potentiation of glycine currents in rat retinal ganglion cells (RGCs). Immunofluorescence double labelling showed that rat RGCs were solely immunoreactive to melatonin MT(2) receptors. Melatonin potentiated glycine currents of RGCs, which was reversed by the MT(2) receptor antagonist 4-P-PDOT. The melatonin effect was blocked by intracellular dialysis of GDP-beta-S. Either preincubation with pertussis toxin or application of the phosphatidylcholine (PC)-specific phospholipase C (PLC) inhibitor D609, but not the phosphatidylinositol (PI)-PLC inhibitor U73122, blocked the melatonin effect. The protein kinase C (PKC) activator PMA potentiated the glycine currents and in the presence of PMA melatonin failed to cause further potentiation of the currents, whereas application of the PKC inhibitor bisindolylmaleimide IV abolished the melatonin-induced potentiation. The melatonin effect persisted when [Ca(2+)](i) was chelated by BAPTA, and melatonin induced no increase in [Ca(2+)](i). Neither cAMP-PKA nor cGMP-PKG signalling pathways seemed to be involved because 8-Br-cAMP or 8-Br-cGMP failed to cause potentiation of the glycine currents and both the PKA inhibitor H-89 and the PKG inhibitor KT5823 did not block the melatonin-induced potentiation. In consequence, a distinct PC-PLC/PKC signalling pathway, following the activation of G(i/o)-coupled MT(2) receptors, is most likely responsible for the melatonin-induced potentiation of glycine currents of rat RGCs. Furthermore, in rat retinal slices melatonin potentiated light-evoked glycine receptor-mediated inhibitory postsynaptic currents in RGCs. These results suggest that melatonin, being at higher levels at night, may help animals to detect positive or negative contrast in night vision by modulating inhibitory signals largely mediated by glycinergic amacrine cells in the inner

  15. Saved Leave Scheme (SLS) : Simplified procedure for the transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2001-01-01

    As part of the process of streamlining procedures, the HR and AS Divisions have jointly developed a system whereby annual and compensatory leave will henceforth be automatically transferred1) to saved leave accounts. Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'2) annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No. 22 B) can be transferred to the saved leave account at the end of the leave year (30 September). Previously, every person taking part in the scheme has been individually issued with a form for the purposes of requesting the transfer of leave to the leave account and the transfer has then had to be done manually by HR Division. To streamline the procedure, unused leave of all those taking part in the saved leave scheme at the closure of of the leave-year accounts will henceforth be transferred automatically to the saved leave account on that date. This simplification is in the ...

  16. Melanoidins extinction coefficient in the glucose/glycine Maillard reaction

    NARCIS (Netherlands)

    Martins, S.I.F.S.; Boekel, van M.A.J.S.

    2003-01-01

    Melanoidins (brown, nitrogenous polymers and co-polymers) are the final products of the Maillard reaction. The glucose/glycine melanoidins extinction coefficient was determined using C-14-labelled glucose at three different reaction conditions. The absorbance was measured at different wavelengths

  17. Paid Family Leave, Fathers' Leave-Taking, and Leave-Sharing in Dual-Earner Households.

    Science.gov (United States)

    Bartel, Anne P; Rossin-Slater, Maya; Ruhm, Christopher J; Stearns, Jenna; Waldfogel, Jane

    Using difference-in-difference and difference-in-difference-in-difference designs, we study California's Paid Family Leave (CA-PFL) program, the first source of government-provided paid parental leave available to fathers in the Unites States. Relative to the pre-treatment mean, fathers of infants in California are 46 percent more likely to be on leave when CA-PFL is available. In households where both parents work, we find suggestive evidence that CA-PFL increases both father-only leave-taking (i.e., father on leave while mother is at work) and joint leave-taking (i.e., both parents on leave at the same time). Effects are larger for fathers of first-born children than for fathers of later-born children.

  18. Max Weber and Robert Michels.

    Science.gov (United States)

    Scaff, Lawrence A.

    1981-01-01

    This paper investigates the unique intellectual partnership of Max Weber and Robert Michels, with particular emphasis on Weber's influence on Michel's inquiry into the sociology of parties and organization. Concludes with an evaluation of the import of Weber's critique of Michels' work. (DB)

  19. Effects of light quality on pod elongation in soybean (Glycine max (L.) Merr.) and cowpea (Vigna unguiculata (L.) Walp.).

    Science.gov (United States)

    Tanaka, Seiya; Ario, Nobuyuki; Nakagawa, Andressa Camila Seiko; Tomita, Yuki; Murayama, Naoki; Taniguchi, Takatoshi; Hamaoka, Norimitsu; Iwaya-Inoue, Mari; Ishibashi, Yushi

    2017-06-03

    Soybean pods are located at the nodes, where they are in the shadow, whereas cowpea pods are located outside of the leaves and are exposed to sunlight. To compare the effects of light quality on pod growth in soybean and cowpea, we measured the length of pods treated with white, blue, red or far-red light. In both species, pods elongated faster during the dark period than during the light period in all light treatments except red light treatment in cowpea. Red light significantly suppressed pod elongation in soybean during the dark and light periods. On the other hand, the elongation of cowpea pods treated with red light markedly promoted during the light period. These results suggested that the difference in the pod set sites between soybean and cowpea might account for the difference in their red light responses for pod growth.

  20. Single Channel Analysis of Isoflurane and Ethanol Enhancement of Taurine-Activated Glycine Receptors.

    Science.gov (United States)

    Kirson, Dean; Todorovic, Jelena; Mihic, S John

    2018-01-01

    The amino acid taurine is an endogenous ligand acting on glycine receptors (GlyRs), which is released by astrocytes in many brain regions, such as the nucleus accumbens and prefrontal cortex. Taurine is a partial agonist with an efficacy significantly lower than that of glycine. Allosteric modulators such as ethanol and isoflurane produce leftward shifts of glycine concentration-response curves but have no effects at saturating glycine concentrations. In contrast, in whole-cell electrophysiology studies these modulators increase the effects of saturating taurine concentrations. A number of possible mechanisms may explain these enhancing effects, including modulator effects on conductance, channel open times, or channel closed times. We used outside-out patch-clamp single channel electrophysiology to investigate the mechanism of action of 200 mM ethanol and 0.55 mM isoflurane in enhancing the effects of a saturating concentration of taurine. Neither modulator enhanced taurine-mediated conductance. Isoflurane increased the probability of channel opening. Isoflurane also increased the lifetimes of the two shortest open dwell times while both agents decreased the likelihood of occurrence of the longest-lived intracluster channel-closing events. The mechanism of enhancement of GlyR functioning by these modulators is dependent on the efficacy of the agonist activating the receptor and the concentration of agonist tested. Copyright © 2017 by The American Society for Pharmacology and Experimental Therapeutics.

  1. Max Aub, crítico e historiador literario

    Directory of Open Access Journals (Sweden)

    Francisco Caudet

    2002-11-01

    Full Text Available On the basis of similarities and dissimilarities in the consideration of authors dealt with in Discurso de la novela española contemporánea, Francisco Caudet points out Max Aub's poetics of realism stated in both his critical studies and fiction. This essay shows that Aub's contribution to the study of Mexican and Spanish literature is outstanding, not only because of his socio-historical approach, but also because of a specific perspective. This does not mean writing a "history" of literature but rather connecting creative processes. Committed during his youth to the avant-garde, Max Aub shifts after the Civil War to a type of new realistic writing. The author highlights Max Aub's activity as a critic discussing and commenting his sources. Aub's critical essays cannot be detached from his personal ideas about literary theory and practice.

  2. Applying FDTD to the Coverage Prediction of WiMAX Femtocells

    Directory of Open Access Journals (Sweden)

    Valcarce Alvaro

    2009-01-01

    Full Text Available Femtocells, or home base stations, are a potential future solution for operators to increase indoor coverage and reduce network cost. In a real WiMAX femtocell deployment in residential areas covered by WiMAX macrocells, interference is very likely to occur both in the streets and certain indoor regions. Propagation models that take into account both the outdoor and indoor channel characteristics are thus necessary for the purpose of WiMAX network planning in the presence of femtocells. In this paper, the finite-difference time-domain (FDTD method is adapted for the computation of radiowave propagation predictions at WiMAX frequencies. This model is particularly suitable for the study of hybrid indoor/outdoor scenarios and thus well adapted for the case of WiMAX femtocells in residential environments. Two optimization methods are proposed for the reduction of the FDTD simulation time: the reduction of the simulation frequency for problem simplification and a parallel graphics processing units (GPUs implementation. The calibration of the model is then thoroughly described. First, the calibration of the absorbing boundary condition, necessary for proper coverage predictions, is presented. Then a calibration of the material parameters that minimizes the error function between simulation and real measurements is proposed. Finally, some mobile WiMAX system-level simulations that make use of the presented propagation model are presented to illustrate the applicability of the model for the study of femto- to macrointerference.

  3. Application of glycine reduces arsenic accumulation and toxicity in Oryza sativa L. by reducing the expression of silicon transporter genes.

    Science.gov (United States)

    Kumar Dubey, Arvind; Kumar, Navin; Ranjan, Ruma; Gautam, Ambedkar; Pande, Veena; Sanyal, Indraneel; Mallick, Shekhar

    2018-02-01

    The present study was intended to investigate the role of amino acid glycine in detoxification of As in Oryza sativa L. The growth parameters such as, shoot length and fresh weight were decreased during As(III) and As(V) toxicity. However, the application of glycine recovered the growth parameters against As stress. The application of glycine reduced the As accumulation in all the treatments, and it was more effective against As(III) treatment and reduced the accumulation by 68% in root and 71% in shoot. Similarly, the translocation of As from root to shoot, was higher against As(III) and As(V) treatments, whereas, reduced upon glycine application. The translocation of Fe and Na was also affected by As, which was lower under As(III) and As(V) treatments. However, the application of glycine significantly enhanced the translocation of Fe and Na in the shoot. Besides, the expression of lower silicon transporters i.e. Lsi-1 and Lsi-2 was observed to be significantly suppressed in the root with the application of glycine against As treatment. Similarly, the expression of three GRX and two GST gene isoforms were found to be significantly increased with glycine application. Simultaneously, the activities of antioxidant enzymes i.e. l-arginine dependent NOS, SOD, NTR and GRX were found to be significantly enhanced in the presence of glycine. Increased activities of antioxidant enzymes coincided with the decreased level of TBARS and H 2 O 2 in rice seedlings. Overall, the results suggested that the application of glycine reduces As accumulation through suppressing the gene expression of lower silicon transporters and ameliorates As toxicity by enhancing antioxidants defense mechanism in rice seedlings. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Biochemical acclimation, stomatal limitation and precipitation patterns underlie decreases in photosynthetic stimulation of soybean (Glycine max) at elevated [CO₂] and temperatures under fully open air field conditions.

    Science.gov (United States)

    Rosenthal, David M; Ruiz-Vera, Ursula M; Siebers, Matthew H; Gray, Sharon B; Bernacchi, Carl J; Ort, Donald R

    2014-09-01

    The net effect of elevated [CO2] and temperature on photosynthetic acclimation and plant productivity is poorly resolved. We assessed the effects of canopy warming and fully open air [CO2] enrichment on (1) the acclimation of two biochemical parameters that frequently limit photosynthesis (A), the maximum carboxylation capacity of Rubisco (Vc,max) and the maximum potential linear electron flux through photosystem II (Jmax), (2) the associated responses of leaf structural and chemical properties related to A, as well as (3) the stomatal limitation (l) imposed on A, for soybean over two growing seasons in a conventionally managed agricultural field in Illinois, USA. Acclimation to elevated [CO2] was consistent over two growing seasons with respect to Vc,max and Jmax. However, elevated temperature significantly decreased Jmax contributing to lower photosynthetic stimulation by elevated CO2. Large seasonal differences in precipitation altered soil moisture availability modulating the complex effects of elevated temperature and CO2 on biochemical and structural properties related to A. Elevated temperature also reduced the benefit of elevated [CO2] by eliminating decreases in stomatal limitation at elevated [CO2]. These results highlight the critical importance of considering multiple environmental factors (i.e. temperature, moisture, [CO2]) when trying to predict plant productivity in the context of climate change. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  5. Hydrogen bonded nonlinear optical γ-glycine: Crystal growth and characterization

    Science.gov (United States)

    Narayana Moolya, B.; Jayarama, A.; Sureshkumar, M. R.; Dharmaprakash, S. M.

    2005-07-01

    Single crystals of γ-glycine(GG) were grown by solvent evaporation technique from a mixture of aqueous solutions of glycine and ammonium nitrate at ambient temperature. X-ray diffraction, thermogravimetric/differential thermal analysis, Fourier transform infrared spectral techniques were employed to characterize the crystal. The lattice parameters were calculated and they agree well with the reported values. GG exists as dipolar ions in which the carboxyl group is present as a carboxylate ion and the amino group as an ammonium ion. Due to this dipolar nature, glycine has a high decomposition temperature. The UV cutoff of GG is below 300 nm and has a wide transparency window, which is suitable for second harmonic generation of laser in the blue region. Nonlinear optical characteristics of GG were studied using Q switched Nd:YAG laser ( λ=1064 nm). The second harmonic generation conversion efficiency of GG is 1.5 times that of potassium dihydrogen phosphate . The X-ray diffraction and Fourier transform infrared spectral studies show the presence of strong hydrogen bonds which create and stabilize the crystal structure in GG. The main contributions to the nonlinear optical properties in GG results from the presence of the hydrogen bond and from the vibrational part due to very intense infrared bands of the hydrogen bond vibrations. GG is thermally stable up to 441 K.

  6. Paid Family Leave, Fathers' Leave-Taking, and Leave-Sharing in Dual-Earner Households

    OpenAIRE

    Bartel, Ann P.; Rossin-Slater, Maya; Ruhm, Christopher J.; Stearns, Jenna; Waldfogel, Jane

    2015-01-01

    This paper provides quasi-experimental evidence on the impact of paid leave legislation on fathers' leave-taking, as well as on the division of leave between mothers and fathers in dual-earner households. Using difference-in-difference and difference-in-difference-in-difference designs, we study California's Paid Family Leave (CA-PFL) program, which is the first source of government-provided paid parental leave available to fathers in the United States. Our results show that fathers in Califo...

  7. 75 FR 66352 - Glycine From the People's Republic of China: Initiation of Antidumping Anti-circumvention Inquiry

    Science.gov (United States)

    2010-10-28

    ..., submission at 5 and 6. Domestic interested parties argue that an analysis of the relevant statutory factors... merchandise imported into the United States. The domestic interested parties' analysis of these factors... sieve and then repackage the processed PRC-origin glycine for export as Indian glycine. Id at 9-10...

  8. Max Weber - bedaget og aktuel

    DEFF Research Database (Denmark)

    Eistrup, Jens

    2010-01-01

    undervisningsartiklen introducerer en række af Max Webers centrale begreber om herredømme, bureaukrati, social handlen, rationalitet og profession. dernæst illustreres hvorledes Webers begreber kan tjene til at belyse spændingsfeltet mellem politik og profession i en socialfaglig kontekst....

  9. Tunnel Effect in CNNs: Image Reconstruction From Max-Switch Locations

    DEFF Research Database (Denmark)

    de La Roche Saint Andre, Matthieu; Rieger, Laura; Hannemose, Morten

    2016-01-01

    In this paper, we show that reconstruction of an image passed through a neural network is possible, using only the locations of the max pool activations. This was demonstrated with an architecture consisting of an encoder and a decoder. The decoder is a mirrored version of the encoder, where...... convolutions are replaced with deconvolutions and poolings are replaced with unpooling layers. The locations of the max pool switches are transmitted to the corresponding unpooling layer. The reconstruction is computed only from these switches without the use of feature values. Using only the max switch...

  10. iamxt: Max-tree toolbox for image processing and analysis

    Directory of Open Access Journals (Sweden)

    Roberto Souza

    2017-01-01

    Full Text Available The iamxt is an array-based max-tree toolbox implemented in Python using the NumPy library for array processing. It has state of the art methods for building and processing the max-tree, and a large set of visualization tools that allow to view the tree and the contents of its nodes. The array-based programming style and max-tree representation used in the toolbox make it simple to use. The intended audience of this toolbox includes mathematical morphology students and researchers that want to develop research in the field and image processing researchers that need a toolbox simple to use and easy to integrate in their applications.

  11. Effects of erythrocyte infusion on VO2max at high altitude

    DEFF Research Database (Denmark)

    Young, Jette Feveile; Sawka, M N; Muza, S R

    1996-01-01

    This study investigated whether autologous erythrocyte infusion would ameliorate the decrement in maximal O2 uptake (VO2max) experienced by lowlanders when they ascend to high altitude. VO2max was measured in 16 men (treadmill running) at sea level (SL) and on the 1st (HA1) and 9th (HA9) days...... of high-altitude (4,300 m) residence. After VO2max was measured at SL, subjects were divided into two matched groups (n = 8). Twenty-four hours before ascent to high altitude, the experimental group received a 700-ml infusion of autologous erythrocytes and saline (42% hematocrit), whereas the control...... group received only saline. The VO2max of erythrocyte-infused [54 +/- 1 (SE) ml.kg-1.min-1] and control subjects (52 +/- 2 ml.kg-1.min-1) did not differ at SL before infusion. The decrement in VO2max on HA1 did not differ between groups, averaging 26% overall, despite higher (P

  12. The critical mission of glycine as a surfactant in the improvement of structural, morphological and optoelectronic features of CdO films

    Science.gov (United States)

    Aydin, Raşit

    2018-05-01

    The main aim of this study is to examine the effect of glycine as a surfactant agent on the physical properties of CdO films. For this purpose nanostructured CdO films with and without different glycine aggregations (0.5, 1.0 and 2.0 M %) were synthesized on glass bases by SILAR technique. The morphological, structural and optical characteristics of these films have been investigated using MM, SEM, XRD and UV-visible spectroscopy respectively. The MM results showed homogeneous and smooth all films. The SEM graphs showed that by using different glycine concentrations as surfactant, the particle thickness decreased from 366.25 nm to 241.10 nm. XRD results showed that the all CdO films with glycine display a (111) and (200) preferential orientations similar to that of the CdO film without glycine. The direct band gap energy of these films is found to increase from 2.05 to 2.35 eV with increasing the glycine concentration in the bath solution.

  13. GABA and glycine as neurotransmitters: a brief history.

    Science.gov (United States)

    Bowery, N G; Smart, T G

    2006-01-01

    gamma-Aminobutyric acid (GABA) emerged as a potentially important brain chemical just over 50 years ago, but its significance as a neurotransmitter was not fully realized until over 16 years later. We now know that at least 40% of inhibitory synaptic processing in the mammalian brain uses GABA. Establishing its role as a transmitter was a lengthy process and it seems hard to believe with our current knowledge that there was ever any dispute about its role in the mammalian brain. The detailed information that we now have about the receptors for GABA together with the wealth of agents which facilitate or reduce GABA receptor mechanisms make the prospects for further research very exciting. The emergence of glycine as a transmitter seems relatively painless by comparison to GABA. Perhaps this is appropriate for the simplest of transmitter structures! Its discovery within the spinal cord and brainstem approximately 40 years ago was followed only 2 years later by the proposal that it be conferred with 'neurotransmitter' status. It was another 16 years before the receptor was biochemically isolated. Now it is readily accepted as a vital spinal and supraspinal inhibitory transmitter and we know many details regarding its molecular structure and trafficking around neurones. The pharmacology of these receptors has lagged behind that of GABA. There is not the rich variety of allosteric modulators that we have come to readily associate with GABA receptors and which has provided us with a virtual treasure trove of important drugs used in anxiety, insomnia, epilepsy, anaesthesia, and spasticity, all stemming from the actions of the simple neutral amino acid GABA. Nevertheless, the realization that glycine receptors are involved in motor reflexes and nociceptive pathways together with the more recent advent of drugs that exhibit some subtype selectivity make the goal of designing selective therapeutic ligands for the glycine receptor that much closer.

  14. Glycine post-synthetic modification of MIL-53(Fe) metal-organic framework with enhanced and stable peroxidase-like activity for sensitive glucose biosensing.

    Science.gov (United States)

    Dong, Wenfei; Yang, Liaoyuan; Huang, Yuming

    2017-05-15

    A facile and rapid post-synthetic strategy was proposed to prepare a glycine functionalized MIL-53(Fe), namely glycine-MIL-53(Fe), by a simple mixing of water dispersible MIL-53(Fe) and glycine. The FT-IR, SEM, XRD and zeta potential were used to characterize the glycine-MIL-53(Fe). The result showed that glycine post-synthetic modification of MIL-53(Fe) did not change in the morphology and crystal structure of MIL-53(Fe). Interestingly, compared with MIL-53(Fe), the glycine-MIL-53(Fe) exhibits an enhanced peroxidase-like activity, which could catalyze the oxidation of TMB by H 2 O 2 to produce an intensive color reaction. Kinetic analysis indicated that the K m of glycine-MIL-53(Fe) for TMB was one-tenth of that of MIL-53(Fe). The glycine-MIL-53(Fe) as peroxidase mimetic displays better stability under alkaline or acidic conditions than MIL-53(Fe). The good performance of glycine-MIL-53(Fe) over MIL-53(Fe) may be attributed to the increase of affinity between TMB and the glycine-MIL-53(Fe). With these characteristics, a simple and sensitive method was developed for the detection of H 2 O 2 and glucose. The linear detection range for H 2 O 2 is 0.10-10μM with a detection limit of 49nM, and glucose could be linearly detected in the range from 0.25 to 10μM with a detection limit of 0.13μM. The proposed method was successfully used for glucose detection in human serum samples. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Antibody conjugated glycine doped polyaniline nanofilms as efficient biosensor for atrazine

    Science.gov (United States)

    Bhardwaj, Sanjeev K.; Sharma, Amit L.; Kim, Ki-Hyun; Deep, Akash

    2017-12-01

    Atrazine is an important member of triazine family of pesticides. The development of its detection methods gained great attention due to the potential health risks associated with its contamination in various media including water, soil, and food. The contamination of atrazine in drinking water beyond the legal permissible limit of EPA (e.g. 3 ng ml-1) may cause various damages to living organisms (e.g. heart, urinary, and limb defects). In this research, we discuss the potential significance of a highly sensitive conductometric immunosensor for sensing the atrazine pesticide. To this end, electrochemical assembly of glycine doped polyaniline (PAni) nanofilms on silicon (Si) substrate was built and modified further with anti-atrazine antibodies. The herein developed immunosensor offered highly sensitive detection of atrazine with a low detection limit of 0.07 ng ml-1. The proposed biosensor was simple in design with excellent performance in terms of its sensitivity, stability and specificity. Highlights •Glycine doped PAni nanofilms have been electropolymerized on Silicon substrates. •Functionality of the above thin films provides opportunity to develop an immunosensing platform. •Highly sensitive and specific detection of atrazine has been realized over a wide concentration range with a LOD of 0.07 ng ml-1. Novelty statement Atrazine is a widely used pesticide in the agriculture sector. It is highly recommended to develop simple biosensing systems for enabling the prospect of routine monitoring. The present research for the first time proposes the design of a glycine doped PAni based simple and highly effective biosensor for the atrazine pesticide. The doping of glycine has easily generated functional groups on the nano-PAni material for further convenient immobilization of anti-atrazine antibodies. The proposed sensor can be highlighted with advantages like ease of fabrication, use of environment friendly functionalization agent, specificity, wide

  16. In vivo NMR analysis of incorporation of [2-13C] glycine into silk fibroin

    International Nuclear Information System (INIS)

    Asakura, Tetsuo; Nagashima, Mariko; Demura, Makoto; Osanai, Minoru.

    1990-01-01

    The biosynthetic mechanism of silk fibroin in silkworms, Bombyx mori, is unique because this fibrous protein composed mainly of glycine, alanine and serine is produced very rapidly in large quantity in the posterior silk glands. It is very meaningful to investigate into the biosynthesis of silk protein under nondestructive condition by in vivo NMR and C-13 labeling techniques. The sugar metabolism related to the production of silk fibroin was analyzed by monitoring the change in the C-13 labeled peaks in the NMR spectra for silkworms. In this paper, the monitoring of the 2-(C-13) glycine metabolism in Bombyx mori by the C-13 NMR in vivo is reported. In particular, the in vivo transport of glycine from the midgut to the posterior silk gland was measured, and the rate constants were determined with the course of the peak intensity in the C-13 NMR spectra. It is possible to discuss quantitatively the in vivo production of silk fibroin with these rate constants. The experiment and the results are reported. The in vivo C-13 NMR spectra of a 5 day old, 5th instar larva of Bombyx mori after the oral administration of 2-(C-13) glycine are shown. The significant increase of the peak intensity occurred. (K.I.)

  17. Exposure to the proton scavenger glycine under alkaline conditions induces Escherichia coli viability loss.

    Directory of Open Access Journals (Sweden)

    Donna Vanhauteghem

    Full Text Available Our previous work described a clear loss of Escherichia coli (E. coli membrane integrity after incubation with glycine or its N-methylated derivatives N-methylglycine (sarcosine and N,N-dimethylglycine (DMG, but not N,N,N-trimethylglycine (betaine, under alkaline stress conditions. The current study offers a thorough viability analysis, based on a combination of real-time physiological techniques, of E. coli exposed to glycine and its N-methylated derivatives at alkaline pH. Flow cytometry was applied to assess various physiological parameters such as membrane permeability, esterase activity, respiratory activity and membrane potential. ATP and inorganic phosphate concentrations were also determined. Membrane damage was confirmed through the measurement of nucleic acid leakage. Results further showed no loss of esterase or respiratory activity, while an instant and significant decrease in the ATP concentration occurred upon exposure to either glycine, sarcosine or DMG, but not betaine. There was a clear membrane hyperpolarization as well as a significant increase in cellular inorganic phosphate concentration. Based on these results, we suggest that the inability to sustain an adequate level of ATP combined with a decrease in membrane functionality leads to the loss of bacterial viability when exposed to the proton scavengers glycine, sarcosine and DMG at alkaline pH.

  18. Exposure to the Proton Scavenger Glycine under Alkaline Conditions Induces Escherichia coli Viability Loss

    Science.gov (United States)

    Vanhauteghem, Donna; Janssens, Geert Paul Jules; Lauwaerts, Angelo; Sys, Stanislas; Boyen, Filip; Cox, Eric; Meyer, Evelyne

    2013-01-01

    Our previous work described a clear loss of Escherichia coli (E. coli) membrane integrity after incubation with glycine or its N-methylated derivatives N-methylglycine (sarcosine) and N,N-dimethylglycine (DMG), but not N,N,N-trimethylglycine (betaine), under alkaline stress conditions. The current study offers a thorough viability analysis, based on a combination of real-time physiological techniques, of E. coli exposed to glycine and its N-methylated derivatives at alkaline pH. Flow cytometry was applied to assess various physiological parameters such as membrane permeability, esterase activity, respiratory activity and membrane potential. ATP and inorganic phosphate concentrations were also determined. Membrane damage was confirmed through the measurement of nucleic acid leakage. Results further showed no loss of esterase or respiratory activity, while an instant and significant decrease in the ATP concentration occurred upon exposure to either glycine, sarcosine or DMG, but not betaine. There was a clear membrane hyperpolarization as well as a significant increase in cellular inorganic phosphate concentration. Based on these results, we suggest that the inability to sustain an adequate level of ATP combined with a decrease in membrane functionality leads to the loss of bacterial viability when exposed to the proton scavengers glycine, sarcosine and DMG at alkaline pH. PMID:23544135

  19. WiMAX security and quality of service an end-to-end perspective

    CERN Document Server

    Tang, Seok-Yee; Sharif, Hamid

    2010-01-01

    WiMAX is the first standard technology to deliver true broadband mobility at speeds that enable powerful multimedia applications such as Voice over Internet Protocol (VoIP), online gaming, mobile TV, and personalized infotainment. WiMAX Security and Quality of Service, focuses on the interdisciplinary subject of advanced Security and Quality of Service (QoS) in WiMAX wireless telecommunication systems including its models, standards, implementations, and applications. Split into 4 parts, Part A of the book is an end-to-end overview of the WiMAX architecture, protocol, and system requirements.

  20. Germinação de sementes e crescimento de plântulas de soja (Glycine max L. Merrill sob cobertura vegetal = Soybean (Glycine max L. Merrill seed germination and plantlet growth under vegetation cover

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Pereira Nóbrega

    2009-07-01

    Full Text Available A eficiência do sistema de rotação de cultura requer, entre outrostratamentos, a escolha adequada das espécies a serem instaladas. Culturas vegetais podem apresentar compostos aleloquímicos, os quais são liberados por meio de pelos radiculares, sementes, raízes, colmos e folhas, em quantidades variáveis, capazes de interferir nas culturas subsequentes, comprometendo a produção. Assim, este estudoanalisou o potencial alelopático de aveia-preta (Avena strigosa Schreb (AP, nabo forrageiro (Raphanus sativus L. (NF, ervilhaca (Vicia sativa L. (ER, azevém (Lolium multiflorum Lam. (AZ e consórcio (CO - AP+ER+NF na germinação de sementes e crescimento de plântulas de soja. O experimento foi em laboratório, com substrato deareia, onde foram cultivadas plantas de cobertura, por 30 dias, mantendo os restos radiculares das plantas com e sem restos de parte aérea. Observou-se redução na emergência de plântulas de soja sob CO, AZ e AP. O índice de velocidade de emergência (IVE, a porcentagem de emergência em areia (EA e a massa fresca de hipocótilo (MFH foram afetados negativamente pelas plantas de cobertura.In order to be efficient, the crop rotation system requires, among other factors, an adequate choice of species to be installed. Vegetalcultures can feature allelochemical compounds, released by root hairs, roots, stems and leaves in variable amounts, which are able to interfere on subsequent cultures, as well as cause a delay in their production. Thus, this study analyzed the allelopathic potentialof black oat (Avena strigosa Schreb (BO, forage turnip (Raphanus sativus L. (FT, vetch (Vicia sativa L. (V, ryegrass (Lolium multiflorum Lam. (RG and consortium (CO - BO+V+FT on soybean seed germination and plantlet growth. This trial was carried out in a laboratory, with sand substrate, where coverage plants were grown, during 30 days. The remaining root portions of plants were kept with and without the remaining aerial part portions

  1. Glycine assisted synthesis of flower-like TiO2 hierarchical spheres and its application in photocatalysis

    International Nuclear Information System (INIS)

    Tao, Yu-gui; Xu, Yan-qiu; Pan, Jun; Gu, Hao; Qin, Chang-yun; Zhou, Peng

    2012-01-01

    Graphical abstract: Flower-like anatase TiO 2 hierarchical spheres assembled by nanosheets were synthesized by glycine assistant via a simple hydrothermal approach and after-annealing process. The obtained TiO 2 sample showed good photocatalytic activity of decomposition of methyl orange under sunlight. Highlights: ► Flower-like TiO 2 hierarchical spheres were synthesized by glycine assistant. ► Reaction time, temperature, solution pH and glycine dosage were studied. ► The formation of the flower-like TiO 2 spheres is an Ostwald ripening process. ► Flower-like TiO 2 showed high photocatalytic activity under sunlight. - Abstract: Flower-like anatase TiO 2 hierarchical spheres assembled by nanosheets were synthesized by glycine assistant via a simple hydrothermal approach and after-annealing process. These flower-like spheres are about 2 μm in diameter with sheet thickness about 20 nm. Results showed reaction time, temperature, solution pH and glycine dosage all played an important role in control of shape and size of the as-synthesized TiO 2 nanocrystals. The photocatalytic activity of this nano-TiO 2 was evaluated by the photocatalytic oxidation decomposition of methyl orange under sunlight illumination in the presence of hydrogen peroxide (H 2 O 2 ). The photocatalytic activity of the obtained TiO 2 was higher than that of commercial TiO 2 .

  2. The ribose and glycine Maillard reaction in the interstellar medium ...

    Indian Academy of Sciences (India)

    WINTEC

    mechanics are briefly addressed in this work. Keywords. Density functional computational study; ribose; glycine; Maillard reaction; gaseous phase .... following the total mass balance of the reaction. Thus, ..... Jalbout A F Origin Life Evol. Biosph ...

  3. A short period undulator for MAX

    International Nuclear Information System (INIS)

    Ahola, H.; Meinander, T.

    1992-01-01

    A hybrid undulator for generation of high brilliance synchrotron radiation in the photon energy range of 60--600 eV at the 550 MeV electron storage ring MAX in Lund, Sweden has been designed and built at the Technical Research Centre of Finland in close collaboration with MAX-lab of Lund University. At the rather modest electron energy of MAX this photon energy range can be reached only by an undulator featuring a fairly short period and the smallest possible magnetic gap. Even then, higher harmonics (up to the 13th) of the radiation spectrum must be utilized. An optimization of the magnetic design resulted in a hybrid configuration of NdFeB magnets and soft iron poles with a period of 24 mm and a minimum magnetic gap of 7--10 mm. A variable-gap vacuum chamber allows reduction of the vacuum gap from a maximum of 20 mm, needed for injection, down to 6 mm during stored beam operation. A special design of this chamber permits a magnetic gap between pole tips that is only 1 mm larger than the vacuum gap. Adequate field uniformity was ensured by calibration of magnets to equal strength at their true operating point and verification of the homogeneity of their magnetization. Magnetic measurements included Hall probe scans of the undulator field and flip coil evaluations of the field integral

  4. Radiation processing and functional properties of soybean (Glycine max)

    International Nuclear Information System (INIS)

    Pednekar, Mrinal; Das, Amit K.; Rajalakshmi, V; Sharma, Arun

    2010-01-01

    Effect of radiation processing (10, 20 and 30 kGy) on soybean for better utilization was studied. Radiation processing reduced the cooking time of soybean and increased the oil absorption capacity of soy flour without affecting its proximate composition. Irradiation improved the functional properties like solubility, emulsification activity and foam stability of soybean protein isolate. The value addition effect of radiation processing has been discussed for the products (soy milk, tofu and tofu fortified patties) prepared from soybean.

  5. Nodulin gene expression during soybean (Glycine max) nodule development.

    NARCIS (Netherlands)

    Gloudemans, T.; Vries, de S.; Bussink, H.J.; Malik, N.S.A.; Franssen, H.; Louwerse, J.; Bisseling, T.

    1987-01-01

    In vitro translation products of total RNA isolated from soybean nodules at successive stages of nodule development were analyzed by two-dimensional gel electrophoresis. In that way the occurrence of over 20 mRNAs specifically transcribed from nodulin genes was detected. The nodulin genes could be

  6. Radiation induced mutagenesis in soybean (Glycine Max L. Merrill)

    International Nuclear Information System (INIS)

    Wakode, M.M.; Nandanwar, R.S.; Patil, G.P.

    2000-01-01

    The mutagenic effects of gamma rays (10, 20 and 30 kR) on some biological parameter in M1 generation and frequency and spectrum of chlorophyll and morphological mutations in five cultivars of soybean viz. JS-8021, JS-335, JS- 7105, Monetta and PKV -1 have been studied. A dose dependant decrease was noticed in most of the characters like root length, shoot length, germination, plant height, plant survival and pollen sterility. While seedling height, number of seeds per pod and number of branches per plant were not affected significantly. The highest frequency and spectrum of chlorophyll and morphological mutations was noticed in variety JS-8021 in which 20 different gene loci for various characters were mutated. However variety JS- 7105 showed less radio sensitive response for different traits in which only 12 different loci were mutated. While JS-335, monetta and PKV-I showed moderate response to frequency and spectrum of various mutations. These varieties showed differential response to radio sensitivity, some useful mutations included, high yielding mutant in 20 kR, non shattering mutant in 30 kR and vine type mutant in 10 kR in variety monetta. Extra early type, erect and high branched type mutant were recorded with high frequency in 10 and 20 kR respectively in variety JS-8021. In general, 20 kR dose was found more effective in all the varieties studied. (author)

  7. Common sunflower (Helianthus annuus) interference in soybean (Glycine max)

    International Nuclear Information System (INIS)

    Geier, P.W.; Maddux, L.D.; Moshier, L.J.; Stahlman, P.W.

    1996-01-01

    Multiple weed species in the field combine to cause yield losses and can be described using one of several empirical models. Field studies were conducted to compare observed corn yield loss caused by common sunflower and shattercane populations with predicted yield losses modeled using a multiple species rectangular hyperbola model, an additive model, or the yield loss model in the decision support system, WeedSOFT, and to derive competitive indices for common sunflower and shattercane. Common sunflower and shattercane emerged with corn and selected densities established in field experiments at Scandia and Rossville, KS, between 2000 and 2002. The multiple species rectangular hyperbola model fit pooled data from three of five location–years with a predicted maximum corn yield loss of 60%. Initial slope parameter estimate for common sunflower was 49.2 and 4.2% for shattercane. A ratio of these estimates indicated that common sunflower was 11 times more competitive than shattercane. When common sunflower was assigned a competitive index (CI) value of 10, shattercane CI was 0.9. Predicted yield losses modeled for separate common sunflower or shattercane populations were additive when compared with observed yield losses caused by low-density mixed populations of common sunflower (0 to 0.5 plants m −2 ) and shattercane (0 to 4 plants m −2 ). However, a ratio of estimates of these models indicated that common sunflower was only four times as competitive as shattercane, with a CI of 2.5 for shattercane. The yield loss model in WeedSOFT underpredicted the same corn losses by 7.5%. Clearly, both the CI for shattercane and the yield loss model in WeedSOFT need to be reevaluated, and the multiple species rectangular hyperbola model is proposed. (author)

  8. Antioxidant and Antimicrobial properties of Glycine Max-A review

    OpenAIRE

    Babu Shankar Ponnusha, Sathiyamoorthy Subramaniyam, Palanisamy Pasupathi, Boopathi subramaniyam, Rajaram Virumandy, Int J Cur Bio Med Sci.

    2011-01-01

    Vegetable soybean is rich in phytochemicals beneficial to the human being and is therefore considered a neutraceutical or a functional food crop. Soybean as a “functional food” that reduces the risk of range of hazardous diseases like atherosclerosis, osteoporosis, various types of cancer (breast, uterus cancer, and prostrate) has attracted people’s attention across the globe. People in India are becoming increasingly aware about the health benefits of consuming soy food. Although isoflavones...

  9. Analysis of resource use efficiency among soybean ( Glycine max ...

    African Journals Online (AJOL)

    Also, 87.5% of the farmers were in their active age, and 81.7% utilized their personal saving as a major source of finance for production. The result of the production function analysis indicated that 87.21% of the variation in the output of soybean is explained for by the independent variables. Resource-use efficiency ...

  10. Soybean (Glycine max) oil bodies and their associated phytochemicals.

    Science.gov (United States)

    Fisk, Ian D; Gray, David A

    2011-01-01

    Soybean oil bodies were isolated from 3 cultivars (Ustie, K98, and Elena) and the occurrence of 2 classes of phytochemicals (tocopherol isoforms and isoflavones) and strength of their association with isolated oil bodies was evaluated. Tocopherol is shown to be closely associated with soybean oil bodies; δ-tocopherol demonstrated a significantly greater association with oil bodies over other tocopherol isoforms. Isoflavones do not show a significant physical association with oil bodies, although there is some indication of a passive association of the more hydrophobic aglycones during oil body isolation. Oil bodies are small droplets of oil that are stored as energy reserves in the seeds of oil seeds, and have the potential to be used as future food ingredients. If oil body suspensions are commercialized on a large scale, knowledge of the association of phytochemicals with oil bodies will be valuable in deciding species of preference and predicting shelf life and nutritional value. © 2011 Institute of Food Technologists®

  11. Intercrop performance of different varieties of soybean (Glycine Max ...

    African Journals Online (AJOL)

    ONOS

    2010-12-13

    Dec 13, 2010 ... (TGX 1894-3E, medium maturing variety), gave the highest grain yield of Soybean and fresh tuber yield of cassava at 12MAP,. Key words: ... basic component of cropping systems in many areas of south eastern Nigeria. ... and aquatic environment, increased soil acidity and highly selective transport or ...

  12. MK-801, but not drugs acting at strychnine-insensitive glycine receptors, attenuate methamphetamine nigrostriatal toxicity.

    Science.gov (United States)

    Layer, R T; Bland, L R; Skolnick, P

    1993-10-15

    Repeated administration of methamphetamine (METH) results in damage to nigrostriatal dopaminergic neurons. Both competitive N-methyl-D-aspartate (NMDA) receptor antagonists and use-dependent cation channel blockers attenuate METH-induced damage. The objectives of the present study were to examine whether comparable reductions in METH-induced damage could be obtained by compounds acting at strychnine-insensitive glycine receptors on the NMDA receptor complex. Four injections of METH (5 mg/kg i.p.) resulted in a approximately 70.9% depletion of striatal dopamine (DA) and approximately 62.7% depletion of dihydroxyphenylacetic acid (DOPAC) content, respectively. A significant protection against METH-induced DA and DOPAC depletion was afforded by the use-dependent channel blocker, MK-801. The competitive glycine antagonist 7-chlorokynurenic acid (7-Cl-KA), the low efficacy glycine partial agonist (+)-3-amino-1-hydroxy-2-pyrrolidone ((+)-HA-966), and the high efficacy partial glycine agonist 1-aminocyclopropane-carboxylic acid (ACPC) were ineffective against METH-induced toxicity despite their abilities to attenuate glutamate-induced neurotoxicity under both in vivo and in vitro conditions. These results indicate that glycinergic ligands do not possess the same broad neuroprotective spectrum as other classes of NMDA antagonists.

  13. Estimated VO2max and its corresponding velocity predict performance of amateur runners

    Directory of Open Access Journals (Sweden)

    Bruno Ribeiro Ramalho Oliveira

    2012-03-01

    Full Text Available In recent years, there has been a substantial increase in the number of runners, with a proportional increase in their involvement in amateur street competition. Identification of the determinants of performance in this population appears necessary for optimization of time devoted to training. The objective of this study was to ascertain the association between estimated maximal oxygen uptake (VO2max, critical velocity (CV and VO2max velocity (VVO2max and athletic performance in the 3.6 km (uphill and 10 and 21.1 km (flatland events. Twelve amateur runners (nine male, mean age 36 ± 5 years underwent five tests: 1 and 5 km race on level ground, 3.6 km race with slope (≈8%, and indirect VO2max measurement. CV was determined from the linear relationship between distance and run time on the first two tests. The subjects then took part in two official 10 km and 21.1 km (half marathon races. VVO2max was calculated from the VO2max through a metabolic equation. VO2max showed the best association with running performance in the 10 and 21.1 km events. For the uphill race, VVO2max showed a better association. Overall, the variable with the highest average association was VO2max (0.91±0.07, followed by VVO2max (0.90±0.04 and VC (0.87±0.06. This study showed strong associations between physiological variables established by low-cost, user-friendly indirect methods and running performance in the 10 and 21.1 km (flatland and 3.6 km (uphill running events.

  14. O pensamento de Max Weber

    Directory of Open Access Journals (Sweden)

    Maurício Tragtenberg

    1966-06-01

    Full Text Available Max Weber inicia sua carreira universitária em 1893, como professor extraordinário de Direito Mercantil e Romano, na Universidade de Berlim. Em 1894 assume a Cadeira de Economia Política na Universidade de Hamburgo e em 1897 leciona na Universidade de Heidelberg.

  15. Electrochemical Performance of LixMn2-yFeyO4-zClz Synthesized Through In-Situ Glycine Nitrate Combustion

    Science.gov (United States)

    2016-06-13

    Electrochemical Performance of LixMn2-yFeyO4-zClz Synthesized Through In-Situ Glycine Nitrate Combustion Ashley L. Ruth, Paula C. Latorre, and...sites as well as the formation of Mn3+ ions via the Jahn- Teller effect. The use of the glycine nitrate combustion synthesis produces small particles at...advantage of submicron ceramic synthesis, namely the glycine nitrate combustion process (GNP), we propose the capability for in-situ B-site doping

  16. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI

  17. Synthetic and mechanistic insight into nosylation of glycine residues

    DEFF Research Database (Denmark)

    Stuhr-Hansen, Nicolai; Sølling, Theis Ivan; Strømgaard, Kristian

    2013-01-01

    The Fukuyama-Mitsunobu alkylation procedure is widely used to introduce alkyl substituents to amino groups in general and N-alkylation of peptides in particular. Here we have investigated the procedure in detail for N-alkylation of peptides with N-terminal glycine residues, based on the observati...

  18. Taking Leave?

    CERN Multimedia

    2000-01-01

    Planning a holiday? Then if you're a member of the personnel, you'll need to use the Laboratory's new leave system that will be put in place on 1 October. Leave allocations don't change - you are entitled to just as much holiday as before - but instead of being credited annually, your leave will be credited on a monthly basis, and this information will be communicated on your salary slip. The reason for the change is that with the various new leave schemes such as Recruitment by Saved Leave (RSL) and the Progressive Retirement Programme (PRP), a streamlined procedure was required for dealing with all kinds of leave. In the new system, each member of the personnel will have leave accounts to which leave will be credited monthly from the payroll and debited each time an absence is registered in the CERN Electronic Document Handling system (EDH). Leave balances will appear on monthly pay slips, and full details of leave transactions and balances will be available through EDH at all times. As the leave will be c...

  19. Glycine: an alternative transmitter candidate of the pallidosubthalamic projection neurons in the rat

    International Nuclear Information System (INIS)

    Takada, M.; Hattori, T.

    1987-01-01

    Autoradiographic retrograde tracing techniques with radioactive transmitters were used to analyse the identity of a putative transmitter in the rat pallidosubthalamic (GP-STN) pathway. One to 2 hours after the stereotaxic injection of 3 H-glycine restricted to the STN, a large number of neuronal somata were radiolabeled in the GP. No comparable labeling was observed following the injection of 3 H-gamma-aminobutyric acid ( 3 H-GABA) into the same nucleus even with survival times as long as 6 hours. Specifically, no significant somatic labeling was detected either in the GP or in the caudoputamen (CPU). Only when 3 H-GABA was injected into the substantia nigra did CPU and GP neurons become labeled. On the contrary, STN neuronal somata were invariably labeled 6 hours after the intrapallidal injection of 3 H-GABA, whereas no perikaryal labeling was observed in the STN after 3 H-glycine injection into the GP. The perikaryal labeling was prevented in all cases by intraventricular administration of colchicine 1 day before the isotope injections. The observations suggest that 3 H-glycine was preferentially transported retrogradely through the GP-STN pathway, and 3 H-GABA through the STN-GP projection. In view of the recent controversy on the role of GABA as a putative transmitter of the GP-STN projection, we now propose glycine as an alternative transmitter candidate of these critically situated neurons in the basal ganglia

  20. Optimal resampling for the noisy OneMax problem

    OpenAIRE

    Liu, Jialin; Fairbank, Michael; Pérez-Liébana, Diego; Lucas, Simon M.

    2016-01-01

    The OneMax problem is a standard benchmark optimisation problem for a binary search space. Recent work on applying a Bandit-Based Random Mutation Hill-Climbing algorithm to the noisy OneMax Problem showed that it is important to choose a good value for the resampling number to make a careful trade off between taking more samples in order to reduce noise, and taking fewer samples to reduce the total computational cost. This paper extends that observation, by deriving an analytical expression f...

  1. L-arginine and glycine supplementation in the repair of the irradiated colonic wall of rats.

    Science.gov (United States)

    de Aguiar Picanço, Etiene; Lopes-Paulo, Francisco; Marques, Ruy G; Diestel, Cristina F; Caetano, Carlos Eduardo R; de Souza, Mônica Vieira Mano; Moscoso, Gabriela Mendes; Pazos, Helena Maria F

    2011-05-01

    Radiotherapy is widely used for cancer treatment but has harmful effects. This study aimed to assess the effects of L-arginine and glycine supplementation on the colon wall of rats submitted to abdominal irradiation. Forty male Wistar rats were randomly divided into four groups: I-healthy, II-irradiated with no amino acid supplementation, III-irradiated and supplemented with L-arginine, and IV-irradiated and supplemented with glycine. The animals received supplementation for 14 days, with irradiation being applied on the eighth day of the experiment. All animals underwent laparotomy on the 15th day for resection of a colonic segment for stereologic analysis. Parametric and nonparametric tests were used for statistical analysis, with the level of significance set at p ≤0.05. Stereologic analysis showed that irradiation induced a reduction of the total volume of the colon wall of group II and III animals compared to healthy controls, but not of group IV animals supplemented with glycine. The mucosal layer of the irradiated animals of all groups was reduced compared to healthy group I animals, but supplementation with L-arginine and glycine was effective in maintaining the epithelial surface of the mucosal layer. The present results suggest that glycine supplementation had a superior effect on the irradiated colon wall compared to L-arginine supplementation since it was able to maintain the thickness of the wall and the epithelial surface of the mucosa, whereas L-arginine maintained the partial volume of the epithelium and the epithelial surface, but not the total volume of the intestinal wall.

  2. Max Reinhardt Haus Berliini / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    1998-01-01

    Arhitekt Peter Eisenmani projekteeritud multifunktsionaalne maja on planeeritud II maailmasõjas hävinud Max Reinhardti teatrihoone kohale. Ühte hoonetahukasse kui uude maamärki on 'volditud' kokku aktiivse linnaelu kõik aspektid.

  3. Influence of foliar application of glycine betaine on gas exchange characteristics of cotton (gossypium Hirsutum L.)

    International Nuclear Information System (INIS)

    Makhdum, M.I.; Din, S.U.

    2007-01-01

    Water is the most limiting factor in cotton production and numerous efforts are being made to improve crop drought tolerance. A field study was conducted with the objectives to determine the effects of different application rates of glycine betaine in field grown cotton at Central Cotton Research Institute, Multan. Four levels of glycine betaine (0.0, 1.0, 3.0 and 6.0 kg ha-1) were applied at three physiological growth stages i.e. at squaring, first flower and peak flowering. Cotton cultivar CIM-448 was used as test crop. Results showed that crop sprayed with glycine betaine at the rate of 6.0 kg ha-1 maintained 120.0, 62.1, 69.7 and 35.5 percent higher net CO/sub 2/ assimilation rate (PN), transpiration rate (E), stomatal resistance (gs) and water use efficiency (PN/E), respectively over that of untreated crop. Crop spayed with glycine betaine at peak flowering stage maintained higher PN, E, gs and PN/E compared to at other stages of growth. (author)

  4. Synthesis and Characterization of Chromium (III) Complexes with L-Glutamic Acid, Glycine and LCysteine

    OpenAIRE

    Kun Sri Budiasih; Chairil Anwar; Sri Juari Santosa; Hilda Ismail

    2013-01-01

    Some Chromium (III) complexes were synthesized with three amino acids: L Glutamic Acid, Glycine, and L-cysteine as the ligands, in order to provide a new supplement containing Cr(III) for patients with type 2 diabetes mellitus. The complexes have been prepared by refluxing a mixture of Chromium(III) chloride in aqueous solution with L-glutamic acid, Glycine, and L-cysteine after pH adjustment by sodium hydroxide. These complexes were characterized by Infrared and Uv-Vis s...

  5. Teste de lixiviação de potássio para avaliação do vigor de sementes de soja [Glycine max (L.Merril] Potassium leaching test for the evaluation of soybean seed vigour

    Directory of Open Access Journals (Sweden)

    D.C.F.S. Dias

    1995-12-01

    Full Text Available O presente trabalho teve como objetivo principal investigar a possibilidade de se obter indicações rápidas sobre a qualidade fisiológica de sementes de soja através do teste de lixiviação de potássio, cuja eficiência foi avaliada comparativamente as informações fornecidas por outros métodos considerados adequados para a determinação do vigor. Para tanto, utilizou-se quatro lotes de sementes de soja dos cultivares IAC-8 e IAC-15 que foram submetidos aos testes de germinação, primeira contagem de germinação, envelhecimento artificial, condutividade elétrica e determinação do grau de umidade. Além destes foram conduzidos estudos de lixiviação de potássio utilizando-se amostras de sementes não danificadas e de sementes fisicamente puras. A quantidade de potássio lixiviado foi avaliada em fotômetro de chama após 60, 90, 120 e 150 minutos de embebição a 30ºC. As avaliações feitas aos 60, 90 e 120 minutos mostraram-se adequadas para a identificação de lotes com diferentes níveis de vigor, constituindo-se em um método simples e rápido para a avaliação da qualidade fisiológica das sementes.This work was performed to investigate the possibilities of providing rapid indications on the physiological quality of seeds through the potassium leaching test. Four lots of soybean (Glycine max (L. Merrill seeds, cultivars IAC-8 and IAC-15 were submitted to germination, first count, accelerated aging, electrical conductivity and seed moisture tests. In addition, studies on potassium leaching were conducted with samples of selected non damaged seeds and with pure seeds. The amount of leached potassium was evaluated in a flame photometer after a 60, 90, 120 and 150 minute imbibition at 30°C. The evaluations after 60, 90 and 120 minutes were suitable for the identification of lots with different levels of vigour, thus proving to be a simple and rapid method for seed vigour evaluation.

  6. An improved synthesis of α-13C glycine and heteronuclear NMR studies of its incorporation into thioredoxin

    International Nuclear Information System (INIS)

    Wishart, D.S.; Sykes, B.D.; Richards, F.M.

    1992-01-01

    We present an improved method to easily prepare gram quantities of α- 13 C glycine beginning from K 13 CN. The four step synthesis involves the production of an N, N-diphenyl-cyanoformamidine intermediate through the coupling of cyanide to N, N-diphenylcarbodiimide. Subsequent reduction by LiAlH 4 and hydrolysis of the resulting amidine produces fully enriched α- 13 C labelled glycine with a 45-50% yield. This relatively fast and simple synthesis uses only commonly available compounds and requires no special equipment, making the process easy to perform in any well equipped biochemistry laboratory. We further demonstrate that the product may be used, without extensive purification, to specifically label bacterially expressed proteins (E. coli thioredoxin) through standard biosynthetic procedures. We also show that the 13 C glycine-labelled protein may be readily analyzed using commonly available heteronuclear NMR techniques. Complete assignments for all 9 glycines of native E. coli thoredoxin are presented. (Author)

  7. Glyphosate and AMPA inhibit cancer cell growth through inhibiting intracellular glycine synthesis.

    Science.gov (United States)

    Li, Qingli; Lambrechts, Mark J; Zhang, Qiuyang; Liu, Sen; Ge, Dongxia; Yin, Rutie; Xi, Mingrong; You, Zongbing

    2013-01-01

    Glycine is a nonessential amino acid that is reversibly converted from serine intracellularly by serine hydroxymethyltransferase. Glyphosate and its degradation product, aminomethylphosphonic acid (AMPA), are analogs to glycine, thus they may inhibit serine hydroxymethyltransferase to decrease intracellular glycine synthesis. In this study, we found that glyphosate and AMPA inhibited cell growth in eight human cancer cell lines but not in two immortalized human normal prostatic epithelial cell lines. AMPA arrested C4-2B and PC-3 cancer cells in the G1/G0 phase and inhibited entry into the S phase of the cell cycle. AMPA also promoted apoptosis in C4-2B and PC-3 cancer cell lines. AMPA upregulated p53 and p21 protein levels as well as procaspase 9 protein levels in C4-2B cells, whereas it downregulated cyclin D3 protein levels. AMPA also activated caspase 3 and induced cleavage of poly (adenosine diphosphate [ADP]-ribose) polymerase. This study provides the first evidence that glyphosate and AMPA can inhibit proliferation and promote apoptosis of cancer cells but not normal cells, suggesting that they have potentials to be developed into a new anticancer therapy.

  8. Resposta da soja (Glycine max (L. Merrill à ação de bioestimulante = Soybean (Glycine max (L. Merrill response to biostimulant action

    Directory of Open Access Journals (Sweden)

    Celestina Alflen Klahold

    2006-04-01

    Full Text Available Objetivando verificar o efeito do bioestimulante, Stimulate®, aplicado via semente e pulverização foliar, na cultura da soja, conduziu-se um experimento sob ambiente protegido, em vasos. O delineamento foi de blocos casualizados, com 4 repetições. Os tratamentos constaram da combinação de doses de bioestimulate, aplicadas via semente (0, 3 e 5 mL kg-1 de sementes na semeadura e via foliar (0,0; 0,075; 0,150 e 0,225 mL L-1, aos 58 dias após a emergência (DAE. Realizaram-se coletas de plantas aos 73 e 129 DAE.Para algumas das variáveis estudadas, nas doses utilizadas, houve efeito negativo na resposta à aplicação de bioestimulante, para algumas doses testadas. Respostas positivas foram verificadas para massa seca de flores, raízes, razão raiz/parte aérea, número de flores, vagens e grãos e produção por planta. Destacaram-se positivamente os tratamentos: 0,0 mL 0,5 kg-1 (AS + 0,150 mL L-1 (APF; 3,0 mL 0,5 kg-1 (AS + 0,0 mL L-1 (APF; 3,0 mL 0,5 kg-1 (AS+ 0,225 mL L-1 (APF e 5,0 mL 0,5 kg-1 (AS + 0,075 mL L-1 (APF.Aiming to verify the effect of the bioestimulant, Stimulate®, applied saw by seed and leaf pulverization, in the culture of the soybean. It behaved an experiment under greenhouse, in vases. Randomized block experimental design was used, with four repetitions. The treatments consisted of the combination of bioestimulant doses: seed application (SA (0; 3; and 5 mL kg-1 of seeds in the sowing and leaf spray (LS (0.0; 0.075; 0.150; and 0.225 mL L- 1, to the 58 days after the emergency (DAE. Collections of plants were accomplished to the 73 and 129 DAE. For some of the studied variables, in the used doses, there was negative effect in the response of the biostimulant application, for some tested doses. Positives responses were verified for flowers and roots dry mass; root/shoot relation; flowers; beans and grains number; and yield for plant. They stood out the treatments: 0,0 mL 0.5 kg-1 (SA + 0.150 mL L-1 (LS; 3.0 mL 0.5 kg-1 (SA + 0.0 mL L-1 (LS; 3.0 mL 0.5 kg-1 (SA + 0.225 mL L-1 (LS; and 5.0 mL 0.5 kg-1 (SA + 0.075 mL L-1 (LS.

  9. Sensibilidade de cultivares de soja (Glycine max aos herbicidas diclosulam e flumetsulam Soybean (Glycine max cultivars sensibility to the herbicides diclosulam and flumetsulam

    Directory of Open Access Journals (Sweden)

    Célio R. F. Leite

    2000-01-01

    Full Text Available O objetivo deste trabalho foi verificar, no campo, no município de Londrina-PR, a resposta de 12 cultivares de soja em relação aos herbicidas diclosulam e flumetsulam aplicados e incorporados em Latossolo Roxo distrófico (80,84 % de argila, pH 5,4 e matéria orgânica 3,07 %. As cultivares foram: 'FT-Guaira', 'Embrapa-48', 'Ocepar-14', 'BR-16', 'Embrapa-4', 'Ocepar-13', 'BR-36', 'FT10-Princesa', 'FT-2000', 'FTAbyara', 'BR-37' e 'RS7- Jacuí'. O diclosulam foi utilizado nas doses de 35 g/ha (normal e 70 g/ha (dobrada; e o flumetsulam nas doses de 120 g/ha (normal e 240 g/ha (dobrada; também foi utilizada a mistura de diclosulam + flumetsulam (20 + 100 g/ha; e imazaquin à 150 g/ha. Nas doses normais utilizadas dos dois herbicidas não foi possível distinguir nenhuma cultivar suscetível. Em dose dobrada do diclosulam os rendimentos das cultivares 'FT-Guaira', 'Embrapa 4' e 'BR-37 ' foram reduzidos em 20,9 %, 11,8 % e 11,0 % respectivamente, em relação à testemunha. O flumetsulam à 240 g/ha e sua mistura com diclosulam também reduziu o rendimento destas cultivares, mais o da 'Ocepar-14'. A maioria das cultivares teve o estande reduzido, nas doses dobradas dos dois herbicidas, mas também sem significância. Somente o estande da cultivar 'Embrapa-48' não foi afetado, ao contrário da 'RS-7 Jacuí'. A altura de plantas foi menor em relação à testemunha no tratamento com flumetsulam à 240 g/ha. Na maioria das cultivares o peso da biomassa seca de nódulos foi menor nas doses dobradas, e em algumas também o peso por unidade de nódulos. A biomassa seca da parte aérea e da raiz não foram reduzidas.The objective of the present paper was to check the behaviour of 12 different soybean cultivars in relation to the tolerance to the herbicides flumetsulam and diclosulam applied on a soil classified as Latossolo Roxo distrófico (80,87% of clay, pH of 5,4 and 3,07 of organic matter in Londrina - PR. The cultivars were: 'FTGuaira', 'Embrapa-48', 'Ocepar-14', 'BR-16', 'Embrapa-4', 'Ocepar-13', 'BR-36', 'FT 10- Princesa', 'FT-2000', 'FT-Abyara', 'BR-37' and 'RS 7-Jacuí'. Diclosulam was used in the rates of 35 g/ha (normal rate and 70 g/ha (double rate and flumetsulam in the rates of 120 g and 240 g/ha (normal and double rate respectively. It was also used a mix of diclosulam and flumetsulam (20 + 100 g/ha and imazaquin at 150 g/ha. At the normal rates of both herbicides it was not poss to find any difference in suscetibily of the cultivars. At double rates of diclosulam the yields of 'FT-Guaira', 'Embrapa-4'and 'BR-37' were reduced in 20,9%, 11,8% and 11,0%, respectively, in relation to the check. Flumetsulam at 240 g/ha and its mix with diclosulam also reduced the yields of these cultivars, plus "Ocepar-14'. The major of the cultivars showed a reduced stand at the double rates of the both herbicides, but without significance. Only the stand of 'Embrapa- 48' was not affected, contrary to 'RS 7-Jacuí'. The plant height was reduced by flumetsulam at 240 g/ha. In all cultivars the nodule dry biomass was reduced in double rates, and in some of them the weight per unit of nodule. The dry biomass of aerial port and roots werw nor reduced.

  10. Protein (Viridiplantae): 850873 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available OC100796589 Glycine max MEETSWEQRVQALTHILTSPTTTPSLHSQFFIATQIPCYLNWDYPPFLCSSNPQLLK...803:12853 ... 3814:12853 ... 163735:5410 ... 3846:8024 1462606:8024 3847:8024 ... PREDICTED: uncharacterized protein L

  11. 5 CFR 630.1204 - Intermittent leave or reduced leave schedule.

    Science.gov (United States)

    2010-01-01

    ... insurance, health benefits, retirement coverage, and leave accrual). (e) The agency shall determine the... REGULATIONS ABSENCE AND LEAVE Family and Medical Leave § 630.1204 Intermittent leave or reduced leave schedule... reduced leave schedule unless the employee and the agency agree to do so. (b) Leave under § 630.1203(a) (3...

  12. Beyond NextGen: AutoMax Overview and Update

    Science.gov (United States)

    Kopardekar, Parimal; Alexandrov, Natalia

    2013-01-01

    Main Message: National and Global Needs - Develop scalable airspace operations management system to accommodate increased mobility needs, emerging airspace uses, mix, future demand. Be affordable and economically viable. Sense of Urgency. Saturation (delays), emerging airspace uses, proactive development. Autonomy is Needed for Airspace Operations to Meet Future Needs. Costs, time critical decisions, mobility, scalability, limits of cognitive workload. AutoMax to Accommodate National and Global Needs. Auto: Automation, autonomy, autonomicity for airspace operations. Max: Maximizing performance of the National Airspace System. Interesting Challenges and Path Forward.

  13. Glycine-containing selective medium for isolation of Legionellaceae from environmental specimens.

    Science.gov (United States)

    Wadowsky, R M; Yee, R B

    1981-11-01

    Glycine, at a final concentration of 0.3%, has been shown to be an excellent selective agent for the isolation of Legionellaceae. Stock cultures of Legionella pneumophila were not inhibited on buffered charcoal-yeast extract agar containing the amino acid. Among the other Legionellaceae tested, only one of two strains of L. dumoffii and two of six strains of L. micdadei were appreciably inhibited. This medium permitted the isolation of L. pneumophila from environmental specimens with marked inhibition of many non-Legionellaceae bacteria. The selectivity of the medium was subsequently improved by the incorporation of vancomycin (5 microgram/ml) and polymyxin B (100 U/ml). This selective medium, glycine-vancomycin-polymyxin B agar, should facilitate the recovery of Legionellaceae from environmental sources.

  14. Equine acquired multiple acyl-CoA dehydrogenase deficiency (MADD) in 14 horses associated with ingestion of Maple leaves (Acer pseudoplatanus) covered with European tar spot (Rhytisma acerinum).

    Science.gov (United States)

    van der Kolk, J H; Wijnberg, I D; Westermann, C M; Dorland, L; de Sain-van der Velden, M G M; Kranenburg, L C; Duran, M; Dijkstra, J A; van der Lugt, J J; Wanders, R J A; Gruys, E

    2010-01-01

    This case-series describes fourteen horses suspected of equine acquired multiple acyl-CoA dehydrogenase deficiency (MADD) also known as atypical myopathy of which seven cases were confirmed biochemically with all horses having had access to leaves of the Maple tree (Acer pseudoplatanus) covered with European tar spot (Rhytisma acerinum). Assessment of organic acids, glycine conjugates, and acylcarnitines in urine was regarded as gold standard in the biochemical diagnosis of equine acquired multiple acyl-CoA dehydrogenase deficiency. Copyright © 2010 Elsevier Inc. All rights reserved.

  15. Pre-synaptic glycine GlyT1 transporter--NMDA receptor interaction: relevance to NMDA autoreceptor activation in the presence of Mg2+ ions.

    Science.gov (United States)

    Musante, Veronica; Summa, Maria; Cunha, Rodrigo A; Raiteri, Maurizio; Pittaluga, Anna

    2011-05-01

    Rat hippocampal glutamatergic terminals possess NMDA autoreceptors whose activation by low micromolar NMDA elicits glutamate exocytosis in the presence of physiological Mg(2+) (1.2 mM), the release of glutamate being significantly reduced when compared to that in Mg(2+)-free condition. Both glutamate and glycine were required to evoke glutamate exocytosis in 1.2 mM Mg(2+), while dizocilpine, cis-4-[phosphomethyl]-piperidine-2-carboxylic acid and 7-Cl-kynurenic acid prevented it, indicating that occupation of both agonist sites is needed for receptor activation. D-serine mimicked glycine but also inhibited the NMDA/glycine-induced release of [(3H]D-aspartate, thus behaving as a partial agonist. The NMDA/glycine-induced release in 1.2 mM Mg(2+) strictly depended on glycine uptake through the glycine transporter type 1 (GlyT1), because the GlyT1 blocker N-[3-(4'-fluorophenyl)-3-(4'-phenylphenoxy)propyl])sarcosine hydrochloride, but not the GlyT2 blocker Org 25534, prevented it. Accordingly, [(3)H]glycine was taken up during superfusion, while lowering the external concentration of Na(+), the monovalent cation co-transported with glycine by GlyT1, abrogated the NMDA-induced effect. Western blot analysis of subsynaptic fractions confirms that GlyT1 and NMDA autoreceptors co-localize at the pre-synaptic level, where GluN3A subunits immunoreactivity was also recovered. It is proposed that GlyT1s coexist with NMDA autoreceptors on rat hippocampal glutamatergic terminals and that glycine taken up by GlyT1 may permit physiological activation of NMDA pre-synaptic autoreceptors. © 2011 The Authors. Journal of Neurochemistry © 2011 International Society for Neurochemistry.

  16. Elastic and Mechanical Properties of the MAX Phases

    Science.gov (United States)

    Barsoum, Michel W.; Radovic, Miladin

    2011-08-01

    The more than 60 ternary carbides and nitrides, with the general formula Mn+1AXn—where n = 1, 2, or 3; M is an early transition metal; A is an A-group element (a subset of groups 13-16); and X is C and/or N—represent a new class of layered solids, where Mn+1Xn layers are interleaved with pure A-group element layers. The growing interest in the Mn+1AXn phases lies in their unusual, and sometimes unique, set of properties that can be traced back to their layered nature and the fact that basal dislocations multiply and are mobile at room temperature. Because of their chemical and structural similarities, the MAX phases and their corresponding MX phases share many physical and chemical properties. In this paper we review our current understanding of the elastic and mechanical properties of bulk MAX phases where they differ significantly from their MX counterparts. Elastically the MAX phases are in general quite stiff and elastically isotropic. The MAX phases are relatively soft (2-8 GPa), are most readily machinable, and are damage tolerant. Some of them are also lightweight and resistant to thermal shock, oxidation, fatigue, and creep. In addition, they behave as nonlinear elastic solids, dissipating 25% of the mechanical energy during compressive cycling loading of up to 1 GPa at room temperature. At higher temperatures, they undergo a brittle-to-plastic transition, and their mechanical behavior is a strong function of deformation rate.

  17. Evaluation of iron transport from ferrous glycinate liposomes using ...

    African Journals Online (AJOL)

    Background: Iron fortification of foods is currently a strategy employed to fight iron deficiency in countries. Liposomes were assumed to be a potential carrier of iron supplements. Objective: The objective of this study was to investigate the iron transport from ferrous glycinate liposomes, and to estimate the effects of liposomal ...

  18. Microspectroscopy At Beamline 73 MAX-lab

    International Nuclear Information System (INIS)

    Engdahl, Anders

    2010-01-01

    Presentation of some projects at the infrared microspectroscopy experimental station at beamline 73 MAX-lab. Among the subjects are found identification of organic residues in fossil material and examination of the chemistry in an old oak wood wreck.

  19. Analisis Kinerja Subscriber Station WiMAX di Urban Area Bandung

    Directory of Open Access Journals (Sweden)

    DWI ARYANTA

    2017-06-01

    Full Text Available ABSTRAK   Teknologi komunikasi wireless semakin pesat mengalami perkembangan. WiMAX  merupakan suatu teknologi broadband yang didukung oleh standar IEEE 802.16d (802.16-2004 yang mampu memberikan layanan data berkecepatan tinggi hingga 75 Mbps dalam radius maksimal 40-50 km pada bandwidth 20 MHz. Alokasi frekuensi yang dipakai Indonesia untuk jaringan WiMAX  ini ialah 3,3 – 3,4 GHz. Penelitian ini dilakukan dengan melakukan proses pengukuran kinerja perangkat radio WiMAX  yaitu HiMax 331-SS. Proses pengukuran dilakukan antara CPE dan base station dengan antenna sektoral 1200 pada ketinggian 45 m. Lokasi pengukuran dilakukan di beberapa area kota Bandung yang telah ditentukan sebelumnya. Hasil pengukuran memperlihatkan nilai CINR tertinggi adalah 31 dB dengan modulasi 64 QAM – ¾ dan terendah nilai 10 dB dengan modulasi BPSK 1/2. Nilai RSSI tertinggi -54 dBm berada dan nilai RSSI terendah -89 dBm. Nilai throughput tertinggi untuk layanan streaming video sebesar  1000,8 kbps (downlink dengan modulasi 64 QAM – ¾. Nilai delay terendah sebesar 56,247 ms pada kondisi LOS dan tertinggi sebesar 139,5 ms pada kondisi NLOS. Nilai terbesar packet loss sebesar 20% yaitu pada lokasi pengukuran terjauh 14,3 km. Kata Kunci : delay, packet loss, RSSI, CINR, throughput, CPE, WiMAX .   ABSTRACT   Wireless communication technologies have evolved more rapidly. WiMAX  is a broadband technology that is supported by the IEEE standard 802.16-2004/d which is able to provide high speed data services of up to 75 Mbps within a radius of 40-50 km at a maximum bandwidth of 20 MHz. Indonesia frequency allocation used for the WiMAX  network is 3.3 to 3.4 GHz. This study was conducted with the performance measurement process that is Himax 331 WiMAX  radio - SS. Process measurement is made between the CPE and base station sector antennas at a height of 45 m in 1200. Locations measurements performed in several areas of Bandung predetermined. The measurement

  20. Low-temperature phase transition in γ-glycine single crystal. Pyroelectric, piezoelectric, dielectric and elastic properties

    Energy Technology Data Exchange (ETDEWEB)

    Tylczyński, Zbigniew, E-mail: zbigtyl@amu.edu.pl [Faculty of Physics, Adam Mickiewicz University, Umultowska 85, 61-614 Poznań (Poland); Busz, Piotr [Institute of Molecular Physics, Polish Academy of Science, Smoluchowskiego 17, 60-179 Poznań (Poland)

    2016-11-01

    Temperature changes in the pyroelectric, piezoelectric, elastic and dielectric properties of γ-glycine crystals were studied in the range 100 ÷ 385 K. The pyroelectric coefficient increases monotonically in this temperature range and its value at RT was compared with that of other crystals having glycine molecules. A big maximum in the d14 component of piezoelectric tensor compared by maximum in attenuation of the resonant face-shear mode were observed at 189 K. The components of the elastic stiffness tensor and other components of the piezoelectric tensor show anomalies at this temperature. The components of electromechanical coupling coefficient determined indicate that γ-glycine is a weak piezoelectric. The real and imaginary part of the dielectric constant measured in the direction perpendicular to the trigonal axis show the relaxation anomalies much before 198 K and the activation energies were calculated. These anomalies were interpreted as a result of changes in the NH{sub 3}{sup +} vibrations through electron-phonon coupling of the so called “dynamical transition”. The anomalies of dielectric constant ε*{sub 11} and piezoelectric tensor component d{sub 14} taking place at 335 K are associated with an increase in ac conductivity caused by charge transfer of protons. - Graphical abstract: Imaginary part of dielectric constant in [100] direction. - Highlights: • Piezoelectric, elastic and dielectric constants anomalies were discovered at 189 K. • These anomalies were interpreted as a result of so called “dynamical transition”. • Relaxational dielectric anomaly was explained by the dynamics of glycine molecules. • Pyroelectric coefficient of γ-glycine was determined in a wide temperature range. • Complex dielectric & piezoelectric anomalies at 335 K were caused by protons hopping.

  1. Sequence-specific DNA binding by MYC/MAX to low-affinity non-E-box motifs.

    Directory of Open Access Journals (Sweden)

    Michael Allevato

    Full Text Available The MYC oncoprotein regulates transcription of a large fraction of the genome as an obligatory heterodimer with the transcription factor MAX. The MYC:MAX heterodimer and MAX:MAX homodimer (hereafter MYC/MAX bind Enhancer box (E-box DNA elements (CANNTG and have the greatest affinity for the canonical MYC E-box (CME CACGTG. However, MYC:MAX also recognizes E-box variants and was reported to bind DNA in a "non-specific" fashion in vitro and in vivo. Here, in order to identify potential additional non-canonical binding sites for MYC/MAX, we employed high throughput in vitro protein-binding microarrays, along with electrophoretic mobility-shift assays and bioinformatic analyses of MYC-bound genomic loci in vivo. We identified all hexameric motifs preferentially bound by MYC/MAX in vitro, which include the low-affinity non-E-box sequence AACGTT, and found that the vast majority (87% of MYC-bound genomic sites in a human B cell line contain at least one of the top 21 motifs bound by MYC:MAX in vitro. We further show that high MYC/MAX concentrations are needed for specific binding to the low-affinity sequence AACGTT in vitro and that elevated MYC levels in vivo more markedly increase the occupancy of AACGTT sites relative to CME sites, especially at distal intergenic and intragenic loci. Hence, MYC binds diverse DNA motifs with a broad range of affinities in a sequence-specific and dose-dependent manner, suggesting that MYC overexpression has more selective effects on the tumor transcriptome than previously thought.

  2. The radiation stability of glycine in solid CO2 - In situ laboratory measurements with applications to Mars

    Science.gov (United States)

    Gerakines, Perry A.; Hudson, Reggie L.

    2015-05-01

    The detection of biologically important, organic molecules on Mars is an important goal that may soon be reached. However, the current small number of organic detections at the martian surface may be due to the harsh UV and radiation conditions there. It seems likely that a successful search will require probing the subsurface of Mars, where penetrating cosmic rays and solar energetic particles dominate the radiation environment, with an influence that weakens with depth. Toward the goal of understanding the survival of organic molecules in cold radiation-rich environments on Mars, we present new kinetics data on the radiolytic destruction of glycine diluted in frozen carbon dioxide. Rate constants were measured in situ with infrared spectroscopy, without additional sample manipulation, for irradiations at 25, 50, and 75 K with 0.8-MeV protons. The resulting half-lives for glycine in CO2-ice are compared to previous results for glycine in H2O-ice and show that glycine in CO2-ice is much less stable in a radiation environment, with destruction rate constants ∼20-40 times higher than glycine in H2O-ice. Extrapolation of these results to conditions in the martian subsurface results in half-lives estimated to be less than 100-200 Myr even at depths of a few meters.

  3. WiMAX technology and network evolution

    CERN Document Server

    Etemad, Kamran

    2010-01-01

    WiMAX, the Worldwide Interoperability for Microwave Access, represents a paradigm shift in telecommunications technology. It offers the promise of cheaper, smaller, and simpler technology compared to existing broadband options such as DSL, cable, fiber, and 3G wireless.

  4. Pharmacological characterisation of strychnine and brucine analogues at glycine and alpha7 nicotinic acetylcholine receptors

    DEFF Research Database (Denmark)

    Jensen, Anders A.; Gharagozloo, Parviz; Birdsall, Nigel J M

    2006-01-01

    of tertiary and quaternary analogues as well as bisquaternary dimers of strychnine and brucine at human alpha1 and alpha1beta glycine receptors and at a chimera consisting of the amino-terminal domain of the alpha7 nicotinic receptor (containing the orthosteric ligand binding site) and the ion channel domain...... of strychnine and brucine, none of the analogues displayed significant selectivity between the alpha1 and alpha1beta subtypes. The structure-activity relationships for the compounds at the alpha7/5-HT3 chimera were significantly different from those at the glycine receptors. Most strikingly, quaternization...... of strychnine and brucine with substituents possessing different steric and electronic properties completely eliminated the activity at the glycine receptors, whereas binding affinity to the alpha7/5-HT3 chimera was retained for the majority of the quaternary analogues. This study provides an insight...

  5. Nanostructured plasma etched, magnetron sputtered nanolaminar Cr2AlC MAX phase thin films

    International Nuclear Information System (INIS)

    Grieseler, Rolf; Hähnlein, Bernd; Stubenrauch, Mike; Kups, Thomas; Wilke, Marcus; Hopfeld, Marcus; Pezoldt, Jörg; Schaaf, Peter

    2014-01-01

    The knowledge of the mechanical properties of new materials determines essentially their usability and functionality when used in micro- and nanostructures. MAX phases are new and highly interesting materials due to their unique combination of materials properties. In this article a new method for producing the Cr 2 AlC MAX phase is presented. Thin film elemental multilayer deposition and subsequent rapid thermal annealing forms the MAX phase within seconds. Additionally, free standing microstructures (beams and cantilevers) based on this MAX phase films are prepared by plasma etching. The mechanical properties of these MAX phase microstructures are investigated

  6. Influence of soil-extractable aluminium and pH on the uptake of aluminium from soil into the soybean plant (Glycine max).

    Science.gov (United States)

    Dong, D; Thornton, I; Ramsey, M H

    1993-09-01

    The effects of soil pH and other soil properties on the uptake of AI by soybean plants have been investigated in a greenhouse experiment. Six soils were compared that were developed over six contrasting bedrock types ranging widely in their AI content and other chemical and physical characteristics, namely Oxford Clay, Chalk, Lower Lias Clay, Devonian Shale, Granite and Lower Greensand. Soil pH varied naturally between soil types and each soil was also amended to give two other pH levels using elemental sulphur and/or calcium carbonate. AI concentrations in various parts of the soybean plants were determined by ICP-AES after acid digestion. The AI solubility in the soils and hence its availability to the plants was estimated using a number of different reagents designed to extract different forms of AI.The AI concentration measured in the soybean leaves was found to be predicted most accurately by the 'available' AI extracted from soils by 0.02 M CaCl2. The relationship appears to the linear, with a correlation coefficient of 0.97 (p <0.01). The AI content of the leaves increases with decreasing soil pH. The relationship is non-linear with a marked increase in leaf AI for soils with pH <4.4. The amounts of 'plant-available' AI in the soils extracted with 0.02 M CaCl2 was much less than that extracted with 0.05 M EDTA, although both increased markedly with decreasing soil pH. The amount of AI measured in the soybean plants was directly related to both the 'available' forms of AI in the soils, and also to the pH of the soils. Soil pH was identified as a major factor that controls the uptake of Al from soil into the soybean plant.

  7. Max Jakobson : Vene ohtu täna veel pole / Max Jakobson ; interv. Vallo Toomet, Urmet Kook, Kaarel Tarand

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013

    2003-01-01

    Balti riikide NATOga liitumise mõjust julgeolekule Läänemere regioonis, Euroopa Liidu kaitsepoliitikast ning Venemaa ja islamiterrorismi ohust julgeolekule. Vt. samas: Toomas Hiio ülevaade Max Jakobsoni elust ja tegevusest

  8. Investigation of the structural anisotropy in a self-assembling glycinate layer on Cu(100) by scanning tunneling microscopy and density functional theory calculations

    Energy Technology Data Exchange (ETDEWEB)

    Kuzmin, Mikhail [Surface Science Laboratory, Optoelectronics Research Centre, Tampere University of Technology, P.O. Box 692, FI-33101 Tampere (Finland); Ioffe Physical Technical Institute, Russian Academy of Sciences, 26 Polytekhnicheskaya, St Petersburg 194021 (Russian Federation); Lahtonen, Kimmo; Vuori, Leena [Surface Science Laboratory, Optoelectronics Research Centre, Tampere University of Technology, P.O. Box 692, FI-33101 Tampere (Finland); Sánchez-de-Armas, Rocío [Materials Theory Division, Department of Physics and Astronomy, Uppsala University, P.O. Box 516, S75120 Uppsala (Sweden); Hirsimäki, Mika, E-mail: mikahirsi@gmail.com [Surface Science Laboratory, Optoelectronics Research Centre, Tampere University of Technology, P.O. Box 692, FI-33101 Tampere (Finland); Valden, Mika [Surface Science Laboratory, Optoelectronics Research Centre, Tampere University of Technology, P.O. Box 692, FI-33101 Tampere (Finland)

    2017-07-01

    Highlights: • Deprotonation reaction of glycine and self-assembly of glycinate is observed on Cu. • Bias-dependent scanning tunneling microscopy indicates two glycinate geometries. • Density functional theory calculations confirm the two non-identical configurations. • Non-identical adsorption explains the anisotropy in adlayer’s electronic structure. - Abstract: Self-assembling organic molecule-metal interfaces exhibiting free-electron like (FEL) states offers an attractive bottom-up approach to fabricating materials for molecular electronics. Accomplishing this, however, requires detailed understanding of the fundamental driving mechanisms behind the self-assembly process. For instance, it is still unresolved as to why the adsorption of glycine ([NH{sub 2}(CH{sub 2})COOH]) on isotropic Cu(100) single crystal surface leads, via deprotonation and self-assembly, to a glycinate ([NH{sub 2}(CH{sub 2})COO–]) layer that exhibits anisotropic FEL behavior. Here, we report on bias-dependent scanning tunneling microscopy (STM) experiments and density functional theory (DFT) calculations for glycine adsorption on Cu(100) single crystal surface. We find that after physical vapor deposition (PVD) of glycine on Cu(100), glycinate self-assembles into an overlayer exhibiting c(2 × 4) and p(2 × 4) symmetries with non-identical adsorption sites. Our findings underscore the intricacy of electrical conductivity in nanomolecular organic overlayers and the critical role the structural anisotropy at molecule-metal interface plays in the fabrication of materials for molecular electronics.

  9. LTE, WiMAX and WLAN network design, optimization and performance analysis

    CERN Document Server

    Korowajczuk, Leonhard

    2011-01-01

    A technological overview of LTE and WiMAX LTE, WiMAX and WLAN Network Design, Optimization and Performance Analysis provides a practical guide to LTE and WiMAX technologies introducing various tools and concepts used within. In addition, topics such as traffic modelling of IP-centric networks, RF propagation, fading, mobility, and indoor coverage are explored; new techniques which increase throughput such as MIMO and AAS technology are highlighted; and simulation, network design and performance analysis are also examined. Finally, in the latter part of the book Korowajczuk gives a step-by-step

  10. Toughening Mechanisms in Nanolayered MAX Phase Ceramics—A Review

    Directory of Open Access Journals (Sweden)

    Xinhua Chen

    2017-03-01

    Full Text Available Advanced engineering and functional ceramics are sensitive to damage cracks, which delay the wide applications of these materials in various fields. Ceramic composites with enhanced fracture toughness may trigger a paradigm for design and application of the brittle components. This paper reviews the toughening mechanisms for the nanolayered MAX phase ceramics. The main toughening mechanisms for these ternary compounds were controlled by particle toughening, phase-transformation toughening and fiber-reinforced toughening, as well as texture toughening. Based on the various toughening mechanisms in MAX phase, models of SiC particles and fibers toughening Ti3SiC2 are established to predict and explain the toughening mechanisms. The modeling work provides insights and guidance to fabricate MAX phase-related composites with optimized microstructures in order to achieve the desired mechanical properties required for harsh application environments.

  11. The development of a differential game related to terrorism: Min-Max differential game

    Directory of Open Access Journals (Sweden)

    Abd El-Monem A. Megahed

    2017-07-01

    Full Text Available In this work, we study a differential game related to terrorism: Min-Max differential game taking into account the governmental activities such as the education quality, increasing the chances of labor, social justice, religious awareness and security arrangements. A Min-Max differential game between government and terrorist organizations is considered in this study. To obtain the optimal strategy of solving this problem, we study the analytic form of a Min-Max differential game and the governmental activities. Furthermore, a saddle point of a Min-Max differential game is studied.

  12. maxAlike

    DEFF Research Database (Denmark)

    Menzel, Karl Peter; Stadler, Peter F.; Gorodkin, Jan

    2011-01-01

    MOTIVATION: The task of reconstructing a genomic sequence from a particular species is gaining more and more importance in the light of the rapid development of high-throughput sequencing technologies and their limitations. Applications include not only compensation for missing data in unsequenced...... genomic regions and the design of oligonucleotide primers for target genes in species with lacking sequence information but also the preparation of customized queries for homology searches. RESULTS: We introduce the maxAlike algorithm, which reconstructs a genomic sequence for a specific taxon based...... on sequence homologs in other species. The input is a multiple sequence alignment and a phylogenetic tree that also contains the target species. For this target species, the algorithm computes nucleotide probabilities at each sequence position. Consensus sequences are then reconstructed based on a certain...

  13. Penultimate modeling of spatial extremes: statistical inference for max-infinitely divisible processes

    KAUST Repository

    Huser, Raphaël

    2018-01-09

    Extreme-value theory for stochastic processes has motivated the statistical use of max-stable models for spatial extremes. However, fitting such asymptotic models to maxima observed over finite blocks is problematic when the asymptotic stability of the dependence does not prevail in finite samples. This issue is particularly serious when data are asymptotically independent, such that the dependence strength weakens and eventually vanishes as events become more extreme. We here aim to provide flexible sub-asymptotic models for spatially indexed block maxima, which more realistically account for discrepancies between data and asymptotic theory. We develop models pertaining to the wider class of max-infinitely divisible processes, extending the class of max-stable processes while retaining dependence properties that are natural for maxima: max-id models are positively associated, and they yield a self-consistent family of models for block maxima defined over any time unit. We propose two parametric construction principles for max-id models, emphasizing a point process-based generalized spectral representation, that allows for asymptotic independence while keeping the max-stable extremal-$t$ model as a special case. Parameter estimation is efficiently performed by pairwise likelihood, and we illustrate our new modeling framework with an application to Dutch wind gust maxima calculated over different time units.

  14. Theoretical study of the possibility of glycin with thiotriazoline complexes formation

    Directory of Open Access Journals (Sweden)

    L. I. Kucherenko

    2017-10-01

    Full Text Available Brain strokes are widely spread all over the world and are among the most dangerous for the population. Often it leads to death, complete or partial loss of ability to work. The correction of imbalance of Excitatory and inhibitory neurotransmitter systems by activation of natural inhibitory processes is a promising direction of primary neuroprotection in cerebral ischemia. Particular attention is drawn to the natural inhibitory neurotransmitter – glycine and its role in the mechanisms of acute cerebral ischemia. There are data on the ability of the thiotriazoline antioxidant to potentiate the therapeutic effect of neurometabolic cerebroprotectors. Therefore, the creation of new combined preparation based on glycine with thiotriazoline is important today. Objective: to study the structure, and estimate the energy of formation and geometric characteristics of the intermolecular hydrogen bonds for complexes which are formed with glycine, 3-methyl-1,2,4-triazolyl-5-thioacetate (MTTA and morpholine. Method of calculation. The initial approximation to the structure of the complexes was obtained with the help of molecular docking procedure using the AutoDock Vina program. The resulting three-component complexes were preliminarily optimized by the semiempirical PM7 method, taking into account the outward influences, which was simulated by the COSMO method. The calculations were carried out using the MOPAC2012 program. The complexes were optimized using the density functional method with the empirical dispersion correction B97-D3/SVP+COSMO (Water using geometric correction for the incompleteness of the gCP basic set. A more accurate calculation of the solvation energy was carried out by SMD method. Calculations by the density functional method were carried out using the ORCA 3.0.3 program. The energy of formation of complexes in solution was calculated as the difference between the free Gibbs energies of the solvated complex and its individual solvated

  15. Incorporation of glycine and serine into sporulating cells of Bacillus subtilis

    International Nuclear Information System (INIS)

    Mitani, Takahiko; Kadota, Hajime

    1976-01-01

    The changes during growth and sporulation in activities of cells of Bacillus subtilis to incorporate various amino acids were investigated with wild-type strain and its asporogenous mutant. In the case of wild type strain the uptake of valine, phenylalanine, and proline was largest during the logarithmic growth period. The uptake of these amino acids decreased rapidly during the early stationary phase. The uptake of valine and cysteine increased again to some extent just prior to the forespore stage. The uptake of glycine and serine, however, was largest at the forespore stage at which the formation of spore coat took place. From these observed phenomena it was assumed that the remarkable incorporation of glycine and serine into the wild type strain during sporulation was closely related to the formation of spore coat. (auth.)

  16. Augmentative Device Helps Max Speak. PACER Center ACTion Information Sheets. PHP-c75

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    This Action Information Sheet follows a family's process of selecting and using augmentative and alternative communication to help their young son, Max, speak. Max is affected by global dyspraxia, which makes learning new motor skills--especially speech--quite difficult. For the first years of his life, Max could not say words. Before he and his…

  17. SHMT2 drives glioma cell survival in the tumor microenvironment but imposes a dependence on glycine clearance

    Science.gov (United States)

    Kim, Dohoon; Fiske, Brian P.; Birsoy, Kivanc; Freinkman, Elizaveta; Kami, Kenjiro; Possemato, Richard; Chudnovsky, Yakov; Pacold, Michael E.; Chen, Walter W.; Cantor, Jason R.; Shelton, Laura M.; Gui, Dan Y.; Kwon, Manjae; Ramkissoon, Shakti H.; Ligon, Keith L.; Kang, Seong Woo; Snuderl, Matija; Heiden, Matthew G. Vander; Sabatini, David M.

    2015-01-01

    SUMMARY Cancer cells adapt their metabolic processes to support rapid proliferation, but less is known about how cancer cells alter metabolism to promote cell survival in a poorly vascularized tumor microenvironment1–3. Here, we identify a key role for serine and glycine metabolism in the survival of brain cancer cells within the ischemic zones of gliomas. In human glioblastoma multiforme (GBM), mitochondrial serine hydroxymethyltransferase (SHMT2) and glycine decarboxylase (GLDC) are highly expressed in the pseudopalisading cells that surround necrotic foci. We find that SHMT2 activity limits that of pyruvate kinase (PKM2) and reduces oxygen consumption, eliciting a metabolic state that confers a profound survival advantage to cells in poorly vascularized tumor regions. GLDC inhibition impairs cells with high SHMT2 levels as the excess glycine not metabolized by GLDC can be converted to the toxic molecules aminoacetone and methylglyoxal. Thus, SHMT2 is required for cancer cells to adapt to the tumor environment, but also renders these cells sensitive to glycine cleavage system inhibition. PMID:25855294

  18. Survivability and reactivity of glycine and alanine in early oceans: effects of meteorite impacts.

    Science.gov (United States)

    Umeda, Yuhei; Fukunaga, Nao; Sekine, Toshimori; Furukawa, Yoshihiro; Kakegawa, Takeshi; Kobayashi, Takamichi; Nakazawa, Hiromoto

    2016-01-01

    Prebiotic oceans might have contained abundant amino acids, and were subjected to meteorite impacts, especially during the late heavy bombardment. It is so far unknown how meteorite impacts affected amino acids in the early oceans. Impact experiments were performed under the conditions where glycine was synthesized from carbon, ammonia, and water, using aqueous solutions containing (13)C-labeled glycine and alanine. Selected amino acids and amines in samples were analyzed with liquid chromatography-mass spectrometry (LC/MS). In particular, the (13)C-labeled reaction products were analyzed to distinguish between run products and contaminants. The results revealed that both amino acids survived partially in the early ocean through meteorite impacts, that part of glycine changed into alanine, and that large amounts of methylamine and ethylamine were formed. Fast decarboxylation was confirmed to occur during such impact processes. Furthermore, the formation of n-butylamine, detected only in the samples recovered from the solutions with additional nitrogen and carbon sources of ammonia and benzene, suggests that chemical reactions to form new biomolecules can proceed through marine impacts. Methylamine and ethylamine from glycine and alanine increased considerably in the presence of hematite rather than olivine under similar impact conditions. These results also suggest that amino acids present in early oceans can contribute further to impact-induced reactions, implying that impact energy plays a potential role in the prebiotic formation of various biomolecules, although the reactions are complicated and depend upon the chemical environments as well.

  19. COMPUTATIONAL STUDY OF INTERSTELLAR GLYCINE FORMATION OCCURRING AT RADICAL SURFACES OF WATER-ICE DUST PARTICLES

    International Nuclear Information System (INIS)

    Rimola, Albert; Sodupe, Mariona; Ugliengo, Piero

    2012-01-01

    Glycine is the simplest amino acid, and due to the significant astrobiological implications that suppose its detection, the search for it in the interstellar medium (ISM), meteorites, and comets is intensively investigated. In the present work, quantum mechanical calculations based on density functional theory have been used to model the glycine formation on water-ice clusters present in the ISM. The removal of either one H atom or one electron from the water-ice cluster has been considered to simulate the effect of photolytic radiation and of ionizing particles, respectively, which lead to the formation of OH . radical and H 3 O + surface defects. The coupling of incoming CO molecules with the surface OH . radicals on the ice clusters yields the formation of the COOH . radicals via ZPE-corrected energy barriers and reaction energies of about 4-5 kcal mol –1 and –22 kcal mol –1 , respectively. The COOH . radicals couple with incoming NH=CH 2 molecules (experimentally detected in the ISM) to form the NHCH 2 COOH . radical glycine through energy barriers of 12 kcal mol –1 , exceedingly high at ISM cryogenic temperatures. Nonetheless, when H 3 O + is present, one proton may be barrierless transferred to NH=CH 2 to give NH 2 =CH 2 + . This latter may react with the COOH . radical to give the NH 2 CH 2 COOH +. glycine radical cation which can then be transformed into the NH 2 CHC(OH) 2 +. species (the most stable form of glycine in its radical cation state) or into the NH 2 CHCOOH . neutral radical glycine. Estimated rate constants of these events suggest that they are kinetically feasible at temperatures of 100-200 K, which indicate that their occurrence may take place in hot molecular cores or in comets exposed to warmer regions of solar systems. Present results provide quantum chemical evidence that defects formed on water ices due to the harsh-physical conditions of the ISM may trigger reactions of cosmochemical interest. The relevance of surface H 3 O

  20. Computational Study of Interstellar Glycine Formation Occurring at Radical Surfaces of Water-ice Dust Particles

    Science.gov (United States)

    Rimola, Albert; Sodupe, Mariona; Ugliengo, Piero

    2012-07-01

    Glycine is the simplest amino acid, and due to the significant astrobiological implications that suppose its detection, the search for it in the interstellar medium (ISM), meteorites, and comets is intensively investigated. In the present work, quantum mechanical calculations based on density functional theory have been used to model the glycine formation on water-ice clusters present in the ISM. The removal of either one H atom or one electron from the water-ice cluster has been considered to simulate the effect of photolytic radiation and of ionizing particles, respectively, which lead to the formation of OH• radical and H3O+ surface defects. The coupling of incoming CO molecules with the surface OH• radicals on the ice clusters yields the formation of the COOH• radicals via ZPE-corrected energy barriers and reaction energies of about 4-5 kcal mol-1 and -22 kcal mol-1, respectively. The COOH• radicals couple with incoming NH=CH2 molecules (experimentally detected in the ISM) to form the NHCH2COOH• radical glycine through energy barriers of 12 kcal mol-1, exceedingly high at ISM cryogenic temperatures. Nonetheless, when H3O+ is present, one proton may be barrierless transferred to NH=CH2 to give NH2=CH2 +. This latter may react with the COOH• radical to give the NH2CH2COOH+• glycine radical cation which can then be transformed into the NH2CHC(OH)2 +• species (the most stable form of glycine in its radical cation state) or into the NH2CHCOOH• neutral radical glycine. Estimated rate constants of these events suggest that they are kinetically feasible at temperatures of 100-200 K, which indicate that their occurrence may take place in hot molecular cores or in comets exposed to warmer regions of solar systems. Present results provide quantum chemical evidence that defects formed on water ices due to the harsh-physical conditions of the ISM may trigger reactions of cosmochemical interest. The relevance of surface H3O+ ions to facilitate chemical