Harris, J R; Scheffler, D; Gebauer, W; Lehnert, R; Markl, J
2000-12-01
The multimeric/higher oligomeric states of the two isoforms of Haliotis tuberculata hemocyanin (HtH1 and HtH2) have been assessed by transmission electron microscopy (TEM) of negatively stained specimens, for comparison with previously published structural data from keyhole limpet hemocyanin (KLH1 and KLH2) [see Harris, J.R., Gebauer, W., Guderian, F.U., Markl, J., 1997a. Keyhole limpet hemocyanin (KLH), I: Reassociation from Immucothel followed by separation of KLH1 and KLH2. Micron, 28, 31-41; Harris, J.R., Gebauer, W., Söhngen, S.M., Nermut, M.V., Markl, J., 1997b. Keyhole limpet hemocyanin (KLH). II: Characteristic reassociation properties of purified KLH1 and KLH2. Micron, 28, 43-56; Harris, J.R., Gebauer, W., Adrian, M., Markl, J., 1998. Keyhole limpet hemocyanin (KLH): Slow in vitro reassociation of KLH1 and KLH2 from Immucothel. Micron, 29, 329-339]. In purified samples of both HtH isoforms, the hollow cylindrical ca 8MDa didecamer predominates together with a small number of decamers, but tri- and longer multidecamers are detectable only in the HtH2. The stability of the two HtH isoforms under varying ionic conditions have been monitored, thereby enabling conditions for the production of stable decamers to be established. The ability of these decamers to reform multimers in the presence of 10 and 100mM concentrations of calcium and magnesium ions in Tris-HCl buffer (pH 7.4), and also of individual HtH1 and HtH2 subunits (produced by pH 9.6 dissociation in glycine-NaOH buffer), to reassociate in the presence of calcium and magnesium ions, has been assessed. For the HtH1 decamers, the predominant multimeric product is the didecamer at 10 and 100mM calcium and magnesium concentrations, whereas for the HtH2 decamers, large numbers of multidecamers are produced, with the reaction proceeding more completely at the higher calcium and magnesium concentration. With the HtH1 subunit, reassociation in the presence of 10 and 100mM calcium and magnesium ions yielded
Arnold, Alice
2009-01-01
Last spring, students from several North Carolina middle schools were invited to participate in the annual Celebrate the Arts festival in Columbus Country. Larry Hewett, a local art teacher, had been selected to instruct the middle-school students. Larry's River Rock Circles project was made as the starting point for the Celebrate the Arts…
Plano de marketing : empresa HTH
Carneiro, Marta Fernandes
2017-01-01
Este plano de marketing na empresa HTH, visa garantir a qualidade dos seus produtos; garantir a excelente relação com os seus clientes; lutar para conseguir ter uma boa oferta de preços, fator decisivo neste mercado; minimizar os tempos de entrega para se diferenciar da concorrência; e, melhorar a divulgação da empresa e dos seus produtos.
Crystal Structure of a Putative HTH-Type Transcriptional Regulator yxaF from Bacillus subtilis
International Nuclear Information System (INIS)
Seetharaman, J.; Kumaran, D.; Bonanno, J.; Burley, S.; Swaminathan, S.
2006-01-01
The New York Structural GenomiX Research Consortium (NYSGXRC) has selected the protein coded by yxaF gene from Bacillus subtilis as a target for structure determination. The yxaF protein has 191 residues with a molecular mass of 21 kDa and had no sequence homology to any structure in the Protein Data Bank (PDB) at the time of target selection. We aimed to elucidate the three-dimensional structure for the putative protein yxaF to better understand the relationship between protein sequence, structure, and function. This protein is annotated as a putative helix-turn-helix (HTH) type transcriptional regulator. Many transcriptional regulators like TetR and QacR use a structurally well-defined DNA-binding HTH motif to recognize the target DNA sequences. DNA-HTH motif interactions have been extensively studied. As the HTH motif is structurally conserved in many regulatory proteins, these DNA-protein complexes show some similarity in DNA recognition patterns. Many such regulatory proteins have a ligand-binding domain in addition to the DNA-binding domain. Structural studies on ligand-binding regulatory proteins provide a wealth of information on ligand-, and possibly drug-, binding mechanisms. Understanding the ligand-binding mechanism may help overcome problems with drug resistance, which represent increasing challenges in medicine. The protein encoded by yxaF, hereafter called T1414, shows fold similar to QacR repressor and TetR/CamR repressor and possesses putative DNA and ligand-binding domains. Here, we report the crystal structure of T1414 and compare it with structurally similar drug and DNA-binding proteins
Science, Politics, and Best Practice: 35 Years after Larry P.
Frisby, Craig L.; Henry, Betty
2016-01-01
A little over 35 years have passed since the original "Larry P." decision was handed down in 1979 by Robert Peckham, a federal judge for the US District Court for the Northern District of California. The "Larry P. case" is a shorthand moniker that refers to a class action lawsuit, supported by the Bay Area Association of Black…
Irradiation-assisted stress corrosion cracking in HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.
1995-01-01
In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water to determine the irradiation-assisted stress corrosion cracking (IASCC) behavior of HTH Alloy X-750 and direct-aged Alloy 625. New data confirm previous results showing that high irradiation levels reduce SCC resistance in Alloy X-750. Heat-to-heat variability correlates with boron content, with low boron heats showing improved IASCC properties. Alloy 625 is resistant to IASCC, as no cracking was observed in any Alloy 625 specimens. Microstructural, microchemical and deformation studies were performed to characterize the mechanisms responsible for IASCC in Alloy X-750 and the lack of an effect in Alloy 625. The mechanisms under investigation are: boron transmutation effects, radiation-induced changes in microstructure and deformation characteristics, and radiation-induced segregation. Irradiation of Alloy X-750 caused significant strengthening and ductility loss that was associated with the formation of cavities and dislocation loops. High irradiation levels did not cause significant segregation of alloying or trace elements in Alloy X-750. Irradiation of Alloy 625 resulted in the formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to the loops and precipitates was apparently offset by a partial dissolution of γ double-prime precipitates, as Alloy 625 showed no irradiation-induced strengthening or ductility loss. In the nonirradiated condition, an IASCC susceptible HTH heat containing 28 ppm B showed grain boundary segregation of boron, whereas a nonsusceptible HTH heat containing 2 ppm B and Alloy 625 with 20 ppm B did not show significant boron segregation. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in Alloy X-750, and the absence of these two effects results in the superior IASCC resistance displayed by Alloy 625
Into the White: Larry Eigner’s Meta-Physical Poetics
Directory of Open Access Journals (Sweden)
Sarah Juliet Lauro
2014-01-01
Full Text Available Disabled poet Larry Eigner makes striking use of the space of the page to create poetry that operates in a visual as well as linguistic register. Many critics have read Eigner’s oeuvre in light of his physical condition, but no scholar has previously looked to the parallels between the Black Mountain artists’ experiments in abstraction and Black Mountain poet Larry Eigner’s work, though the same influences are clearly evident. Working collaboratively and interdisciplinarily, the authors combine their expertise in the disciplines of literature and art history, reading both the words on the page and the page as picture, in a manner that engages specifically with phenomenological philosophy, to explicate how these poems work on the body of the reader. Key words: embodiment, abstraction, poetics, typography, metaphysics, phenomenology
Lula VS. Larry Rohter: Misconceptions in international coverage
Directory of Open Access Journals (Sweden)
Heloiza Golbspan Herckovitz
2007-06-01
Full Text Available This article discusses the confl ict between the New York Times foreign correspondent Larry Rohter and Brazil’s President Luis Inácio Lula da Silva over a story published by the American newspaper on May 9, 2004 accusing the President of being a drunkard. Larry Rohter’s piece was criticized for its lack of facts and of reliable sources, and for its ironic overtone. President Lula was criticized for cancelling the journalist’s visa, a measure later revoked because of public pressure. The case exemplifi es a well-know sequence of misconceptions and stereotypes from both sides (the world’s most prestigious newspaper and the president of the largest country in Latin America, which brings to light a much needed discussion on the quality of international news coverage, press freedom and social responsibility. This article also attempts to advance the discussion on how framing – second level agenda-setting —may infl uence how we think about foreign political leaders.
Larry Echo Hawk: A Rising Star from Idaho.
Wisecarver, Charmaine
1993-01-01
Larry Echo Hawk, Idaho attorney general and former state legislator, discusses success factors in college and law school; early experiences as an Indian lawyer; first election campaign; and his views on tribal sovereignty, state-tribal relationship, gambling, and his dual responsibility to the general public and Native American issues. (SV)
Customization and the Common Good: A Conversation with Larry Cuban.
Willis, Scott
2002-01-01
A conversation with Larry Cuban, Professor Emeritus of Education at Stanford University, about two contradictory trends in education: customization and standardization and their effect on the public schools' responsibilities to provide both individual and social benefits. (PKP)
Irradiation assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Mills, W.J.; Lebo, M.R.; Bajaj, R.; Kearns, J.J.; Hoffman, R.C.; Korinko, J.J.
1994-01-01
In-reactor testing of bolt-loaded precracked compact tension specimens was performed in 360 degree C water to determine effect of irradiation on the SCC behavior of HTH Alloy X-750 and direct aged Alloy 625. Out-of-flux and autoclave control specimens provided baseline data. Primary test variables were stress intensity factor, fluence, chemistry, processing history, prestrain. Results for the first series of experiments were presented at a previous conference. Data from two more recent experiments are compared with previous results; they confirm that high irradiation levels significantly reduce SCC resistance in HTH Alloy X-750. Heat-to-heat differences in IASCC were related to differences in boron content, with low boron heats showing improved SCC resistance. The in-reactor SCC performance of Alloy 625 was superior to that for Alloy X-750, as no cracking was observed in any Alloy 625 specimens even though they were tested at very high K 1 and fluence levels. A preliminary SCC usage model developed for Alloy X-750 indicates that in-reactor creep processes, which relax stresses but also increase crack tip strain rates, and radiolysis effects accelerate SCC. Hence, in-reactor SCC damage under high flux conditions may be more severe than that associated with postirradiation tests. In addition, preliminary mechanism studies were performed to determine the cause of IASCC In Alloy X-750
Steinberg, Shirley R.
2009-09-01
I describe how Joe Kincheloe experienced learning from a peer during his pre-school life only to see how his friend was unable to succeed at school. Joe's commitment to empowered cognition was grounded first, by his friend, Larry's mentorship—teaching him the environmental nuances of the mountains in rural Tennessee, and secondly, the contradiction of schooling being unable to afford learning for Larry. This article discusses how Kincheloe became a scholar, the salience of Einstein's work with his own, and the evolution of his research and scholarship. Examples of Kincheloe's work addressed are: postformalism, bricolage, critical theory, and alternative knowledges, and how this work has contributed to science education.
An Interview with Larry Golden: Long-Time Marriage and Family Counselor and Counselor Educator
Juhnke, Gerald A.; Yu, Fangzhou
2010-01-01
Larry Golden started the marriage and family therapy program at Our Lady of the Lake University and was founding chair of the Department of Counseling at the University of Texas at San Antonio. He has contributed substantially to the literature in marriage and family counseling. This interview secured his unique perspective on developments in the…
Steinberg, Shirley
2009-01-01
I describe how Joe Kincheloe experienced learning from a peer during his pre-school life only to see how his friend was unable to succeed at school. Joe's commitment to empowered cognition was grounded first, by his friend, Larry's mentorship--teaching him the environmental nuances of the mountains in rural Tennessee, and secondly, the…
Simon, C. A.; Arjmand, S.; Abad, J. D.
2012-12-01
Because of its relatively low carbon dioxide emissions, natural gas is considered to be more efficient and environmentally friendly than other non-renewable fuels. As a result of this, among other factors, in recent years natural gas has become one of the world's primary energy sources. In the United States, drilling to extract natural gas has substantially increased over the past few years. In the Marcellus Shale, unconventional gas is currently extracted by using two new techniques: horizontal drilling and hydraulic fracturing. Today, fracking fluids which have been applied as part of the hydraulic fracturing process to fracture the shale rock and release the gas, pose a major environmental concern. These fluids are highly contaminated with radionuclides and toxic metals and any exposure of this highly polluted water to surface water or soil could heavily contaminate the media. The area selected for the current study is the Larry's Creek, located in Lycoming County in Pennsylvania. Larry's Creek Watershed was adversely affected by coal and iron mines activities in the 19th century. Though, the water quality in this creek was considered to be good as of 2006. Recently, oil and gas drilling activities have raised concerns about the creek's water quality again. A major environmental hazard is the freshwater contamination by frac/flowback water. Drilling companies are using impoundments on site to keep fracwater, and to store and evaporate flowback water. However, these ponds may fail or leak due to construction problems and/or accidents. Close to Saladasburg, Larry's Creek's stream was observed running rich with clay in October 19, 2011. Historical measurements show very high turbidity during this period which has raised questions about water contamination by the gas industry activities in the upper stream of the watershed. An interstate watershed agency has reported spills in Wolf Run in different drilling sites in the Larry's Creek basin. The focus of this study
Wright, Adam; Sittig, Dean F; McGowan, Julie; Ash, Joan S; Weed, Lawrence L
2014-01-01
Larry Weed, MD is widely known as the father of the problem-oriented medical record and inventor of the now-ubiquitous SOAP (subjective/objective/assessment/plan) note, for developing an electronic health record system (Problem-Oriented Medical Information System, PROMIS), and for founding a company (since acquired), which developed problem-knowledge couplers. However, Dr Weed's vision for medicine goes far beyond software--over the course of his storied career, he has relentlessly sought to bring the scientific method to medical practice and, where necessary, to point out shortcomings in the system and advocate for change. In this oral history, Dr Weed describes, in his own words, the arcs of his long career and the work that remains to be done. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
LA BASE AXIOLÓGICA DE LA EMPRESA CIENTÍFICA Y LA PLURALIDAD DE FINES EN LA CIENCIA EN LARRY LAUDAN
Directory of Open Access Journals (Sweden)
Marcos Antonio da Silva
2013-08-01
Full Text Available No presente artigo analiso as implicações das formulações teóricas de Larry Laudan com respeito à avaliação da ciência. Nele, o estudo dos valores epistêmicos, do método e dos fins da ciência, no contexto de seu naturalismo normativo, ganha sentido e o coloca como mais um instrumental importante na análise da atividade da ciência e de suas teorias. Daí resulta mais significativa sua proposta do modelo reticular, em seus três níveis de análise do conhecimento produzido pela ciência. O artigo mostra que este modelo constitui uma contribuição importante de Laudan para a Filosofia da Ciência.
Network thermodynamic approach compartmental analysis. Na+ transients in frog skin.
Mikulecky, D C; Huf, E G; Thomas, S R
1979-01-01
We introduce a general network thermodynamic method for compartmental analysis which uses a compartmental model of sodium flows through frog skin as an illustrative example (Huf and Howell, 1974a). We use network thermodynamics (Mikulecky et al., 1977b) to formulate the problem, and a circuit simulation program (ASTEC 2, SPICE2, or PCAP) for computation. In this way, the compartment concentrations and net fluxes between compartments are readily obtained for a set of experimental conditions involving a square-wave pulse of labeled sodium at the outer surface of the skin. Qualitative features of the influx at the outer surface correlate very well with those observed for the short circuit current under another similar set of conditions by Morel and LeBlanc (1975). In related work, the compartmental model is used as a basis for simulation of the short circuit current and sodium flows simultaneously using a two-port network (Mikulecky et al., 1977a, and Mikulecky et al., A network thermodynamic model for short circuit current transients in frog skin. Manuscript in preparation; Gary-Bobo et al., 1978). The network approach lends itself to computation of classic compartmental problems in a simple manner using circuit simulation programs (Chua and Lin, 1975), and it further extends the compartmental models to more complicated situations involving coupled flows and non-linearities such as concentration dependencies, chemical reaction kinetics, etc.
A Network Thermodynamic Approach to Compartmental Analysis
Mikulecky, D. C.; Huf, E. G.; Thomas, S. R.
1979-01-01
We introduce a general network thermodynamic method for compartmental analysis which uses a compartmental model of sodium flows through frog skin as an illustrative example (Huf and Howell, 1974a). We use network thermodynamics (Mikulecky et al., 1977b) to formulate the problem, and a circuit simulation program (ASTEC 2, SPICE2, or PCAP) for computation. In this way, the compartment concentrations and net fluxes between compartments are readily obtained for a set of experimental conditions involving a square-wave pulse of labeled sodium at the outer surface of the skin. Qualitative features of the influx at the outer surface correlate very well with those observed for the short circuit current under another similar set of conditions by Morel and LeBlanc (1975). In related work, the compartmental model is used as a basis for simulation of the short circuit current and sodium flows simultaneously using a two-port network (Mikulecky et al., 1977a, and Mikulecky et al., A network thermodynamic model for short circuit current transients in frog skin. Manuscript in preparation; Gary-Bobo et al., 1978). The network approach lends itself to computation of classic compartmental problems in a simple manner using circuit simulation programs (Chua and Lin, 1975), and it further extends the compartmental models to more complicated situations involving coupled flows and non-linearities such as concentration dependencies, chemical reaction kinetics, etc. PMID:262387
DEFF Research Database (Denmark)
Balle, Søren Hattesen
Frank O’Hara’s ekphrastic poem “On Seeing Larry Rivers’s Washington Crossing the Delaware” is only one work among others in a series of 1950s works in different genres and media relating to Emanuel Leutze’s romantic representation of the father of the American nation in his painting Washington...... event in American history. Inversely, only few critics take seriously the difference in both genre and medium between these different textual and graphic representations of Washington’s crossing and the questions such a difference may give rise to. In this paper I shall make an intergeneric......) and by narrativizing Rivers’s painting, the poem opens up alternative representational possibilities of the former and thus poses the question of whose ‘truth’ gets told or not told depending on the choice of genre and medium in representation. Thus, the intertextual relationship existing between Rivers’s painting...
Chauhan, Nishant Ranjan; Kapoor, Medha; Prabha Singh, Laxmi; Gupta, Rajinder Kumar; Chand Meena, Ramesh; Tulsawani, Rajkumar; Nanda, Sarita; Bala Singh, Shashi
2017-09-01
Heat Stress (HS) induces diverse pathophysiological changes, which include brain ischemia, oxidative stress and neuronal damage. The present study was undertaken with the objective to ascertain whether neuroinflammation in Hypothalamus (HTH) caused under HS affects monoamine levels and hence, its physiological role in thermoregulation. Rats were exposed to HS in a heat simulation environmental chamber (Ambient temperature, Ta=45±0.5°C and Relative Humidity, RH=30±10%) with real-time measurement of core temperature (Tc) and skin temperature (Ts). Animals were divided into two subgroups: Moderate HS (MHS) (Tc=40°C) and Severe HS (SHS)/Heat stroke (Tc=42°C). Rats with MHS showed an increase in Mean Arterial Pressure (MAP) and Heart Rate (HR) while fall in MAP and rise in HR was observed in rats with SHS. In addition, oxidative stress and an increase in pyknotic neurons were observed in HTH. High levels of Adrenocorticotropic-hormone (ACTH), Epinephrine (EPI), Norepinephrine (NE) and Dopamine (DA) in the systemic circulation and progressive increase in EPI and DA levels in HTH were recorded after the thermal insult. Moreover, a substantial increase in Glutamate (Glu) level was observed in HTH as well as in systemic circulation of heat stroke rats. We found a rise in NE whereas a fall in Serotonin (5-HT) level in HTH at MHS, without perturbing inflammatory mediators. However, rats with SHS exhibited significant elevations in NF-kB, IL-1β, COX2, GFAP and Iba1 protein expression in HTH. In conclusion, the data suggest that SHS induces neuroinflammation in HTH, which is associated with monoamines and Glu imbalances, leading to thermoregulatory disruption. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.
Smith, Frank W; Jockusch, Elizabeth L
2014-11-01
The establishment of segment identity is a key developmental process that allows for divergence along the anteroposterior body axis in arthropods. In Drosophila, the identity of a segment is determined by the complement of Hox genes it expresses. In many contexts, Hox transcription factors require the protein products of extradenticle (exd) and homothorax (hth) as cofactors to perform their identity specification functions. In holometabolous insects, segment identity may be specified twice, during embryogenesis and metamorphosis. To glean insight into the relationship between embryonic and metamorphic segmental identity specification, we have compared these processes in the flour beetle Tribolium castaneum, which develops ventral appendages during embryogenesis that later metamorphose into adult appendages with distinct morphologies. At metamorphosis, comparisons of RNAi phenotypes indicate that Hox genes function jointly with Tc-hth and Tc-exd to specify several region-specific aspects of the adult body wall. On the other hand, Hox genes specify appendage identities along the anteroposterior axis independently of Tc-hth/Tc-exd and Tc-hth/Tc-exd specify proximal vs. distal identity within appendages independently of Hox genes during this stage. During embryogenesis, Tc-hth and Tc-exd play a broad role in the segmentation process and are required for specification of body wall identities in the thorax; however, contrasting with results from other species, we did not obtain homeotic transformations of embryonic appendages in response to Tc-hth or Tc-exd RNAi. In general, the homeotic effects of interference with the function of Hox genes and Tc-hth/Tc-exd during metamorphosis did not match predictions based on embryonic roles of these genes. Comparing metamorphic patterning in T. castaneum to embryonic and post-embryonic development in hemimetabolous insects suggests that holometabolous metamorphosis combines patterning processes of both late embryogenesis and
Directory of Open Access Journals (Sweden)
Lu Bai
2017-01-01
Full Text Available The study investigated the expression of Wnt/β-catenin pathway in diabetic rats and the intervention effect of Huayu Tongluo herbs (HTH. Ten rats were randomly selected as control group and the remaining rats were established as diabetic models. The diabetic rats were randomly divided into model group and HTH treatment group. The intervention was intragastric administration in all rats for 20 weeks. At the end of every 4 weeks, fasting blood glucose and 24 h urinary total protein quantitatively were measured. At the end of the 20th week, biochemical parameters and body weight were tested. The kidney tissues were observed under light microscope and transmission electron microscopy. We examined Wnt/beta-catenin signaling pathway key proteins and renal interstitial fibrosis related molecular markers expression. The results showed that HTH could reduce urinary protein excretion and relieve renal pathological damage. Wnt4, p-GSK3β (S9, and β-catenin expression were decreased in the signaling pathway, but GSK3β level was not changed by HTH in diabetic rats. Furthermore, the expressions of TGF-β1 and ILK were decreased, but the level of E-cadherin was increased in diabetic rats after treatment with HTH. This study demonstrated that HTH could inhibit the high expression of Wnt/β-catenin pathway in kidney of diabetic rats. The effect might be one of the main ways to reduce urinary protein excretion.
International Nuclear Information System (INIS)
Chapman, J.B.; Mihevc, T.M.; Lyles, B.F.
1994-08-01
The Central Nevada Test Area was the site of the Faultless underground nuclear test that could be a source of radionuclide contamination to aquifers in Hot Creek Valley, Nevada. Field studies in 1992 and 1993 have used hydrologic logging and water sampling to determine the adequacy of the current groundwater monitoring network and the status of water-level recovery to pre-shot levels in the nuclear chimney. The field studies have determined that there is a possibility for contaminant migration away from the Faultless event though the pre-event water level has not been attained, while new data raise questions about the ability of the current monitoring network to detect migration. Hydrologic logs from the postshot hole (drilled into the chimney created by the nuclear detonation) reveal inflow around 485 m below land surface. The physical and chemical characteristics of the inflow water indicate that its source is much deeper in the chimney, perhaps driven upward in a convection cell generated by heat near the nuclear cavity. Logging and sampling at monitoring wells HTH-1 and HTH-2 revealed that the completion of HTH-1 may be responsible for its elevated water level (as compared to pre-nuclear test levels) and may have also created a local mound in the water table in the alluvium that accounts for higher post-test water levels at HTH-2. This mound would serve to divert flow around the monitoring wells, so that only migration of contaminants through the underlying, higher pressure, volcanic units is currently monitored. A hydraulic high found in an abandoned hole located between the nuclear chimney and the monitoring wells further reduces the likelihood of HTH-1 or HTH-2 intercepting contaminant migration
Directory of Open Access Journals (Sweden)
Hou-Long Long
2018-05-01
Full Text Available Dietary anthocyanin compounds have multiple biological effects, including antioxidant, anti-inflammatory, and anti-atherosclerotic characteristics. The present study evaluated the anti-tumor capacity of mulberry anthocyanins (MA in thyroid cancer cells. Our data showed that MA suppressed SW1736 and HTh-7 cell proliferation in a time- and dose-dependent manner. Meanwhile, flow cytometry results indicated that MA significantly increased SW1736 and HTh-7 cell apoptosis. We additionally observed that SW1736 and HTh-7 cell autophagy was markedly enhanced after MA treatment. Importantly, anthocyanin-induced cell death was largely abolished by 3-methyladenine (3-MA or chloroquine diphosphate salt (CQ treatment, suggesting that MA-induced SW1736 and HTh-7 cell death was partially dependent on autophagy. In addition, activation of protein kinase B (Akt, mammalian target of rapamycin (mTOR, and ribosomal protein S6 (S6 were significantly suppressed by anthocyanin exposure. In summary, MA may serve as an adjunctive therapy for thyroid cancer patients through induction of apoptosis and autophagy-dependent cell death. Keywords: Mulberry anthocyanins, Thyroid cancer, Apoptosis, Autophagic death
2005-04-28
PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S...Company Lead: Larry Bradford Atlantic Research Propellant Mixing/Loading, Nozzle Manufacturing, Corporation Motor Static Testing Company Lead: Steve
40th Annual Armament Systems: Guns-Ammunition-Rockets-Missiles Conference and Exhibition
2005-04-28
PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S
2005-04-28
PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S
2005-04-28
PM] Abraham Overview, Mr. Robert Daunfeldt, Bofors Defence Summary Overview of an Advanced 2.75 Hypervelocity Weapon, Mr. Larry Bradford , CAT Flight...Substantially Improves 2.75 Rocket Lethality, Safety, Survivability Mr. Larry Bradford , CAT Flight Services, Inc. APKWS Flight Test Results Mr. Larry S
2012-06-01
and other wildlife from suitable habitat in the 7 proposed Project Area. Smaller, less-mobile species and those seeking refuge in burrows could 8...the NONROAD model and were provided to e²M by Larry Landman of the Air Quality and Modeling Center (Landman.Larry@epamail.epa.gov) on 12/14/07...Emission factors are taken from the NONROAD model and were provided to e²M by Larry Landman of the Air Quality and Modeling Center (Landman.Larry
Directory of Open Access Journals (Sweden)
Sonia Carreño-Moreno
2016-02-01
Full Text Available The objective of this work, is provide conceptual elements that constitute an integrated vision of care conditions required by the human talent in health HTH that caters to people with chronic disease (CD and their families, and that are translated into a tool for gathering information of survey type that allow characterization. This research was conducted in three phases: 1 Review of the literature. 2 Structuring a proposed survey 3 Refinement of the final version of the survey. As results, based on the conceptual framework it was possible to reach a comprehensive vision that served as the basis for the development of a survey to identify the conditions of HTH to care for people with chronic illness and their families. This instrument, called GCPC-A-THS (in Spanish, contains 37 items distributed in 6 additional dimensions that include aspects of care such as: sociodemographic variables of HTH, caring ability, information and communication technologies (ICTs as a means of support to care, continuity, security and also includes some items related to the level of professional satisfaction. The work done made it possible to achieve a comprehensive view of the characteristics and conditions required by the HTH for care to people with chronic illness and their families.
75 FR 69061 - Senior Executive Service; Performance Review Board
2010-11-10
..., Linda C Burrows, Charles W Buttress, Larry D Buzzard, Christine M Cadieux, Gena E Callahan, Samuel N... Bekkedahl, Larry N Bell, Melody C Berkowitz, Barry E Bieniawski, Andrew J Bishop, Clarence T Bishop, Tracey..., Douglas E Kane, Michael C Kaplan, Stan M Kearney, James H Kelly, Henry C Kelly, Larry C Kenchington, Henry...
77 FR 64967 - Senior Executive Service; Performance Review Board
2012-10-24
... BROWN, STEPHANIE H BRYAN, WILLIAM N BURROWS, CHARLES W BUTTRESS, LARRY D CADIEUX, GENA E CALBOS, PHILIP..., CAROL J BEAMON, JOSEPH A BEARD, JEANNE M BEARD, SUSAN F BEAUSOLEIL, GEOFFREY L BEKKEDAHL, LARRY N BELL..., HENRY C KELLY, JOHN E KELLY, LARRY C KENCHINGTON, HENRY S KENDELL, JAMES M KETCHAM, TIMOTHY E KHAN...
78 FR 70027 - Senior Executive Service; Performance Review Board
2013-11-22
..., WILLIAM N. BURROWS, CHARLES W. BUTTRESS, LARRY D. CADIEUX, GENA E. CALBOS, PHILIP T. CALLAHAN, SAMUEL N..., LARRY N. BELL, MELODY C. BESTANI, ROBERT M. BIENIAWSKI, ANDREW J. BIERBOWER, WILLIAM J. BINKLEY, JOHN S..., STAN M. KEARNEY, JAMES H. KELLY, HENRY C. KELLY, JOHN E. KELLY, LARRY C. KENCHINGTON, HENRY S. KENDELL...
Liu, Sushuang; Liu, Yanmin; Jia, Yanhong; Wei, Jiaping; Wang, Shuang; Liu, Xiaolin; Zhou, Yali; Zhu, Yajing; Gu, Weihong; Ma, Hao
2017-06-01
Matrix metalloproteinases (MMPs) are a family of zinc- and calcium-dependent endopeptidases. Gm1-MMP was found to play an important role in soybean tissue remodeling during leaf expansion. In this study, Gm1-MMP was isolated and characterized. Its encoding protein had a relatively low phylogenetic relationship with the MMPs in other plant species. Subcellular localization indicated that Gm1-MMP was a plasma membrane protein. Gm1-MMP showed higher expression levels in mature leaves, old leaves, pods, and mature seeds, as well as was involved in the development of soybean seed. Additionally, it was involved in response to high temperature and humidity (HTH) stress in R7 leaves and seeds in soybean. The analysis of promoter of Gm1-MMP suggested that the fragment from -399 to -299 was essential for its promoter activity in response to HTH stress. The overexpression of Gm1-MMP in Arabidopsis affected the growth and development of leaves, enhanced leaf and developing seed tolerance to HTH stress and improved seed vitality. The levels of hydrogen peroxide (H 2 O 2 ) and ROS in transgenic Arabidopsis seeds were lower than those in wild type seeds under HTH stress. Gm1-MMP could interact with soybean metallothionein-II (GmMT-II), which was confirmed by analysis of yeast two-hybrid assay and BiFC assays. All the results indicated that Gm1-MMP plays an important role in the growth and development of leaves and seeds as well as in tolerance to HTH stress. It will be helpful for us understanding the functions of Gm1-MMP in plant growth and development, and in response to abiotic stresses. Copyright © 2017 Elsevier B.V. All rights reserved.
Hydrogeologic characterization of wells HTH-1, UE18r, UE6e, and HTH-3, Nevada Test Site
International Nuclear Information System (INIS)
Lyles, B.F.; McKay, W.A.; Chapman, J.B.; Tyler, S.W.
1991-06-01
Monitoring for the migration of contaminants in groundwater or for the proper design of nuclear test emplacement holes at the Nevada Test Site (NTS) requires proper placement and completion of monitoring wells. This is only possible if the hydrogeologic system is understood in a regional and local context, necessitating data from existing wells and boreholes. Though the NTS Groundwater Characterization Project will be drilling wells, their great expense limits the number of new wells. However, there are many existing boreholes and wells on the NTS which have not been completely evaluated hydrologically. Some of these are incorporated in the Long Term Hydrologic Monitoring Program (LTHMP) of the US Environmental Protection Agency (EPA), others are related to the testing programs. In all cases, additional site investigation in necessary to properly interpret the hydrogeologic data from these wells. Monitoring wells on the NTS are poorly characterized with regard to aquifers penetrated, vertical hydraulic gradients, and vertical variations in water quality. One of the goals of the well validation program was to gain a thorough understanding of the parameters needed to interpret the source and fate potential hazardous and radioactive substances that may be detected in these wells in the future. One of the most critical parameters for monitoring is the knowledge of what aquifer or geologic unit is being sampled when a water sample is collected. Pumped water samples are weighted most heavily to the water quality of the most productive (highest transmissivity) aquifer penetrated by the well
2013-05-01
SSC Burrowing owl Athene cunicularia - SSC Piping plover Charadrius melodus T T Southeastern snowy plover Charadrius alexandrinus...Department of Environmental Protection 3900 Commonwealth Blvd, M.S. 47 Tallahassee, FL 32399-3000 Commissioner Larry Bustle Chair Mayor Robert Minning...the NONROAD model and were provided to e²M by Larry Landman of the Air Quality and Modeling Center (Landman.Larry@epamail.epa.gov) on 12/14/07
Directory of Open Access Journals (Sweden)
Didier Aubert
2011-04-01
Full Text Available 1. Do you happen to remember the first time you actually made money with a picture you took?You have to go back to 1961. Before that I was trying to pick up work here and there as an assistant but I couldn’t because I was an undisciplined bum, so people would fire me. Then I studied with Lisette Model. My parents were very nice to me. They allowed me to float around as an artist. I didn’t really have to suffer or suffocate myself by driving a cab or anything like that. So I was very fortunate...
10 noort veebifirmat, millel tasub silm peal hoida
2008-01-01
Aastatel 2003-2008 asutatud ettevõtetest Ushahidi, Mashery, 33Across, Qik, Pinger, QTech, Dash Navigation, Powence, Anagran ning Peer39, mis loodavad kasu teenida innovaatiliste sotsiaalse interneti ideedega. Vt. samas: David Talbot. Kriisiallikate kaardistamine; Lissa Harris. Erinevate veebilehtede andmete integreerimine on nüüd lihtne; Larry Aragon. Kas sul on... mõjuvõimu?; David Talbot. Videoedastus mobiiltelefoniga; Larry Aragon. Kiire kõnepostiteenus; Lissa Harris. Kõik ei lähegi meelest ära!; David Talbot. Liiklusekspert; Lissa Harris. Privaatne failivahetus; Larry Aragon. Videopakettide edastus; Lissa Harris. Semantilised reklaamid
1988-01-01
California, USA Alberto G. de Flgueiredo Lab. Geologia Marinha. Universidude Federal Fluminense. Niteroi. Brazil Larry J. Doyle University of South...USA Alberto G. de Flguelredo Lab. Geologia Marinha, Universidude Federal Fluminense, Niteroi, Brazil Larry J. Doyle University of South Florida
Inhibition of stress corrosion cracking of Alloy X-750 by prestrain
International Nuclear Information System (INIS)
Mills, W.J.; Lebo, M.R.; Kearns, J.J.
1997-03-01
Tests of precracked and as-notched compact tension specimens were conducted in 3600C hydrogenated water to determine the effect of prestrain on the stress corrosion cracking (SCC) resistance of Alloy X-750 in the HTH, AH and HOA heat treated conditions. Prestraining is defined as the intentional application of an initial load (or strain) that is higher than the final test load. Prestrain was varied from 10% to 40% (i.e., the initial to final load ratios ranged from 1.1 to 1.4). Other variables included notch root radius, stress level and irradiation. Specimens were bolt-loaded to maintain essentially constant displacement conditions during the course of the test. The frequent heat up and cooldown cycles that were necessary for periodic inspections provided an opportunity to evaluate the effect of test variables on rapid low temperature crack propagation to which this alloy is subject. For Condition HTH, application of 20% to 40% prestrain either eliminates or significantly retards SCC initiation in as-notched specimens and the onset of crack growth in precracked specimens. In addition, this procedure reduces the propensity for low temperature crack growth during cooldown. Similar results were observed for precracked HOA specimens. Application of 20% prestrain also retards SCC in as-notched and precracked AH specimens, but the effects are not as great as in Condition HTH. Prestraining at the 10% level was found to produce an inconsistent benefit. In-reactor SCC testing shows that prestrain greatly improves the in-flux and out-of-flux SCC resistance of Condition HTH material. No SCC was observed in precracked specimens prestrained 30%, whereas extensive cracking was observed in their nonprestrain counterparts
Role of Sida cordifolia L. leaves on biochemical and antioxidant profile during myocardial injury.
Kubavat, J B; Asdaq, S M B
2009-07-06
The Sida cordifolia L. (Family: Malvaceae) is a widely allocated herb by folk tribes of Gujarat state of India for the treatment of coronary manifestations. However, no published data relevant to use of the plant is available. The aim of the present study was to evaluate the antioxidant and biochemical profile of hydroalcoholic extract of Sida cordifolia L. (HESC) leaves against myocardial infarction (MI) in rats. Albino rats were administered HESC (100 and 500 mg/kg) and propranolol (10 mg/kg) once daily orally for 30 days. At the end of treatment period, MI was induced by administering isoproterenol (ISO) or by subjecting heart to ischemia reperfusion injury (IRI). Endogenous biomarkers (LDH and CK-MB) and antioxidants (SOD and catalase) were estimated in serum/perfusate and heart tissue homogenate (HTH). The LDH and CK-MB activities were elevated in HTH and depleted in serum/perfusate of HESC and propranolol groups when compared to ISO/IRI control. Further, it was found that both doses significantly increased endogenous antioxidants in HTH. Moreover, biochemical findings were supported by histopathological observations. The result confirm, at least in part, for the use of Sida cordifolia in folk medicine to treat MI.
ORF Alignment: NC_000964 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available HTH-type ... transcriptional regulator pksA ... Length = 182 ... Query: 8 ... EKRRKQIAEATWRVILERGME...GASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 67 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAM...KLVQEK Sbjct: 1 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 60
CASE REPORT MRI signal changes in the liver following multiple ...
African Journals Online (AJOL)
2008-02-10
Feb 10, 2008 ... Canadian Royal College certification or eligibility to write exam preferred. Locum positions are also available. Regina has a booming economy, no traffic and an international airport. Contact Larry Kliman, Business Manager tel: 306"529"3305 or e"mail larry@rarsk.com. RADIOLOGY POSITIONS.indd 1.
76 FR 70711 - Senior Executive Service; Performance Review Board
2011-11-15
... L BEKKEDAHL, LARRY N BELL, MELODY C BIENIAWSKI, ANDREW J BIERBOWER, WILLIAM J BISHOP, CLARENCE T... BROWN, FRED L BROWN, STEPHANIE H BRUCE, SANDRA D BRYAN, PAUL F BRYAN, WILLIAM N BURROWS, CHARLES W BUTTRESS, LARRY D BUZZARD, CHRISTINE M CADIEUX, GENA E CALBOS, PHILIP T CALLAHAN, SAMUEL N CAMPAGNONE, MARI...
Linn, Bill
1981-01-01
Relates composition to the philosophy of Taoism as performing an activity instinctively and with ease. Illustrates the relationship with examples of students' reactions to particular writing situations. (HTH)
Directory of Open Access Journals (Sweden)
Teresa Milano
2016-01-01
Full Text Available The MocR bacterial transcriptional regulators are characterized by an N-terminal domain, 60 residues long on average, possessing the winged-helix-turn-helix (wHTH architecture responsible for DNA recognition and binding, linked to a large C-terminal domain (350 residues on average that is homologous to fold type-I pyridoxal 5′-phosphate (PLP dependent enzymes like aspartate aminotransferase (AAT. These regulators are involved in the expression of genes taking part in several metabolic pathways directly or indirectly connected to PLP chemistry, many of which are still uncharacterized. A bioinformatics analysis is here reported that studied the features of a distinct group of MocR regulators predicted to be functionally linked to a family of homologous genes coding for integral membrane proteins of unknown function. This group occurs mainly in the Actinobacteria and Gammaproteobacteria phyla. An analysis of the multiple sequence alignments of their wHTH and AAT domains suggested the presence of specificity-determining positions (SDPs. Mapping of SDPs onto a homology model of the AAT domain hinted at possible structural/functional roles in effector recognition. Likewise, SDPs in wHTH domain suggested the basis of specificity of Transcription Factor Binding Site recognition. The results reported represent a framework for rational design of experiments and for bioinformatics analysis of other MocR subgroups.
Shelf-Life of Chlorine Solutions Recommended in Ebola Virus Disease Response.
Iqbal, Qais; Lubeck-Schricker, Maya; Wells, Emma; Wolfe, Marlene K; Lantagne, Daniele
2016-01-01
In Ebola Virus Disease (EVD) outbreaks, it is widely recommended to wash living things (handwashing) with 0.05% (500 mg/L) chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies) with 0.5% (5,000 mg/L) chlorine solution. Chlorine solutions used in EVD response are primarily made from powdered calcium hypochlorite (HTH), granular sodium dichloroisocyanurate (NaDCC), and liquid sodium hypochlorite (NaOCl), and have a pH range of 5-11. Chlorine solutions degrade following a reaction highly dependent on, and unusually sensitive to, pH, temperature, and concentration. We determined the shelf-life of 0.05% and 0.5% chlorine solutions used in EVD response, including HTH, NaDCC, stabilized NaOCl, generated NaOCl, and neutralized NaOCl solutions. Solutions were stored for 30 days at 25, 30, and 35°C, and tested daily for chlorine concentration and pH. Maximum shelf-life was defined as days until initial concentration fell to pH = 7) had a maximum shelf-life of a few hours, NaDCC solutions (pH = 6) 2 days, generated NaOCl solutions (pH = 9) 6 days, and HTH and stabilized NaOCl solutions (pH 9-11) >30 days. Models were developed for solutions with maximum shelf-lives between 1-30 days. Extrapolating to 40°C, the maximum predicted shelf-life for 0.05% and 0.5% NaDCC solutions were 0.38 and 0.82 hours, respectively; predicted shelf-life for 0.05% and 0.5% generated NaOCl solutions were >30 and 5.4 days, respectively. Each chlorine solution type offers advantages and disadvantages to responders, as: NaDCC is an easy-to-import high-concentration effervescent powder; HTH is similar, but forms a precipitate that may clog pipes; and, NaOCl solutions can be made locally, but are difficult to transport. We recommend responders chose the most appropriate source chlorine compound for their use, and ensure solutions are stored at appropriate temperatures and used or replaced before expiring.
HDR-Aggregate Read Service (ARS)
Department of Veterans Affairs — ARS is a SOAP web service exposed over HTTPS that provides an aggregated (report) view of HTH Survey, DMP and Census data stored in the HDR DB. ARS is deployed in...
Survey Helps Class to See, Understand Local Standards.
Pasternack, Steve
1986-01-01
Presents an exercise in which students interview various groups of citizens--church leaders, school officials, government and business leaders--in order to give students a broader understanding of the definitions of obscenity and community standards. (HTH)
Asset Management Process (AMP) Improvement Project: Final Report of Findings and Recommendations
2009-10-01
Beach, Sue Meade-Lutz, Gary Reid, Deanna Tauvela, and Larry Majure . John Gorman served as the event’s Process Owner. INVESTIGATIONAL QUESTION The...Reid, Deanna Tauvela, and Larry Majure . John Gorman served as the event’s Process Owner. INVESTIGATIONAL QUESTION For years, the Center has...Provide custodians with receipts that are electronically tracked and use the receipt transaction to trigger forced asset transfers in ERP. See Appendix F
ORGANIZED SYMPOSIA, ANNUAL MEETING SAEA, LITTLE ROCK, ARKANSAS, FEBRUARY 1990.
Anonymous
1990-01-01
Education: the key to sustained development in the rural south, Brady J. Deaton; The design, funding and extension of interdisciplinary water quality research, Larry D. Sanders; Fee access to recreational activities by private landowners, Dennis K. Smith; A new challenge for agricultural economics: public policy education & analysis during program implementation, Larry D. Sanders; Software design and development for the direct support of extension programs and extension field staff, G.A. Barn...
Ears and Eyes in the Sky: The Evolution of Manned Airborne ISR
2012-05-25
immeasurably grateful. I would be remiss not to mention Mr. Larry Tart. His work on manned airborne ISR has educated and inspired the latest...comprehensive summary of airborne ISR such as that presented in this thesis. Several prominent works contain significant sections on airborne ISR. Larry ...Historic Cryptographic Collection, RG 457, Box 1369, NARA. 77 William E. Burrows , By Any Means Necessary (New York, NY: Farrar, Straus, and Giroux
Independent Assessment of the Afghan National Security Forces
2014-02-01
to prolong assignment and “ burrow in” Increased cost compared to military or civilian U.S. – Afghanistan Bilateral Simplifies relationships and...227. 248 Larry P. Goodson. Afghanistan’s Endless War: State Failure, Regional Pol- itics, and the Rise of the Taliban. Seattle: University of...Goodson, Larry P. Afghanistan’s Endless War: State Failure, Regional Poli- tics, and the Rise of the Taliban. Seattle: University of Washington Press
Francis Bacon and the Technology of Style.
Baker, Christopher
1983-01-01
Examines Francis Bacon's intentionally devised style for scientific writings and the theoretical basis of that style. Discusses his emphasis on a truly objective point of view, and his use of aphorisms to adapt to his audience. (HTH)
Cohen, Alan S.
1984-01-01
Describes a final exercise that gives composition students a better sense of how they have grown as writers during the semester. Students review, edit, and make conclusions on their "selected works," preparing a manuscript-like folder. (HTH)
Akande, Adebowale
1993-01-01
Describes assessment and successful treatment of a preadolescent with erratic toileting behavior and related social skills difficulties. Treatment included monitoring of bowel movements, using a star chart, and applying rewards as positive reinforcement of acceptable behavior. (HTH)
Hammerstrom, Troy G; Horton, Lori B; Swick, Michelle C; Joachimiak, Andrzej; Osipiuk, Jerzy; Koehler, Theresa M
2015-02-01
The Bacillus anthracis virulence regulator AtxA controls transcription of the anthrax toxin genes and capsule biosynthetic operon. AtxA activity is elevated during growth in media containing glucose and CO(2)/bicarbonate, and there is a positive correlation between the CO(2)/bicarbonate signal, AtxA activity and homomultimerization. AtxA activity is also affected by phosphorylation at specific histidines. We show that AtxA crystallizes as a dimer. Distinct folds associated with predicted DNA-binding domains (HTH1 and HTH2) and phosphoenolpyruvate: carbohydrate phosphotransferase system-regulated domains (PRD1 and PRD2) are apparent. We tested AtxA variants containing single and double phosphomimetic (His→Asp) and phosphoablative (His→Ala) amino acid changes for activity in B. anthracis cultures and for protein-protein interactions in cell lysates. Reduced activity of AtxA H199A, lack of multimerization and activity of AtxAH379D variants, and predicted structural changes associated with phosphorylation support a model for control of AtxA function. We propose that (i) in the AtxA dimer, phosphorylation of H199 in PRD1 affects HTH2 positioning, influencing DNA-binding; and (ii) phosphorylation of H379 in PRD2 disrupts dimer formation. The AtxA structure is the first reported high-resolution full-length structure of a PRD-containing regulator, and can serve as a model for proteins of this family, especially those that link virulence to bacterial metabolism. © 2014 John Wiley & Sons Ltd.
Tyrosine hydroxylase regulatory domain as indicator of enzyme sensitivity to irradiation
International Nuclear Information System (INIS)
Mustafayeva, N.N.; Alieva, I.N.; Aliev, Ds.I.
2002-01-01
Full text: At the present time contra dictionary and variously kind opinions concern to effect of different level of irradiation on the structure and functional activity of the tyrosine hydroxylase (TH), the key a rate-limiting enzyme in the biosynthesis of catecholamines are discussed in this study. To date, the effect of the irradiation on the both catalytic and N-terminal regulatory domains of TH localized in the different parts of the brain has been established. Th is responsible for dopamine, noradrenaline and adrenaline catecholamines neuro mediators biosynthesis, so a number of pathological changes in an organism has been induced by the structural reorganization different parts of the TH domains under pathological effect of environment. The available conformational states of the human TH type 1 (hTH1) regulatory domain, the activity of which is regulated by the feedback inhibition of the catecholamine products including dopamine has been established by the method of molecular mechanics. It is shown that N-terminal sequence Met30-Ser40 of hTH1 located between the two a-helices (residues 16-29 and residues 41-59) has a number of low-energy conformational states. The most available structures consists of b-turn type II on the pentapeptide fragment of hTH1. This fragment distortion under pathological factors effect, i.e. irradiation may lead to global reorganization in enzyme structure as well as at the enzyme catalytic and regulatory functions
Energy Technology Data Exchange (ETDEWEB)
Hammerstrom, Troy G.; Lori, Horton B.; Swick, Michelle C.; Joachimiak, Andrzej; Osipiuk, Jerzy; Koehler, Theresa M.
2014-12-30
The Bacillus anthracis virulence regulator AtxA controls transcription of the anthrax toxin genes and capsule biosynthetic operon. AtxA activity is elevated during growth in media containing glucose and CO2/bicarbonate, and there is a positive correlation between the CO2/bicarbonate signal, AtxA activity and homomultimerization. AtxA activity is also affected by phosphorylation at specific histidines. We show that AtxA crystallizes as a dimer. Distinct folds associated with predicted DNA-binding domains (HTH1 and HTH2) and phosphoenolpyruvate: carbohydrate phosphotransferase system-regulated domains (PRD1 and PRD2) are apparent. We tested AtxA variants containing single and double phosphomimetic (HisAsp) and phosphoablative (HisAla) amino acid changes for activity in B.anthracis cultures and for protein-protein interactions in cell lysates. Reduced activity of AtxA H199A, lack of multimerization and activity of AtxAH379D variants, and predicted structural changes associated with phosphorylation support a model for control of AtxA function. We propose that (i) in the AtxA dimer, phosphorylation of H199 in PRD1 affects HTH2 positioning, influencing DNA-binding; and (ii) phosphorylation of H379 in PRD2 disrupts dimer formation. The AtxA structure is the first reported high-resolution full-length structure of a PRD-containing regulator, and can serve as a model for proteins of this family, especially those that link virulence to bacterial metabolism.
Solution structure of CEH-37 homeodomain of the nematode Caenorhabditis elegans
International Nuclear Information System (INIS)
Moon, Sunjin; Lee, Yong Woo; Kim, Woo Taek; Lee, Weontae
2014-01-01
Highlights: •We have determined solution structures of CEH-37 homedomain. •CEH-37 HD has a compact α-helical structure with HTH DNA binding motif. •Solution structure of CEH-37 HD shares its molecular topology with that of the homeodomain proteins. •Residues in the N-terminal region and HTH motif are important in binding to Caenorhabditis elegans telomeric DNA. •CEH-37 could play an important role in telomere function via DNA binding. -- Abstract: The nematode Caenorhabditis elegans protein CEH-37 belongs to the paired OTD/OTX family of homeobox-containing homeodomain proteins. CEH-37 shares sequence similarity with homeodomain proteins, although it specifically binds to double-stranded C. elegans telomeric DNA, which is unusual to homeodomain proteins. Here, we report the solution structure of CEH-37 homeodomain and molecular interaction with double-stranded C. elegans telomeric DNA using nuclear magnetic resonance (NMR) spectroscopy. NMR structure shows that CEH-37 homeodomain is composed of a flexible N-terminal region and three α-helices with a helix-turn-helix (HTH) DNA binding motif. Data from size-exclusion chromatography and fluorescence spectroscopy reveal that CEH-37 homeodomain interacts strongly with double-stranded C. elegans telomeric DNA. NMR titration experiments identified residues responsible for specific binding to nematode double-stranded telomeric DNA. These results suggest that C. elegans homeodomain protein, CEH-37 could play an important role in telomere function via DNA binding
Solution structure of CEH-37 homeodomain of the nematode Caenorhabditis elegans
Energy Technology Data Exchange (ETDEWEB)
Moon, Sunjin [Structural Biochemistry and Molecular Biophysics Lab, Department of Biochemistry, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Yong Woo; Kim, Woo Taek [Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Weontae, E-mail: wlee@spin.yonsei.ac.kr [Structural Biochemistry and Molecular Biophysics Lab, Department of Biochemistry, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of)
2014-01-10
Highlights: •We have determined solution structures of CEH-37 homedomain. •CEH-37 HD has a compact α-helical structure with HTH DNA binding motif. •Solution structure of CEH-37 HD shares its molecular topology with that of the homeodomain proteins. •Residues in the N-terminal region and HTH motif are important in binding to Caenorhabditis elegans telomeric DNA. •CEH-37 could play an important role in telomere function via DNA binding. -- Abstract: The nematode Caenorhabditis elegans protein CEH-37 belongs to the paired OTD/OTX family of homeobox-containing homeodomain proteins. CEH-37 shares sequence similarity with homeodomain proteins, although it specifically binds to double-stranded C. elegans telomeric DNA, which is unusual to homeodomain proteins. Here, we report the solution structure of CEH-37 homeodomain and molecular interaction with double-stranded C. elegans telomeric DNA using nuclear magnetic resonance (NMR) spectroscopy. NMR structure shows that CEH-37 homeodomain is composed of a flexible N-terminal region and three α-helices with a helix-turn-helix (HTH) DNA binding motif. Data from size-exclusion chromatography and fluorescence spectroscopy reveal that CEH-37 homeodomain interacts strongly with double-stranded C. elegans telomeric DNA. NMR titration experiments identified residues responsible for specific binding to nematode double-stranded telomeric DNA. These results suggest that C. elegans homeodomain protein, CEH-37 could play an important role in telomere function via DNA binding.
The Computer and the Writer's Craft: Implications for Teachers.
Brockmann, R. John; McCauley, Rebecca J.
1984-01-01
Examines how computers as a medium for communication affect the craft of writing, and subsequently affect teaching approaches. Discusses the need for teaching online document design and problem-solving processes as they relate to the communication process. (HTH)
Hydrogen metal hydride storage with integrated catalytic recombiner for mobile application
Energy Technology Data Exchange (ETDEWEB)
Marinescu-Pasoi, L.; Behrens, U.; Langer, G.; Gramatte, W.; Rastogi, A.K.; Schmitt, R.E. (Battelle-Institut e.V., Frankfurt am Main (DE). Dept. of Energy Technology)
1991-01-01
A novel, thermodynamically efficient device is under development at Battelle in Frankfurt, by which the range of hydrogen-driven cars with a metal hydride tank might be roughly doubled. The device makes use of the properties of metal hydrides, combined with catalytic combustion. Its development is funded by the Hessian Ministry of Economic Affairs and Technology; it is to be completed by the end of 1990. High-temperature hydrides (HTH) have about three times the storage capacity of low temperature hydrides (LTH), but require relatively large amounts of heat at high temperatures to release the hydrogen. The exhaust heat from combustion-engine-driven vehicles is insufficient for this, and vehicles with electric (fuel cell) drive produce practically no exhaust heat at all. The Battelle-developed device is a combination of an HTH storage cell, an LTH storage cell and a catalyst. (author).
Thermodynamic study of the thorium-hydrogen system at 700 K
International Nuclear Information System (INIS)
Picard, C.; Kleppa, O.J.
1980-01-01
The partial enthalpies of solution of hydrogen in thorium-hydrogen alloys with H/Th ratios ranging from 0 to 2 have been measured calorimetrically at 700 K. From these data we calculate the standard enthalpy of formation of ThH 2 at this temperature to be -34.8 kcal mol -1 with an estimated uncertainty of +- 0.2 kcal mol -1 . This agrees well with values calculated by earlier investigators from plateau pressure equilbrium data. For several alloy compositions within the nearly stoichiometric phase ThH 2 the equilibrium pressures of hydrogen also were determined. Comparisons of the relative partial Gibbs energies of hydrogen obtained from these equilibrium pressures with corresponding enthalpies from calorimetry provide information on the partial entropy. The partial enthalpy and entropy both change dramatically with composition between H/Th = 1.99 and 2.003
Steward of Headwaters: U.S. Army Corps of Engineers, St. Paul District, 1975-2000
2012-01-01
to their shells, thereby preventing them from migrating or burrowing .73 The St. Paul District initiated a monitoring process of the zebra mussel at...P ro je ct s 4 104 Strong Move, 13 February 1997, File LaFarge Ho Chunk, Box 6410, SPDAR; Ron Wilber to Larry Garvin, HoChunk Researcher, 10...July 1987, File Congressional Correspondence, Box 6412, SPDAR. 39 Larry and Diane Uhlir to Mr. Gregg Struss, Resource Manager, Gull Lake Recreation
Mike O’Callaghan Federal Medical Center Campus Environmental Assessment
2012-03-01
and therefore is protected under the Endangered Species Act (ESA). The western burrowing owl (Athene cunicularia) is a former USFWS C- 2 species and...JVanHavel@dot . state . nv.us> ; keiba.crear@snwa.com; LANGSTON@ClarkCountyNV. gov; ~arry . Tamashiro@ lvvwd. com <mailto : Larry . Tamashi! r o@lvvwd...Wardlaw; JVanHavel @dot .state.nv .us; keiba . c rear@snwa . com; Rodney Langston; Larry . Tamashiro@l vvwd.com; laura. j a cobsen@lvvwd . com
The Lens of Power: Aerial Reconnaissance and Diplomacy in the Airpower Century
2013-01-01
comments at Burrows , By Any Means Necessary, 321. These comments are echoed by Larry Tart at Burrows , By Any Means Necessary, xvi. 1143 As if to make this...For example: William Burrows , Paul Lashmar, L. Parker Temple, Chris Pocock, Gregory Pedlow, and Donald Welzenbach. Their works are covered more...reconnaissance. For example, Larry Tart and Robert Keefe’s 2001 The Price of Vigilance was written to raise awareness about reconnaissance crews who never
J-Educators Must Deal with "A Nation at Risk."
Craig, J. Robert
1985-01-01
Suggests that mass communication educators need to interpret the literacy called for in "A Nation at Risk" to include media literacy: responsible awareness of media effects, media criticism and ethics, nontraditional media technologies, and media issues and problems. (HTH)
Children's Preferences for Film Form and Technique.
Cox, Carole
1982-01-01
Describes the methodology and results of a study of the preferences of fourth- and fifth-grade children for film form and technique. Indicates that children prefer narrative/live action films, followed by narrative/animation, nonnarrative/live action, and nonnarrative/animation. (HTH)
Respecting an Individual's Privacy Critical in Making Difficult Journalistic Judgments.
Adams, Julian
1984-01-01
Discusses the criteria of "newsworthy" regarding news reporting and the right to privacy. Examines the thin line between what is legal and what is ethical to print and some components of the law to consider when making such decisions. (HTH)
From Surrogacy to Contested Adoption: What Went Wrong?
Greenfield, Joanna; Jennings, Seamus
1995-01-01
Notes the complex and emotive nature of surrogate motherhood. Describes a surrogacy arrangement that was apparently based initially on a clear agreement and partnership, but developed into a disputed adoption application when the surrogate mother became dissatisfied with contact arrangements. (HTH)
Elementary School Math Instruction: Can Reading Specialists Assist?
Heinrichs, Audrey S.
1987-01-01
Discusses the contradictions found in recommendations for direction instruction or informal math language development, and some suggestions for practical resolution of disagreements, to enable school reading specialists to provide both background and practical help to classroom instructors teaching math. (HTH)
Formal Specification and Analysis of Cloud Computing Management
2012-01-24
te r Cloud Computing in a Nutshell We begin this introduction to Cloud Computing with a famous quote by Larry Ellison: “The interesting thing about...the wording of some of our ads.” — Larry Ellison, Oracle CEO [106] In view of this statement, we summarize the essential aspects of Cloud Computing...1] M. Abadi, M. Burrows , M. Manasse, and T. Wobber. Moderately hard, memory-bound functions. ACM Transactions on Internet Technology, 5(2):299–327
"Daughter of Time": Outside Reading for a Research Writing Course.
Sosville, Jerri
1987-01-01
Presents an alternative to the usual selections taught in research paper writing courses. Suggests that Josephine Tey's novel is more relevant and enjoyable, as well as better suited for research projects, than, for example, "1984" or "The Sound and the Fury." (HTH)
Ainsworth, Mary D. S.; Marvin, Robert S.
1995-01-01
Developmental psychologist Ainsworth discusses early influences on her work in attachment theory; similarities and differences in attachment behaviors across cultures; construction of assessments and research designs; individual differences in attachment and maternal support; and the influence of early relationships on later ones. (HTH)
Intercountry Adoption: A Comparison between France and England.
Greenfield, Joanna
1995-01-01
Examined the intercountry adoption experiences of 100 French and 100 English families, comparing policy in each country. Found a lack of effective and sensitive management of the introductory meetings between prospective parents and adoptive children, and of adequate birth records information. (HTH)
Murphy, Christina
1985-01-01
Presents a dialogue between two adherents of the process centered paradigm of rhetoric: one a "classicist" who sees art as the knowledge necessary for producing preconceived results by conscious, directed actions, and the other a "romantic," who sees art as "magical" inspiration. (HTH)
Strategic Studies Quarterly. Volume 7, Number 3, Fall 2013
2013-01-01
Data Processing One of the five tasks given Air Force ISR chief Lt Gen Larry James by Secretary Donley was to develop a roadmap for intelligence...34 7. McCullough, "Eye on Future ISR." 8. "Lt Gen Larry James: Air Force Will Combine Space, Cyber and Airborne ISR Capa- bilities," Inside Defense... Burrows , This New Ocean (New York: Random House, 1998) 191. 81. Paul B. Stares, The Militarization of Space (Ithaca, NY: Cornell University Press) 49. 82
2011 Integrated Warfare Systems Conference Held in Arlington, Virginia on December 6-7, 2011
2011-12-06
Kaplan IWS6EA 1E2111 M. Roberts IWS6ENG2 1E2031 Director Sensor Netting/Track Management D. Burrows , IWS6SN/TM, 1E2131 Brian Harris...Invention (Basic and Applied Science) ≈45% ≈12% Director of Transition 11 • FNC, PEOs, Industry • ManTech • SBIR 12 Dr. Larry Schuette...engagement. − We are a people-centric organization for better or for worse • How are we doing? 32 Contact Information Larry Schuette
Applications of the Wilkinson Model of Writing Maturity to College Writing.
Sternglass, Marilyn
1982-01-01
Examines the four-category model developed by Andrew Wilkinson at the University of Essex (England) to assess growth in writing maturity. The four measures of development are stylistic, affective, cognitive, and moral. Each has several subcategories. Includes college student essays to illustrate the model. (HTH)
What Do Feminist Critics Want? Or a Postcard from the Volcano.
Gilbert, Sandra
1980-01-01
Explores the task of revising Western culture, particularly in the study of literature, that feminist critics encounter. Discusses the male-oriented attitudes towards feminist studies in academia, as well as the attributes of and need for the study of literature from a feminist perspective. (HTH)
Chinese Journalism Education: Slow Progress since 1918.
Jingming, Zhang; Jiana, Peng
1986-01-01
Notes that journalism education prior to 1949 was modeled after American journalism schools, while since the 1950s, that orientation has been replaced by Soviet principles. Observes the projected shortage of journalism graduates and the need for increased capacity in journalism institutions and for increased international exchange. (HTH)
Hirsch's "Philosophy of Composition": An Evaluation of the Argument.
Doherty, Paul C.
1982-01-01
Examines the description of the reading for revision process put forth in E. D. Hirsch's "The Philosophy of Composition," contending the research studies Hirsch uses are inconsistent and, taken together, do not support the general description of the reading process that underlies the argument of the book. (HTH)
Effect of excess ozone on UV-stimulated tritium oxidation
International Nuclear Information System (INIS)
Hasegawa, Kiyoshi; Horii, Kazuhiro; Matsuyama, Masao; Watanabe, Kuniaki.
1995-01-01
The authors have reported that the oxidation of tritium is considerably accelerated by irradiating a mixture gas of HT(H 2 )-O 2 with UV-photons, and this UV-stimulated HT oxidation is mainly due to the formation of intermediates such as ozone and activated oxygen species. This suggests that the oxidation will be much more enhanced in the presence of excess ozone in the reaction system. To examine this possibility, effects of the excess ozone on the UV-stimulated HT oxidation was experimentally studied on the one hand, and reaction mechanisms were investigated by developing a computer simulation program applicable to the three-component system of HT(H 2 )-O 2 -O 3 . The formation rate of HTO was measured for gas mixtures consisting of O 2 (75.5 Torr), O 3 (0.5-2% of O 2 ), H 2 (0.1-3% of O 2 ) and HT(H 2 /HT=12000). The experiments showed considerable enhancement of the HTO production rate in the presence of excess ozone by UV-photons from a low pressure mercury lamp(5W). The time course of the reaction was reproduced quite well by computer simulation, indicating that the assumed reaction mechanism is valid. This is also supported by observations that computer simulation reproduced the experimentally observed dependence of ozone decomposition rate on ozone and hydrogen pressures under the UV-irradiation. Those results showed that UV-stimulated HT oxidation was accelerated by about 14000 times in the presence of excess ozone. It strongly suggests that the UV-stimulated oxidation in the presence of excess ozone will be applicable to tritium handling systems as a non-catalytic tritium removal method. (author)
The effects of heat treatment and environment on corrosion fatigue
International Nuclear Information System (INIS)
Ballinger, R.G.; Hwang, I.S.; Elliott, C.K.
1993-05-01
Alloy X-750 is a nickel-base alloy used extensively in Light Water Reactor (LWR) nuclear power systems due to its excellent corrosion resistance and high temperature strength. In spite of alloy X-750's exceptional high temperature properties, it has been found to be susceptible to environmentally assisted fatigue and stress corrosion cracking in relatively low temperature aqueous environments such as those that exist in LWR systems. In order to develop a better understanding of the role that microstructure plays in the fatigue behavior of alloy X-750, three thermal treatments were studied. The treatments used were as hot worked + : (1) 24 h at 885 degree C + 20 h at 704 degree C (AH), (2) lh at 982 degree C + 20 h at 704 degree C (BH), and (3) 1 h at 1093 degree C + 20 h at 704 degree C (HTH). Fatigue crack growth tests were conducted at frequencies of 0.1 and 10 Hz in the following aqueous environments: (1) high purity, air saturated water (8 ppM O 2 ) at 93 degree C and 288 degree C, (2) high purity, deoxygenated water (5 ppb O 2 ) at 93 degree C, and (3) simulated BWR water chemistry with hydrogen additions at 288 degree C. Crack growth rate data was collected at constant values of stress intensity factor range (ΔK). The results show that crack growth rates and morphology are a function of ΔK, frequency, thermal treatment and environment. Frequency effects were most significant for the AH material. Crack growth rates generally decrease, for a given value of ΔK, in the BH and HTH materials with the HTH material showing the lowest growth rate
Students Write, Then "Sell" Ad Copy to Class.
Galician, Mary Lou
1986-01-01
Describes a course in commercial copywriting for electronic media in which students must also present orally their copy to the class to drive home two points: (1) the writing has to sell products, and (2) the writer has to sell the spot or campaign to the client or employers. (HTH)
Sluder, R. S.; Luder, Linda C.
1995-01-01
Notes that children with special needs often require specific considerations with regard to dental care. Discusses some of the physical disabilities and how they interfere with dental hygiene, and how child caregivers can modify daily routines and assist disabled children with areas of hygiene the children may find difficult. (HTH)
Timing of Childhood Events and Early-Adult Household Formation.
Hill, Martha S.; And Others
1996-01-01
Identified a number of risk factors contributing to early household formation. Found that for girls, factors included mother's educational level and birth order; for boys, parental divorce at any stage of childhood. Risk factors common to boys and girls were age of mother at time of child's birth and race. (HTH)
Directory of Open Access Journals (Sweden)
Redactie KITLV
1953-04-01
Full Text Available - G.J. Held, P.E. de Josselin de Jong, Minangkabau and Negri Sembilan; Socio-political structure in Indonesia, 1951, PhD thesis, Leiden, viii + 208 pp. H.Th. Fischer, C. Nooteboom, Trois problèmes d'ethnologie maritime, 1952, Rotterdam: Museum van Land- en Volkenkunde, 25 figuren.
Stenning, Keith; Michell, Lynn
1985-01-01
Reports the results of a study showing that one stylistic feature, the inclusion of connectives other than "and/then" is a good predictor of explanation in five- to ten-year-olds, but a straightforward lack of linguistic resources is not necessarily what limits older children's achievement of explanatory narrative. (HTH)
Dunham, Diane
1995-01-01
Outlines a minicourse for the middle level, intended as a foundation for planning courses that meet the unique needs of each school and its students. The course, on the properties of silver, covers the curricular areas of science, social studies, language arts, math, creative arts, and vocational-career education. (HTH)
Teaching the 'A' Level Text: Emma.
Huband, David
1987-01-01
Notes how important it is that any critical writing assignments should take into account the individual reading, and that the teacher's role is to steer discussion that stems from a class of individual readings. Explores some of the aspects of Jane Austen's novel "Emma" to which students readily respond. (HTH)
Children Today, 1994
1994-01-01
Notes that our capacity to diffuse conflict rests in our ability to recognize and verbalize feelings, develop empathy, and think of alternatives to violence. Explores the influence of role models and culture on violence and how the media can use violent images effectively in helping us confront a culture of violence. (HTH)
Tritium removal using vanadium hydride
International Nuclear Information System (INIS)
Hill, F.B.; Wong, Y.W.; Chan, Y.N.
1978-01-01
The results of an initial examination of the feasibility of separation of tritium from gaseous protium-tritium mixtures using vanadium hydride in cyclic processes is reported. Interest was drawn to the vanadium-hydrogen system because of the so-called inverse isotope effect exhibited by this system. Thus the tritide is more stable than the protide, a fact which makes the system attractive for removal of tritium from a mixture in which the light isotope predominates. The initial results of three phases of the research program are reported, dealing with studies of the equilibrium and kinetics properties of isotope exchange, development of an equilibrium theory of isotope separation via heatless adsorption, and experiments on the performance of a single heatless adsorption stage. In the equilibrium and kinetics studies, measurements were made of pressure-composition isotherms, the HT--H 2 separation factors and rates of HT--H 2 exchange. This information was used to evaluate constants in the theory and to understand the performance of the heatless adsorption experiments. A recently developed equilibrium theory of heatless adsorption was applied to the HT--H 2 separation using vanadium hydride. Using the theory it was predicted that no separation would occur by pressure cycling wholly within the β phase but that separation would occur by cycling between the β and γ phases and using high purge-to-feed ratios. Heatless adsorption experiments conducted within the β phase led to inverse separations rather than no separation. A kinetic isotope effect may be responsible. Cycling between the β and γ phases led to separation but not to the predicted complete removal of HT from the product stream, possibly because of finite rates of exchange. Further experimental and theoretical work is suggested which may ultimately make possible assessment of the feasibility and practicability of hydrogen isotope separation by this approach
Shelf-Life of Chlorine Solutions Recommended in Ebola Virus Disease Response.
Directory of Open Access Journals (Sweden)
Qais Iqbal
Full Text Available In Ebola Virus Disease (EVD outbreaks, it is widely recommended to wash living things (handwashing with 0.05% (500 mg/L chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies with 0.5% (5,000 mg/L chlorine solution. Chlorine solutions used in EVD response are primarily made from powdered calcium hypochlorite (HTH, granular sodium dichloroisocyanurate (NaDCC, and liquid sodium hypochlorite (NaOCl, and have a pH range of 5-11. Chlorine solutions degrade following a reaction highly dependent on, and unusually sensitive to, pH, temperature, and concentration. We determined the shelf-life of 0.05% and 0.5% chlorine solutions used in EVD response, including HTH, NaDCC, stabilized NaOCl, generated NaOCl, and neutralized NaOCl solutions. Solutions were stored for 30 days at 25, 30, and 35°C, and tested daily for chlorine concentration and pH. Maximum shelf-life was defined as days until initial concentration fell to 30 days. Models were developed for solutions with maximum shelf-lives between 1-30 days. Extrapolating to 40°C, the maximum predicted shelf-life for 0.05% and 0.5% NaDCC solutions were 0.38 and 0.82 hours, respectively; predicted shelf-life for 0.05% and 0.5% generated NaOCl solutions were >30 and 5.4 days, respectively. Each chlorine solution type offers advantages and disadvantages to responders, as: NaDCC is an easy-to-import high-concentration effervescent powder; HTH is similar, but forms a precipitate that may clog pipes; and, NaOCl solutions can be made locally, but are difficult to transport. We recommend responders chose the most appropriate source chlorine compound for their use, and ensure solutions are stored at appropriate temperatures and used or replaced before expiring.
International Nuclear Information System (INIS)
Wright, T.
1983-01-01
Consider a stratified population with L strata, so that a Poisson random variable is associated with each stratum. The parameter associated with the hth stratum is theta/sub h/, h = 1, 2, ..., L. Let ω/sub h/ be the known proportion of the population in the hth stratum, h = 1, 2, ..., L. The authors want to estimate the parameter theta = summation from h = 1 to L ω/sub h/theta/sub h/. We assume that prior information is available on theta/sub h/ and that it can be expressed in terms of a gamma distribution with parameters α/sub h/ and β/sub h/, h = 1, 2, ..., L. We also assume that the prior distributions are independent. Using squared error loss function, a Bayes allocation of total sample size with a cost constraint is given. The Bayes estimate using the Bayes allocation is shown to have an adjusted mean square error which is strictly less than the adjusted mean square error of the classical estimate using the classical allocation
75 FR 35765 - Proposed Information Collection; Comment Request; BroadbandMatch Web Site Tool
2010-06-23
... infrastructure, public computer centers and sustainable broadband adoption projects. NTIA Administrator Larry E... the White House's Open Government Initiative that seeks to promote transparency, openness and...
Blind Grid Scoring Record No. 290
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Blind Grid Scoring Record No. 293
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George; Archiable, Robert; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Blind Grid. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record Number 312
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Archiable, Robert; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Scoring Committee...
Standardized UXO Demonstration Site Blind Grid Scoring Record No. 690
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Archiable, Robert; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Scoring Committee...
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 257
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 252
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record Number 691
National Research Council Canada - National Science Library
Overbay, Jr., Larry; Watts, Kimberly; Fling, Rick; McClung, Christina; Banta, Matthew
2006-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site blind grid. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 237
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 764
National Research Council Canada - National Science Library
Overbay, Larry; Watts, Kimberly
2006-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 690
National Research Council Canada - National Science Library
Overbay, Larry
2005-01-01
...) utilizing the YPC Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 426
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Archiable, Robert; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 657
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinate by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Open Field Scoring Record No. 298
National Research Council Canada - National Science Library
Overbay, Jr., Larry; Robitaille, George; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record No. 442
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Archiable, Robert; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) unitizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing they PG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinate by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Open Field Scoring Record No. 299
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 638
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Archiable, Robert; McClung, Christina
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Woods Scoring Record Number 486
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
"Matrix : Revolutsiooni" esilinastusele on ostetud üle 700 pileti
2003-01-01
Andy ja Larry Wachowski ulmefilmide triloogia 3. osa "Matrix : Revolutsioon" ("The Marix Revolutions") jõuab 5. novembril esilinastuseni korraga enam kui 50 riigis, sealhulgas MPDE vahendusel ka Eestis
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 396
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 268
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record Number 431
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 397
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site. Open Field Scoring Record Number 154
National Research Council Canada - National Science Library
Overbay, Larry
2004-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 379
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
... (UXO) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. Scoring Records have been coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 354
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Archiable, Robert; McClung, Christina
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record No. 311
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbuy and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 129
National Research Council Canada - National Science Library
Overbay, Larry
2004-01-01
...) utilizing the APO Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 229
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Boutin, Matthew; Fling, Rick; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site, Open Field Scoring Record Number 411
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 169
National Research Council Canada - National Science Library
Overbay, Larry; Archiable, Robert; McClung, Christina; Robitaille, George
2005-01-01
...) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 201
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Fling, Rick; Robitaille, George
2004-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 165
National Research Council Canada - National Science Library
Overbay, Larry
2004-01-01
...) utilizing the APO Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Kaugeks jäänud jant / Gert Kiiler
Kiiler, Gert
2007-01-01
DVDl ilmunud film "Borat - kultuurialased õppetunnid Ameerikast abiks suursuguse Kasahstani riigi ülesehitamisel" : režissöör Larry Charles, peaosas Sacha Baron Cohen : Ameerika Ühendriigid 2006
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 671
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
... (UXO) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Deomostration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 245
National Research Council Canada - National Science Library
Overbay, Larry
2005-01-01
... (UXO) utilizing the YPG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 675
National Research Council Canada - National Science Library
Overbay, Larry; Robitaille, George
2005-01-01
... (UXO) utilizing the APG Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...
77 FR 26008 - Ocean Transportation Intermediary License; Applicants
2012-05-02
.... Forth-Matthews, President, Application Type: New OFF License. Azimuth Lines Inc. (OFF), 111 Ivy Lane.... (NVO), 1000 Lakes Drive, 260, West Covina, CA 91760, Officers: Larry Lee, Treasurer (Qualifying...
2012-02-13
... October 17, 2011 (``Themis Letter''); Garret Cook, dated November 4, 2011 (``Cook Letter''); James.... Larry Paden, Bright Trading, dated December 1, 2011 (``Paden Letter''); Thomas Dercks, dated December 1...
75 FR 58435 - Membership of the Senior Executive Service Standing Performance Review Boards
2010-09-24
..., ROBERT N ASSOCIATE DEPUTY ATTORNEY GENERAL MONACO, LISA ASSOCIATE DEPUTY ATTORNEY GENERAL BURROWS... GENERAL MASON, KAROL V DEPUTY ASSOCIATE ATTORNEY GENERAL TRIBE, LARRY H SENIOR COUNSELOR FOR ACCESS TO...
Indian Academy of Sciences (India)
notes the total capital available for the survey, Co the over- head cost, Ch the cost of surveying a unit in the hth stratum and nh the number of units surveyed in the ... optimal allocation in the remaining strata by taking n -. Ej=l N hi as the sample size. It is shown below that a similar situation may also arise under the setup (ti).
Directory of Open Access Journals (Sweden)
Marlene K Wolfe
Full Text Available To prevent disease transmission, 0.05% chlorine solution is commonly recommended for handwashing in Ebola Treatment Units. In the 2014 West Africa outbreak this recommendation was widely extended to community settings, although many organizations recommend soap and hand sanitizer over chlorine. To evaluate skin irritation caused by frequent handwashing that may increase transmission risk in Ebola-affected communities, we conducted a randomized trial with 91 subjects who washed their hands 10 times a day for 28 days. Subjects used soap and water, sanitizer, or one of four chlorine solutions used by Ebola responders (calcium hypochlorite (HTH, sodium dichloroisocyanurate (NaDCC, and generated or pH-stabilized sodium hypochlorite (NaOCl. Outcomes were self-reported hand feel, irritation as measured by the Hand Eczema Score Index (HECSI (range 0-360, signs of transmission risk (e.g., cracking, and dermatitis diagnosis. All groups experienced statistically significant increases in HECSI score. Subjects using sanitizer had the smallest increases, followed by higher pH chlorine solutions (HTH and stabilized NaOCl, and soap and water. The greatest increases were among neutral pH chlorine solutions (NaDCC and generated NaOCl. Signs of irritation related to higher transmission risk were observed most frequently in subjects using soap and least frequently by those using sanitizer or HTH. Despite these irritation increases, all methods represented minor changes in HECSI score. Average HECSI score was only 9.10 at endline (range 1-33 and 4% (4/91 of subjects were diagnosed with dermatitis, one each in four groups. Each handwashing method has benefits and drawbacks: soap is widely available and inexpensive, but requires water and does not inactivate the virus; sanitizer is easy-to use and effective but expensive and unacceptable to many communities, and chlorine is easy-to-use but difficult to produce properly and distribute. Overall, we recommend Ebola
Wolfe, Marlene K; Wells, Emma; Mitro, Brittany; Desmarais, Anne Marie; Scheinman, Pamela; Lantagne, Daniele
2016-01-01
To prevent disease transmission, 0.05% chlorine solution is commonly recommended for handwashing in Ebola Treatment Units. In the 2014 West Africa outbreak this recommendation was widely extended to community settings, although many organizations recommend soap and hand sanitizer over chlorine. To evaluate skin irritation caused by frequent handwashing that may increase transmission risk in Ebola-affected communities, we conducted a randomized trial with 91 subjects who washed their hands 10 times a day for 28 days. Subjects used soap and water, sanitizer, or one of four chlorine solutions used by Ebola responders (calcium hypochlorite (HTH), sodium dichloroisocyanurate (NaDCC), and generated or pH-stabilized sodium hypochlorite (NaOCl)). Outcomes were self-reported hand feel, irritation as measured by the Hand Eczema Score Index (HECSI) (range 0-360), signs of transmission risk (e.g., cracking), and dermatitis diagnosis. All groups experienced statistically significant increases in HECSI score. Subjects using sanitizer had the smallest increases, followed by higher pH chlorine solutions (HTH and stabilized NaOCl), and soap and water. The greatest increases were among neutral pH chlorine solutions (NaDCC and generated NaOCl). Signs of irritation related to higher transmission risk were observed most frequently in subjects using soap and least frequently by those using sanitizer or HTH. Despite these irritation increases, all methods represented minor changes in HECSI score. Average HECSI score was only 9.10 at endline (range 1-33) and 4% (4/91) of subjects were diagnosed with dermatitis, one each in four groups. Each handwashing method has benefits and drawbacks: soap is widely available and inexpensive, but requires water and does not inactivate the virus; sanitizer is easy-to use and effective but expensive and unacceptable to many communities, and chlorine is easy-to-use but difficult to produce properly and distribute. Overall, we recommend Ebola responders and
Standardized UXO Technology Demonstration Site Blind Grid Scoring Record No. 213
National Research Council Canada - National Science Library
Overbay, Larry; Archiable, Robert; McClung, Christina; Robitaille, George
2005-01-01
... (UXO) utilizing the YPG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Site Scoring Committee...
Consensus Through Conversation How to Achieve High-Commitment Decisions
Dressler, Larry
2006-01-01
Facilitation expert Larry Dressler's Consensus Through Conversation is a guide for the effective facilitation and practice of one of business's most popular - but most widely misunderstood - decision-making models: consensus.
Bogi i monstrõ, ili biografija Supermena / Olga Marsheva
Marsheva, Olga
2007-01-01
Ameerika tuntuimad koomiksikunstnikud Larry Hama, Stan Lee, Jerry Seagel, Bob Kain, Frank Miller ja nende loodud tegelaskujud. Ka briti kirjanik Alan Moore, kellele ei meeldi oma kangelastest tehtud ekraniseeringuid vaadata
78 FR 41032 - Proposed Information Collection; Comment Request; Foreign Availability Procedures
2013-07-09
... comments to Jennifer Jessup, Departmental Paperwork Clearance Officer, Department of Commerce, Room 6616... instrument and instructions should be directed to Larry Hall, BIS ICB Liaison, (202) 482-4895, Lawrence.Hall...
Werner, Laurie
2014-01-01
Oracle'i tegevjuht Larry Ellison ostis 98% Hawai saarest Lanaist. Ettevõtja soovib rajada sinna tööstuspiirkondada, võtta kasutusele päikeseenergiarajatisi, tuua saarele elektriautosid ja suurendada elanikkonda
78 FR 41032 - Proposed Information Collection; Comment Request; Special Comprehensive License
2013-07-09
... to Jennifer Jessup, Departmental Paperwork Clearance Officer, Department of Commerce, Room 6616, 14th... instrument and instructions should be directed to Larry Hall, BIS ICB Liaison, (202) 482-4895, Lawrence.Hall...
2012-04-26
.... FOR FURTHER INFORMATION CONTACT: Larry Crist, Field Supervisor, (telephone 801-975-3330; facsimile 801... emerge from their burrows by mid to late June at which time they are foraging independently (Hoogland...
Borat tungib psüühesse / Rain Tolk
Tolk, Rain, 1977-
2006-01-01
Briti koomik Sacha Baron Cohen ja tema loodud peategelasega film "Borat - kultuurialased õppetunnid Ameerikast abiks suursuguse Kasahstani riigi ülesehitamisel", režissöör Larry Charles : Ameerika Ühendriigid 2006
TSD acceptance testing in Australia
Wix, Richard
2014-01-01
Structural Session 3: Current Applications Moderated by Larry Scofield This presentation was held at the Pavement Evaluation 2014 Conference, which took place from September 15-18, 2014 in Blacksburg, Virginia. Presentation only
Kas Merrillis õnnestub korrata New Yorgi börsi edu? / Matthew Goldstein, Emily Thornton
Goldstein, Matthew
2007-01-01
Juhivahetusest ja tulevikuperspektiividest Merill Lynchi investeerimispangas. Vt. samas: Mara Der Hovanesian. Miks mitte Larry Fink?; Karen Young. Kuldsed langevarjud. Lisa: Kui nad täna lahkuksid (kümne tuntud tippjuhi lahkumispaketid)
77 FR 2270 - Proposed Information Collection; Comment Request; Firearms Convention
2012-01-17
... Jennifer Jessup, Departmental Paperwork Clearance Officer, Department of Commerce, Room 6616, 14th and... and instructions should be directed to Larry Hall, BIS ICB Liaison, (202) 482-4895, Lawrence[email protected
2010-09-09
... Pancakes and Larry's East Colfax Avenue. Trading Post (now Mama's Caf[eacute], Herbs and Art, and Purple... conclusively shown to increase the risk of lung cancer. Dispersion quickly dilutes radon emanating from radium...
Kolmas "Matrix" põrutab kuulipildujaga / Andres Laasik
Laasik, Andres, 1960-2016
2003-01-01
Andy ja Larry Wachowski ulmefilmide triloogia 3. osa "Matrix : Revolutsioon" ("The Marix Revolutions") jõuab 5. novembril kell 16 meie aja järgi esilinastuseni korraga paljudes riikides, sealhulgas MPDE vahendusel ka Eestis
2011-12-23
..., dated October 17, 2011; Garret Cook, dated November 4, 2011; James Johannes, dated November 27, 2011... November 30, 2011; Dr. Larry Paden, Bright Trading, dated December 1, 2011; Thomas Dercks, dated December 1...
Matrix - kultusfilm, mis muutus müüdiks / Rando Tooming
Tooming, Rando
2003-01-01
Andy ja Larry Wachowski ulmefilmide triloogia 3. osa "Matrix : Revolutsioon" ("The Marix Revolutions") jõuab 5. novembril esilinastuseni korraga enam kui 50 riigis, sealhulgas MPDE vahendusel ka Eestis. Eesti filmikriitikute arvamusi Matrix'i fenomenist
Spacelab Life Sciences Research Panel
Sulzman, Frank; Young, Laurence R.; Seddon, Rhea; Ross, Muriel; Baldwin, Kenneth; Frey, Mary Anne; Hughes, Rod
2000-01-01
This document describes some of the life sciences research that was conducted on Spacelab missions. Dr. Larry Young, Director of the National Space Biomedical Research Institute, provides an overview of the Life Sciences Spacelabs.
Directory of Open Access Journals (Sweden)
Ram Prakash Gupta
2017-11-01
Full Text Available During animal development, selector genes determine identities of body segments and those of individual organs. Selector genes are also misexpressed in cancers, although their contributions to tumor progression per se remain poorly understood. Using a model of cooperative tumorigenesis, we show that gain of selector genes results in tumor cooperation, but in only select developmental domains of the wing, haltere and eye-antennal imaginal discs of Drosophila larva. Thus, the field selector, Eyeless (Ey, and the segment selector, Ultrabithorax (Ubx, readily cooperate to bring about neoplastic transformation of cells displaying somatic loss of the tumor suppressor, Lgl, but in only those developmental domains that express the homeo-box protein, Homothorax (Hth, and/or the Zinc-finger protein, Teashirt (Tsh. In non-Hth/Tsh-expressing domains of these imaginal discs, however, gain of Ey in lgl− somatic clones induces neoplastic transformation in the distal wing disc and haltere, but not in the eye imaginal disc. Likewise, gain of Ubx in lgl− somatic clones induces transformation in the eye imaginal disc but not in its endogenous domain, namely, the haltere imaginal disc. Our results reveal that selector genes could behave as tumor drivers or inhibitors depending on the tissue contexts of their gains.
Nestor, Siim, 1974-
2006-01-01
Briti koomik Sacha Baron Cohen ja tema loodud peategelasega film "Borat - kultuurialased õppetunnid Ameerikast abiks suursuguse Kasahstani riigi ülesehitamisel", režissöör Larry Charles : Ameerika Ühendriigid 2006. Lisaks "Seigad Coheni elust"
75 FR 44050 - Qualification of Drivers; Exemption Applications; Vision
2010-07-27
..., Mitchell L. Carmen, Christopher R. Cone, Walter O. Connelly, Stephen B. Copeland, Armando P. D'Angeli..., Andrew C. Kelly, Jason W. King, James T. Leek, Billy J. Lewis, Velmer L. McClelland, Larry McCoy, Sr...
78 FR 26107 - Qualification of Drivers; Exemption Applications; Diabetes Mellitus
2013-05-03
... Christopher W. Bailey (OH), Kent S. Bills (IN), Bobby B. Brown (VA), Maryland A. Chandler (KY), Ronald D. Clark (AR), Larry L. Eberly (PA), Steven J. Fessler (IL), Michael R. Fisher (IA), Mark A. Krause (PA...
Irradiation-assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.
1995-01-01
In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water. New data confirms previous results that high irradiation levels reduce SCC resistance in Alloy X-750. Low boron heats show improved IASCC (irradiation-assisted stress corrosion cracking). Alloy 625 is resistant to IASCC. Microstructural, microchemical, and deformation studies were carried out. Irradiation of X-750 caused significant strengthening and ductility loss associated with formation of cavities and dislocation loops. High irradiation did not cause segregation in X-750. Irradiation of 625 resulted in formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to loops and precipitates was apparently offset in 625 by partial dissolution of γ precipitates. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in X-750, and the absence of these two effects results in superior IASCC resistance in 625
1984-01-01
350 STATE TOTAL 377 NEBRASKA ARMY TRACTORS WHEELED 111 CONTRACTOR TOTAL 488 PINE BUSH EQUIPMENT CO INC NEW YORK ARMY TRACTORS WHEELED 49 PSI MOBILE...ARMY VEHICULAR FURNITURE AND ACCESSORIES 48- AURORA CORD a CABLE CO INC ILLINOIS ARMY VEHICULAR FURNITURE AND ACCESSORIES 211 BARREN RV MTL HTH/MTL...MICHIGAN ARMY VEHICULAR BRAKE STEERING AXLE WHEEL COMP 702 PENN ARMY VEHICULAR BRAKE STEERING AXLE WHEEL COMP 32 CONTRACTOR TOTAL 734 RYAN CHRYSLER PLYMOUTH
"Matrix" sobitub iga filosoofiaga / Rando Tooming
Tooming, Rando
2003-01-01
Andy ja Larry Wachowski ulmefilmide triloogia "Matrix" fenomeni analüüsist ajakirja "Vikerkaar" 2003. aasta 9. numbris, kus sellele on pühendatud nelja filosoofi artiklid ( Slavoj Zhizhek, Jüri Eintalu, Bruno Mölder, Tanel Tammet)
Nazvan samõi vlijatelnõi tshelovek v iskusstve
2008-01-01
Ajakirja ArtReview ekspertide poolt 2008. aastal valitud 100 kunstimaailmas mõjukaima inimese nimekirja "The Power 100" juhib inglise skulptor Damien Hirst. Teisel kohal on ameerika galerist Larry Gagosian ja kolmandal kohal kunstimuuseumi MoMA direktor Kathy Halbreich
10. VI avati Tartus Sadamateatris...
2005-01-01
Näitus "The 2D Cowboys and a Man from No Man's Land". New Mexico kunstnikud Larry Bob Phillips, Mathew Williams (Mad Dog), Doug Morris (grupeering 2D Cowboys) ja Eesti juurtega Pat Kikut eksponeerivad maali, joonistusi ja kollaazhe
Sacha baron Cohen - julge mees / Timo Diener
Diener, Timo
2006-01-01
Eesti kinodesse on jõudnud briti koomiku Sacha Baron Coheni loodud peategelasega USA film "Borat - kultuurialased õppetunnid Ameerikast abiks suursuguse Kasahstani riigi ülesehitamisel" : režissöör Larry Charles. Filmi peaosalisest ja filmi seiklusrikkast võtteperioodist
Directory of Open Access Journals (Sweden)
Stafford Randall S
2006-09-01
Full Text Available Abstract Background Case management has emerged as a promising alternative approach to supplement traditional one-on-one sessions between patients and doctors for improving the quality of care in chronic diseases such as coronary heart disease (CHD. However, data are lacking in terms of its efficacy and cost-effectiveness when implemented in ethnic and low-income populations. Methods The Stanford and San Mateo Heart to Heart (HTH project is a randomized controlled clinical trial designed to rigorously evaluate the efficacy and cost-effectiveness of a multi-risk cardiovascular case management program in low-income, primarily ethnic minority patients served by a local county health care system in California. Randomization occurred at the patient level. The primary outcome measure is the absolute CHD risk over 10 years. Secondary outcome measures include adherence to guidelines on CHD prevention practice. We documented the study design, methodology, and baseline sociodemographic, clinical and lifestyle characteristics of 419 participants. Results We achieved equal distributions of the sociodemographic, biophysical and lifestyle characteristics between the two randomization groups. HTH participants had a mean age of 56 years, 63% were Latinos/Hispanics, 65% female, 61% less educated, and 62% were not employed. Twenty percent of participants reported having a prior cardiovascular event. 10-year CHD risk averaged 18% in men and 13% in women despite a modest low-density lipoprotein cholesterol level and a high on-treatment percentage at baseline. Sixty-three percent of participants were diagnosed with diabetes and an additional 22% had metabolic syndrome. In addition, many participants had depressed high-density lipoprotein (HDL cholesterol levels and elevated values of total cholesterol-to-HDL ratio, triglycerides, triglyceride-to-HDL ratio, and blood pressure. Furthermore, nearly 70% of participants were obese, 45% had a family history of CHD or
DVD-d. "Borat", "United 93", "Must Daalia", "Vimm 2" / Andres Laasik
Laasik, Andres, 1960-2016
2007-01-01
Uued mängufilmide DVD-d : Larry Charlesi "Borat" (peaosas Sacha Baron Cohen; USA 2006), Paul Greengrassi "United 93" (USA 2006), Brian De Palma "Must Daalia" ("The Black Dahlia", USA 2006), Takashi Shimizu "Vimm 2" ("The Grudge 2", USA 2006)
Natalie Portman plaanib veritasu / Timo Diener
Diener, Timo
2006-01-01
Natalie Portman ulmepõnevikus "V nagu veritasu" ("V for Vendetta") : režissöör James McTeigue : USA - Saksamaa 2005. Aluseks on Alan Moore'i samanimeline koomiks, mille vennad Larry ja Andy Wachowski stsenaariumiks töötlesid
Kaks meest abielluvad / Timo Diener
Diener, Timo
2007-01-01
Komöödiafilm "Kui Chuck abiellub Larryga" ("I Now Pronounce You Chuck and Larry") : režissöör Dennis Dugan : osades Adam Sandler, Kevin James, Jessica Biel : Ameerika Ühendriigid 2007. Lisatud nimekiri "Adam Sandleri menukamad filmid"
A Lean Approach to Scheduling Systems Engineering Resources
2013-05-01
Boeing), Suzette Johnson (Northrop Grumman), Larry Mac- cherone (Rally Development), Don Reinertsen (Reinertsen & Associates), David Rico (Boe- ing...Change for Your Technology Business. Sequim, WA: Blue Hole Press 9. Burrows , Mike. (2010). Kanban in a Nutshell. Blog post. <http
Military Interventions in Sierra Leone: Lessons from a Failed State
National Research Council Canada - National Science Library
Woods, Larry J; Reese, Timothy R
2008-01-01
This study by Larry J. Woods and Colonel Timothy R. Reese analyzes the massive turmoil afflicting the nation of Sierra Leone, 1993-2002, and the efforts by a variety of outside forces to bring lasting stability to that small country...
Cooperative interactions between paired domain and homeodomain.
Jun, S; Desplan, C
1996-09-01
The Pax proteins are a family of transcriptional regulators involved in many developmental processes in all higher eukaryotes. They are characterized by the presence of a paired domain (PD), a bipartite DNA binding domain composed of two helix-turn-helix (HTH) motifs,the PAI and RED domains. The PD is also often associated with a homeodomain (HD) which is itself able to form homo- and hetero-dimers on DNA. Many of these proteins therefore contain three HTH motifs each able to recognize DNA. However, all PDs recognize highly related DNA sequences, and most HDs also recognize almost identical sites. We show here that different Pax proteins use multiple combinations of their HTHs to recognize several types of target sites. For instance, the Drosophila Paired protein can bind, in vitro, exclusively through its PAI domain, or through a dimer of its HD, or through cooperative interaction between PAI domain and HD. However, prd function in vivo requires the synergistic action of both the PAI domain and the HD. Pax proteins with only a PD appear to require both PAI and RED domains, while a Pax-6 isoform and a new Pax protein, Lune, may rely on the RED domain and HD. We propose a model by which Pax proteins recognize different target genes in vivo through various combinations of their DNA binding domains, thus expanding their recognition repertoire.
Observing and Modelling the HighWater Level from Satellite Radar Altimetry During Tropical Cyclones
DEFF Research Database (Denmark)
Deng, Xiaoli; Gharineiat, Zahra; Andersen, Ole Baltazar
2016-01-01
This paper investigates the capability of observing tropical cyclones using satellite radar altimetry. Two representative cyclones Yasi (February 2011) and Larry (March 2006) in the northeast Australian coastal area are selected based also on available tide gauge sea level measurements. It is sho...
77 FR 71873 - Disciplinary Appeals Board Panel
2012-12-04
... review and comment. Employees, employee organizations, and other interested parties shall be provided... CONTACT: Larry Ables, Employee Relations and Performance Management Service (051), Office of Human.... Ables may be reached at (202) 461-6172. SUPPLEMENTARY INFORMATION: Public Law 102-40 requires that the...
Principles of Building Partnership Capacity
2010-06-11
COCOM and the green container that represents the COCOMs ability to influence the overall size of the engagement. United States BPC Efforts...1977. Japanese foreign policy 1869-1942: Kasumigaseki to Miyakezaka. Boston MA: Routledge and Kegan Paul Ltd. Nowes, Larry. 2006. Congressional
2012-03-01
..., Themis Trading LLC, dated October 17, 2011 (``Themis Letter''); Garret Cook, dated November 4, 2011 (``Cook Letter''); James Johannes, dated November 27, 2011 (``Johannes Letter''); Ken Voorhies, dated... (``UBS Letter''); Dr. Larry Paden, Bright Trading, dated December 1, 2011 (``Paden Letter''); Thomas...
Probability theory: the logic of science
National Research Council Canada - National Science Library
Jaynes, E. T; Bretthorst, G. Larry
2005-01-01
... by G. Larry Bretthorst Copyright Cambridge, New York, Melbourne, Madrid, Cape Town, Singapore, São Paulo Cambridge University Press...
2012-10-02
... FURTHER INFORMATION CONTACT: Larry Crist, Field Supervisor, U.S. Fish and Wildlife Service, Utah Field... burrows, dune migration characteristics that permit vegetation to develop and persist within dune swales... sediment characteristics not conducive for vegetation nor suitable for larval burrows, dune migration...
2016-07-01
possible, the site around the wash stations is graded to allow the wash water to run off to a pit, where it can seep into the earth or be collected...Caustic soda solution Radioisotopes /Nuclear Residuals Soap with warm water DS2 = Decontamination Solution 2 STB = Super Tropical bleach HTH = High... DATE (DD-MM-YYYY) 2. REPORT TYPE 3. DATES COVERED (From - To) 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER
OHD/HL - RFCDEV/HVT: 2nd charter
success criteria defined here no later than September 30, 2011. No travel beyond a RFC verification /HSD) Larry Lowe (ABRFC verification focal point) James Coe (APRFC verification focal point) Ashley Nielson (CBRFC verification focal point) Kevin Werner (CBRFC verification co-focal point and SCH
Genetic structure of Pseudococcus microcirculus (Hemiptera ...
Indian Academy of Sciences (India)
Department of Biology, Armstrong State University, Savannah, GA 31419, USA. Abstract ... [Zettler J. A., Adams K., Frederick B., Gutting A., Ingebretsen N., Ragsdale A. and Schrey A. 2017 Genetic structure of Pseudococcus ..... Park) and Larry Richardson (Florida Panther Wildlife Refuge) for ... University Press of Florida,.
CrossTalk: The Journal of Defense Software Engineering. Volume 24, Number 1, Jan/Feb 2011
2011-02-01
Aircraft Sustainment Group Tony Henderson 309th Software Maintenance Group Lt. Col. Brian Hermann, Ph.D. Defense Information Systems Agency Lt. Col...Solutions, Inc. Gordon Sleve Robbins Gioia LLC Larry Smith Software Technology Support Center Dr. John Sohl Weber State University Elizabeth Starrett OO-ALC
The National Shipbuilding Research Program: Solid Waste Segregation and Recycling
1998-03-01
decreasing landfill space, legislated recycling goals are being set, and your institution is expected to comply. The letter indicates that all...Larry Krull, (800) 837-3398, landfill covers, liners, and cap systems Canadian Forest Products, Ltd., New Westminister , BC, Joe Hargitt, (604) 520-9327
Stronger Consistency and Semantics for Low-Latency Geo-Replicated Storage
2013-06-01
Wallach, Mike Burrows , Tushar Chandra, Andrew Fikes, and Robert E. Gruber. Bigtable: A distributed storage system for structured data. ACM TOCS, 26(2...propagation for weakly consistent replication. In SOSP, October 1997. [60] Larry Peterson, Andy Bavier, and Sapan Bhatia. VICCI: A programmable cloud
2010-06-01
... concerning this finding to the above street address. FOR FURTHER INFORMATION CONTACT: Larry Crist, Field... actively work to maintain the grassland vegetation surrounding their burrows for visibility. White-tailed prairie dogs dig their own burrows. Burrow construction requires deep, well-drained soils. Preferred soils...
2013-10-02
... facsimile 801-975-3331. FOR FURTHER INFORMATION CONTACT: Larry Crist, Field Supervisor, Utah Ecological... vegetation, swale sediment characteristics appropriate for vegetation and larval burrows, dune migration... by the female within the burrows that tiger beetles typically dig during the hot part of the day and...
Trading Freshness for Performance in Distributed Systems
2014-12-01
C. Hsieh, Deborah A. Wallach, Mike Burrows , Tushar Chandra, Andrew Fikes, and Robert E. Gruber. BigTable: A distributed storage system for structured... Larry Brilliant. Detecting influenza epidemics using search engine query data. Nature, pages 1012–1014, February 2009. 3.2 Goetz Graefe. Write
77 FR 67671 - Larry Elbert Perry, M.D.; Decision and Order
2012-11-13
... June 7, 2012, the Government filed a Motion for Stay of Proceedings and Summary Disposition (``MSD... proceedings pending the results of this Government motion.'' MSD, at 5. A copy of a November 19, 2009...'s surrender of his state license to practice medicine, were both attached to the MSD. The Respondent...
2010-04-29
Technology: From the Office Larry Smith Software Technology Support Center to the Enterprise 517 SMXS/MXDEA 6022 Fir Avenue Hill AFB, UT 84056 801...2010 to 00-00-2010 4. TITLE AND SUBTITLE Accelerating Project and Process Improvement using Advanced Software Simulation Technology: From the Office to
Anatomy Journal of Africa - Vol 4, No 2 (2015)
African Journals Online (AJOL)
Variant Anatomy of Intracranial Part of Middle Meningeal Artery in a Kenyan Population · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Julius Ogeng'o, Beda Olabu, Mary I. Otiti, Beryl S. Ominde, Larry Mburu, Hemed Elbusaidy, 571-577 ...
A NOVEL S-ADENOSYL-L-METHIONINE: ARSENIC (III) METHYLTRANSFERASE FROM RAT LIVER CYTOSOL
A Novel S-Adenosyl-L-methionine: Arsenic(III) Methyltransferase from Rat Liver CytosolShan Lin, Qing Shi, F. Brent Nix, Miroslav Styblo, Melinda A. Beck, Karen M. Herbin-Davis, Larry L. Hall, Josef B. Simeonsson, and David J. Thomas S-adenosyl-L-methionine (AdoMet): ar...
The Social Organization of Schooling
Hedges, Larry V., Ed.; Schneider, Barbara, Ed.
2005-01-01
Schools are complex social settings where students, teachers, administrators, and parents interact to shape a child's educational experience. Any effort to improve educational outcomes for America's children requires a dynamic understanding of the environments in which children learn. In "The Social Organization of Schooling", editors Larry Hedges…
Artificial Intelligence in ADA: Pattern-Directed Processing. Final Report.
Reeker, Larry H.; And Others
To demonstrate to computer programmers that the programming language Ada provides superior facilities for use in artificial intelligence applications, the three papers included in this report investigate the capabilities that exist within Ada for "pattern-directed" programming. The first paper (Larry H. Reeker, Tulane University) is…
2012-12-01
31 Michael McDevitt, “Geographic Ruminations ,” in The Chinese Armed Forces in 21st Century, ed. Larry M. Wortzel, (Carlisle, Pennsylvania...Philippines and Vietnam remained as main contenders in the region. Admittedly, the U.S. strategic re-orientation toward Asia and its enhancing security
"To Kill A Mockingbird": Then and Now--A 35th Anniversary Celebration. Teacher Study Guide.
National Council of Teachers of English, Urbana, IL.
This study guide offers a different approach, teleconferencing, to new information, ideas, and resources on the film, "To Kill a Mockingbird." Following general information on "then and now," the guide consists of sections entitled: Preparing to Teach TKM: Special Considerations (by Charles Suhor and Larry Bell); Historical…
DEFF Research Database (Denmark)
Simonsen, Karen-Margrethe
2010-01-01
Artiklen handler om overvågning i to kunstværker, hhv. Hasan Elahis "Tracking Transience" og Surveillance Camera Players "1984". Den diskuterer overvågningens form, materialitet og det implicitte tema om individets retsstatus. Med udgangspunkt i Gilles Deleuze og juristen Larry Catá Backer...
2015-07-14
realize and my success in graduate school began with their mentorship. Erin Davis, Jessica Lu, Will Alexander, Steve Burrows , Alec Wagner, Yafen...description of the doser can be found in Larry Fiegland’s dissertation.68 The second doser is a variable sapphire-plate precision leak valve (Duniway
Strategic Improvements to TSA Spot Program
2015-03-01
supporting me in this program, and specifically, Assistant Administrators Robin Kane, John Sanders, and Chris McLaughlin for their sponsorship. I hope...analysis. Edited by Michael Borenstein, Larry V. Hedges, Julian P. T. Higgins , and Hannah R. Rothstein, 377–387. Chichester, UK: John Wiley & Sons, 2009
2010-05-10
... MERIT SYSTEMS PROTECTION BOARD The Merit Systems Protection Board (MSPB) is Providing Notice of the Opportunity to File Amicus Briefs in the Matter of Larry L. Evans v. Department of Veterans Affairs, MSPB Docket Number AT-3330-09-0953- I-1. AGENCY: Merit Systems Protection Board. ACTION: Notice...
2017-09-01
54 Larry Lewis, Operation Iraqi Freedom: Ground-to-Air Fratricide (U). CNA Research Memorandum CRM D0008910.A4, July 2004, //Secret. (Portion cited...Operation Iraqi Freedom: Ground-to-Air Fratricide (U). CNA Research Memorandum CRM D0008910.A4. Secret. (Portions cited in the present report are
Vilgub, välgub ja kihutab / Alar Niineväli
Niineväli, Alar
2008-01-01
Seiklusfilm "Speed Racer" : stsenaristid-režissöörid Andy ja Larry Wachowski : Ameerika Ühendriigid 2008. Teose aluseks on tatsuo Yoshida manga põhjal loodud 52-osaline animaseriaal "Mahha GoGoGo" (1967-1968). Lisatud: M.L. "Lihtsalt Wachowsid?" režissööride eraelust
Shuaib Lwasa Makerere University
International Development Research Centre (IDRC) Digital Library (Canada)
Shuaib Lwasa
2012-12-02
Dec 2, 2012 ... Examples; Sine Saloum mangroove restoration, coastal erosion control in Bangladesh (Pieter de Hoochweg, 2010, Larry Luxner. 2012). ▫. Influenced by anticipated and experienced hazards; sea level rise, storm surges, flooding e.t.c. ▫. The Policy context. ▫. Key Issues of Policy: Goals -> Rules / guidelines ...
Association for Education in Journalism and Mass Communication.
The Magazine and Visual Communication Divisions section of the Proceedings contains the following 8 papers: "Beefcake, Breadwinner, or Babysitter: A Content Analysis of Male Images in Female-Targeted Magazine Advertising, 1978-1998" (Mikalee Dahle and Jennifer Greer); "The Impact of Larry Flynt: An Overview of One Publisher's Legal…
2017-10-01
both in military combat and training conditions and in active civilian populations . The purpose of this expansion project is to use the novel...training experience including an NIH T32 and several K-award mentorships; and clinical co-mentor, Dr. Larry Marsh, a world class trauma surgeon and
A Model of the Spatio-temporal Dynamics of Drosophila Eye Disc Development.
Fried, Patrick; Sánchez-Aragón, Máximo; Aguilar-Hidalgo, Daniel; Lehtinen, Birgitta; Casares, Fernando; Iber, Dagmar
2016-09-01
Patterning and growth are linked during early development and have to be tightly controlled to result in a functional tissue or organ. During the development of the Drosophila eye, this linkage is particularly clear: the growth of the eye primordium mainly results from proliferating cells ahead of the morphogenetic furrow (MF), a moving signaling wave that sweeps across the tissue from the posterior to the anterior side, that induces proliferating cells anterior to it to differentiate and become cell cycle quiescent in its wake. Therefore, final eye disc size depends on the proliferation rate of undifferentiated cells and on the speed with which the MF sweeps across the eye disc. We developed a spatio-temporal model of the growing eye disc based on the regulatory interactions controlled by the signals Decapentaplegic (Dpp), Hedgehog (Hh) and the transcription factor Homothorax (Hth) and explored how the signaling patterns affect the movement of the MF and impact on eye disc growth. We used published and new quantitative data to parameterize the model. In particular, two crucial parameter values, the degradation rate of Hth and the diffusion coefficient of Hh, were measured. The model is able to reproduce the linear movement of the MF and the termination of growth of the primordium. We further show that the model can explain several mutant phenotypes, but fails to reproduce the previously observed scaling of the Dpp gradient in the anterior compartment.
A Model of the Spatio-temporal Dynamics of Drosophila Eye Disc Development.
Directory of Open Access Journals (Sweden)
Patrick Fried
2016-09-01
Full Text Available Patterning and growth are linked during early development and have to be tightly controlled to result in a functional tissue or organ. During the development of the Drosophila eye, this linkage is particularly clear: the growth of the eye primordium mainly results from proliferating cells ahead of the morphogenetic furrow (MF, a moving signaling wave that sweeps across the tissue from the posterior to the anterior side, that induces proliferating cells anterior to it to differentiate and become cell cycle quiescent in its wake. Therefore, final eye disc size depends on the proliferation rate of undifferentiated cells and on the speed with which the MF sweeps across the eye disc. We developed a spatio-temporal model of the growing eye disc based on the regulatory interactions controlled by the signals Decapentaplegic (Dpp, Hedgehog (Hh and the transcription factor Homothorax (Hth and explored how the signaling patterns affect the movement of the MF and impact on eye disc growth. We used published and new quantitative data to parameterize the model. In particular, two crucial parameter values, the degradation rate of Hth and the diffusion coefficient of Hh, were measured. The model is able to reproduce the linear movement of the MF and the termination of growth of the primordium. We further show that the model can explain several mutant phenotypes, but fails to reproduce the previously observed scaling of the Dpp gradient in the anterior compartment.
Harry Potter ja Scarlett käivad kohut / Ilona Martson
Martson, Ilona, 1970-
2001-01-01
Alice Randalli romaan "Tuul on läinud" - samad sündmused kui Margaret Mitchelli romaanis "Tuulest viidud", ainult neegerorjade vaatevinklist. Nancy Stofferi raamatud "Larry Potter ja tema parim sõber Lilly" ja "Legend Rah'ist ja Mugudest" ilmusid 1984. a. Joanne Kathleen Rowlingi "Harry Potter" lood aga valmisid hiljem
Massive public investment needed to grow green economy.
2009-01-01
The President of the Communications Workers of America, Larry Cohen, urges large-scale investments in research and technology in response to economic turmoil and climate change. He envisions one million made-in-America hybrid cars running on U.S. roadways by 2015 and use of alternative energy doubling within three years.
Interpretation Analysis as a Competitive Event.
Nading, Robert M.
Interpretation analysis is a new and interesting event on the forensics horizon which appears to be attracting an ever larger number of supporters. This event, developed by Larry Lambert of Ball State University in 1989, requires a student to perform all three disciplines of forensic competition (interpretation, public speaking, and limited…
Increased Awareness, Increased Appreciation
Nightingale, Barbra
2015-01-01
This article provides a student's viewpoint in response to Larry Andrews' article, "The Humanities Are Dead! Long Live the Humanities!," which addresses and solidifies the notion that, at least from the standpoint of academicians, the humanities are alive and well. The author believes that a broader base of learning, an increased…
Evaluating the Relationship Between Neuropsychological Function and Cognitive Performance
2012-08-01
Larry.Moore.ctr2@wpafb.af.mil) L3 Communications 5950 East Sossaman Road, Suite 102, Mesa, AZ 85212 USA Abstract The last 2 decades have...Viard, A., Schürhoff, F., Recasens, C., Martinot, M. L. P., Leboyer, M., & Martinot, J-L. (2003). Conscious and subliminal conflicts in normal
1985-10-01
median service time for a FIST IHQ to service Copperhead missions while in review mode and for mission workload (FO + ARMOR + CPH) was only 6.0...07703 Uazhin.tou, DC 20036 2 Coui-,ander 1 Comwanaer US Aruy larry Diaiaond Labs. US Army Belvoir ATTN: AIILHD- TD , Dr. Scully Research & Development
Congress of the U.S., Washington, DC. Senate Special Committee on Aging.
In this report of a congressional hearing, testimony includes statements and prepared statements of these four senators: John Breaux, Larry Craig, Debbie Stabenow, and Herbert Kohl. Panel I is presented by the Acting Assistant Attorney General, United States (U.S.) Department of Justice. Panel II consists of individuals representing the National…
Student Engagement: Key to Personalized Learning
Ferlazzo, Larry
2017-01-01
Personalized learning has the potential to greatly improve student achievement--but realistic teachers know that any instructional strategy will only be effective if students are willing to do the work. That is why Larry Ferlazzo emphasizes the importance of weaving intrinsic motivation into every personalized learning classroom. Four key elements…
Wat komt bovenaan de lijst bij Google?
Litvak, Nelly
2006-01-01
In 1998 presenteerden de PhD-studenten Sergey Brin en Larry Page uit Stanford het artikel ‘The anatomy of a Large-Scale Hypertextual Web Search Engine’ op het zevende World-Wide-Web-congres in Brisbane, Australië. Zij beschreven de Web-zoekmachine Google, waarvan de blanco bladzijde tegenwoordig zo
Congress of the U.S., Washington, DC. Senate Committee on Labor and Human Resources.
A Senate hearing reviewing health care services available for people with Alzheimer's disease and related dementia and reviewing proposals related to the treatment of Alzheimer's disease is presented in this document. Statements are given by Senators Charles E. Grassley, Albert Gore, Paula Hawkins, Howard M. Metzenbaum, Larry Pressler, and Paul…
Thinking Fast and Slow about Causality: Response to Palinkas
Marsh, Jeanne C.
2014-01-01
Larry Palinkas advances the developing science of social work by providing an explanation of how social science research methods, both qualitative and quantitative, can improve our capacity to draw casual inferences. Understanding causal relations and making causal inferences--with the promise of being able to predict and control outcomes--is…
Analysis of Servant-Leadership Characteristics: Case Study of a For-Profit Career School President
Hiatt, Elaine M.
2010-01-01
Servant leadership is a challenging leadership philosophy to study empirically. The purpose of this qualitative descriptive case study was to determine if an effective leader of a for-profit career school displays the 10 servant-leader characteristics, identified by Larry R. Spears (1995) in "Reflections on Leadership," according to respondents,…
2012-03-14
only two snake species on the Guam, the other of which is a burrowing blind snake Ramphotyphlops braminus (possibly introduced as well), and none of...descriptions of three new species. Systematic Parasitology 1:127-140. Roberts, L. S. and J. J. Janovy. 2005. Gerald D. Schmidt and Larry S. Roberts
Structure, Function and Diversity of the Healthy Human Microbiome
2012-06-14
Durbin, R. Fast and accurate long-read alignment with Burrows –Wheeler transform. Bioinformatics 26, 589–595 (2010). 26. Giannoukos, G. et al...Feldgarden2, Victor M. Felix7, Sheila Fisher2, Anthony A. Fodor41, Larry J. Forney42, Leslie Foster6, Valentina Di Francesco19, Jonathan Friedman43
Resource-Efficient Data-Intensive System Designs for High Performance and Capacity
2015-09-01
76, 79, 80, and 81.] [9] Anirudh Badam, KyoungSoo Park, Vivek S. Pai, and Larry L. Peterson. HashCache: cache storage for the next billion. In Proc...Jeffrey Dean, Sanjay Ghemawat, Wilson C. Hsieh, Deborah A. Wallach, Mike Burrows , Tushar Chandra, Andrew Fikes, and Robert E. Gruber. Bigtable: A
Tide Gauge and Satellite Altimetry Integration for Storm Surge Prediction
DEFF Research Database (Denmark)
Andersen, Ole Baltazar; Cheng, Yongcun; Deng, X.
2013-01-01
of the Northeast Australia, we have investigated several large cyclones causing much destruction when they hit the coast. One of these being the Cyclone Larry, which hit the Queensland coast in March 2006 and caused both losses of lives as well as huge devastation. Here we demonstrate the importance of integrating...
77 FR 26777 - Endangered Species; Marine Mammals; Issuance of Permits
2012-05-07
... not operate to the disadvantage of the endangered species, and (3) The granted permit would be..., 2012. 64654A Double Springs 77 FR 6816; March 14, 2012. Partnership Ltd. February 9, 2012. 64656A Double Springs 77 FR 6816; March 14, 2012. Partnership Ltd. February 9, 2012. 64723A Larry Friesenhahn...
Making History: SACES Presidential Leadership 1949-1998.
Sheeley, Vernon Lee
This booklet provides educational, professional, and biographical information on 48 presidents of the Southern Association for Counselor Education and Supervision. A photo of each president is included. All leaders from 1949-1998 are covered. The presidents are: Donna Henderson, Debra Cobia, Pamela Paisley, Larry C. Loesch, Charlotte M. Taylor,…
Literature: Developing Critical Awareness; Some Classroom-Tested Approaches.
Matthews, Dorothy, Ed.
1977-01-01
This issue of the "Illinois English Bulletin" is devoted to developing critical awareness, through poetry, values, the elements of fiction, and literary study. The first section considers approaching narrative through the use of popular materials and includes two essays: "Grim Tales in the English Classroom" by Larry Danielson and "From the Comics…
78 FR 52602 - Qualification of Drivers; Exemption Applications; Vision
2013-08-23
... showing requirement red, green, and amber (49 CFR 391.41(b)(10)). FMCSA recognizes that some drivers do.... Thane (OH), Larry A. Tidwell (MO), Dale Torkelson (WI), Norman Vanderzyl (IA), John Vanek (MO), James D. Vorderbruggen (MN), Desmond Waldor (PA), Alicia Waters (IL), Norman R. Wilson (WA), James G. Witt (AZ), James L...
African Journals Online (AJOL)
Items 1 - 48 of 48 ... Vol 2 (2003), Electrical Properties of Antimony (Sb) Metal Contacts to Silicon (Si) Thin Films, Abstract PDF. S. S. Oluyamo. Vol 4 (2005), Fading of radio signals from spaced synchronous satellites: dependence on source coordinates, Abstract PDF. Larry LN Amaeshi. Vol 3 (2004), Finite Element Modelling ...
Lum, Lydia
2009-01-01
Every time Dr. Larry Shinagawa teaches his "Introduction to Asian American Studies" course at the University of Maryland (UMD), College Park, he finds that 10 to 20 percent of his students are adoptees. Among other things, they hunger to better comprehend the social and political circumstances overseas leading to their adoption. In…
Manned Airborne Intelligence, Surveillance, and Reconnaissance: Strategic, Tactical . . . Both?
2012-12-01
Program, 1996), 97, http://www.dtic.mil /cgi-bin/GetTRDoc?AD=ADA442835&Location=U2&doc=GetTRDoc.pdf. 17. Quoted in William E. Burrows , By Any Means...41. Larry Tart and Robert Keefe, The Price of Vigilance: Attacks on American Surveillance Flights (New York: Ballantine Books, 2001), 196. 42. Ibid
2011-06-21
..., comments, or questions concerning this finding to the above address. FOR FURTHER INFORMATION CONTACT: Larry...-920, 923). The young emerge from their nursery burrow by early to mid-June and primarily forage on...; Turner 1979, p. 51; McDonald 1993, p. 9). Well-drained soils are necessary for Utah prairie dogs' burrows...
Rohrer, Daniel Morgan
This review of current legal practices with respect to censorship in the areas of obscenity and pornography contains a history of anti-obscenity legislation; a review of the efforts of the United States Supreme Court and lower courts to define obscenity; a discussion of publisher Larry Flynt's battle against the "community standards"…
Lubovisk, Git, Ed.
This catalog lists some 14,600 books, magazines, photos and other material related to the film industry that are available from Larry Edmunds Bookshop Inc., Hollywood, Calif. The 488-page catalog is divided into eight sections. The first and largest section is labelled "Literature of the Cinema" and lists books in categories from aesthetics and…
Embracing E-Books: Increasing Students' Motivation to Read and Write
Siegle, Del
2012-01-01
In his keynote address at the "New York Times" Schools for Tomorrow 2011 Fall Conference, Dr. Larry Summers (2011) suggested that technology implementations have an unusual growth pattern. New technology innovations usually require more time to "catch on" than one might expect, but once they catch on, their use spreads more quickly than anyone can…
Lawrence G. Raisz November 13, 1925-August 25, 2010
Bilezikian, J.P.; Drezner, M.; Kream, B.; Stern, P.; Clemens, T.; Elderkin, A.; Siris, E.; Krane, S.; Eisman, J.; Arnold, A.; Feyen, J.; Hurley, M.; Kawaguchi, H.; Lorenzo, J.; Peck, W.; Pilbeam, C.; Rowe, D.; Martin, T.J.; Hock, J.; DeLuca, H.; Rodan, S.; Lukert, B.; Chen, T.; Klein-Nulend, J.
2011-01-01
No one person in the world of bone has had a greater impact than Larry on us all. To honor his memory, we asked some of Larry’s closest friends and colleagues to reflect upon his extraordinary life. What follows is an expression of that meaning sprinkled with Larry’s inimitable wit and reflections
Dr. Mary McLeod Bethune: A Life Devoted to Service
Long, Kim Cliett
2011-01-01
The purpose of this paper is to explore and analyze the leadership traits of Dr. Mary McLeod Bethune, an African-American woman of history, using the servant leadership theory developed by Robert K. Greenberg and the ten characteristics of servant leadership as conceived by Larry C. Spears. This exploration seeks to identify the significant…
Comments: Improving Weighting Methods for Causal Mediation Analysis
Imai, Kosuke
2012-01-01
The author begins this discussion by thanking Larry Hedges, the editor of the journal, for giving him an opportunity to provide a commentary on this stimulating article. He also would like to congratulate the authors of the article for their insightful discussion on causal mediation analysis, which is one of the most important and challenging…
The Harmon Memorial Lectures in Military History 1959-1987
1988-01-01
Farrand, ed., Records of the Federal Convention of 1787 (New Haven, 1911-1937), 111, 85, 86n. 4. Pogue, Marshall, 1, 323; Larry 1. Bland and Sharon R...569, iU2, 573 Boulogne camp: 316, 317 594 INDEX Bourke , John G.: 26 Chamberlain, Neville: 572 Bradley, Omar N.: 163, 166, 167, 185, 190, Charles
Campbell, Sharon
2004-01-01
This brief article describes one third-grade classroom's experience engaging in a lesson plan inspired by Larry Yanez's "Cocina Jaiteca" and images of the cheerful kitchen. In the lesson, the students were to draw their own kitchens based on their observations of the many details in Yanez's kitchen example, such as the calendar on the wall,…
A Modified Approach to Team-Based Learning in Linear Algebra Courses
Nanes, Kalman M.
2014-01-01
This paper documents the author's adaptation of team-based learning (TBL), an active learning pedagogy developed by Larry Michaelsen and others, in the linear algebra classroom. The paper discusses the standard components of TBL and the necessary changes to those components for the needs of the course in question. There is also an empirically…
Teaching History Then and Now: A Story of Stability and Change in Schools
Cuban, Larry
2016-01-01
In "Teaching History Then and Now," Larry Cuban explores the teaching of history in American high schools during the past half-century. Drawing on his early career experience as a high school history educator and his more recent work as a historian of US education policy and practice, Cuban examines how determined reformers have and have…
Steiner, David
2009-01-01
This article is an autobiographical account of a remarkable childhood. In this essay, David Steiner, the Klara & Larry Silverstein Dean of the School of Education at Hunter College in New York, chronicles his early years and his road to Oxford. David is the son of George Steiner, the polymath who has scathingly denounced Western societies for the…
Reliability of Multiple Component Systems
1975-07-15
George Washington University Bethesda, Maryland .20014 Dr. Larry Cornwell Western Illinois University Macomb, Illinois 61455 Dr. Lester A...Jersey 07801 Robert M. Eissner USA Materiel Sys Anal Agency Aberdeen Proving Ground, Md. 21005 Bernard Engebos USA Electronics Command White...Philadelphia, Pennsylvania 19137 587 J Attendee»-- 19lh Design of Experiments Conference (continued) Captain Bernard J. Lawless Hqs
78 FR 78477 - Qualification of Drivers; Exemption Applications; Vision
2013-12-26
...) James T. Sullivan (KY) David C. Sybesma (ID) Robert N. Taylor (OR) Scott A. Taylor (WV) Temesgn H. Teklezig (WA) Matthew K. Tucker (MN) Victor H. Vera (TX) Stephen D. Vice (KY) Larry J. Waldner (SD) Karl A...) Jerry L. Schroder (IL) Gerald J. Shamla (MN) Stephen E. Shields (KY) Peter M. Shirk (PA) William C...
Summary of Research Activities, Academic Departments, 1979-1980.
1980-10-01
c 1935," USNA Class of 1935 Reunion, Annapolis, Maryl;nd, 10 May 1980. TI)-PSON, Larry V. , Professor, " Eichmann in Jerusalem : A Reconsideration...Conference on Ied i cal Ph’s i cs andI XIT TInternational Conference on ’W icai and Pioloiical E~noineeri nq , Jerusalem , 20 Auqost 1979. 100 r Wwu( !I t~ I
Automatic Configuration of Programmable Logic Controller Emulators
2015-03-01
download.php?articleid= sec v6 n12 2013 3 . [FGM+99] Roy Fielding, Jim Gettys, Jeffrey Mogul, Henrik Frystyk, Larry Masin- ter, Paul Leach, and Tim...2011 ACM SIGCOMM Conference on, IMC ’11, pages 397–412, New York, NY, USA, 2011. ACM. [LBZH13] Patrick LaRoche, Aimee Burrows , and A. Nur Zincir
David, Jane L.; Cuban, Larry
2010-01-01
"Cutting Through the Hype: The Essential Guide to School Reform" is a revised, expanded, and updated version of the classic work by Jane L. David and Larry Cuban. It offers balanced analyses of 23 currently popular school reform strategies, from teacher performance pay and putting mayors in charge to turnaround schools and data-driven instruction.…
Liu, Xi; Dai, Fangyin; Guo, Enen; Li, Kang; Ma, Li; Tian, Ling; Cao, Yang; Zhang, Guozheng; Palli, Subba R; Li, Sheng
2015-11-06
As revealed in a previous microarray study to identify genes regulated by 20-hydroxyecdysone (20E) and juvenile hormone (JH) in the silkworm, Bombyx mori, E93 expression in the fat body was markedly low prior to the wandering stage but abundant during larval-pupal metamorphosis. Induced by 20E and suppressed by JH, E93 expression follows this developmental profile in multiple silkworm alleles. The reduction of E93 expression by RNAi disrupted 20E signaling and the 20E-induced autophagy, caspase activity, and cell dissociation in the fat body. Reducing E93 expression also decreased the expression of the 20E-induced pupal-specific cuticle protein genes and prevented growth and differentiation of the wing discs. Importantly, the two HTH domains in E93 are critical for inducing the expression of a subset of 20E response genes, including EcR, USP, E74, Br-C, and Atg1. By contrast, the LLQHLL and PLDLSAK motifs in E93 inhibit its transcriptional activity. E93 binds to the EcR-USP complex via a physical association with USP through its LLQHLL motif; and this association is enhanced by 20E-induced EcR-USP interaction, which attenuates the transcriptional activity of E93. E93 acts through the two HTH domains to bind to GAGA-containing motifs present in the Atg1 promoter region for inducing gene expression. In conclusion, E93 transcriptionally modulates 20E signaling to promote Bombyx larval-pupal metamorphosis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Liu, Xi; Dai, Fangyin; Guo, Enen; Li, Kang; Ma, Li; Tian, Ling; Cao, Yang; Zhang, Guozheng; Palli, Subba R.; Li, Sheng
2015-01-01
As revealed in a previous microarray study to identify genes regulated by 20-hydroxyecdysone (20E) and juvenile hormone (JH) in the silkworm, Bombyx mori, E93 expression in the fat body was markedly low prior to the wandering stage but abundant during larval-pupal metamorphosis. Induced by 20E and suppressed by JH, E93 expression follows this developmental profile in multiple silkworm alleles. The reduction of E93 expression by RNAi disrupted 20E signaling and the 20E-induced autophagy, caspase activity, and cell dissociation in the fat body. Reducing E93 expression also decreased the expression of the 20E-induced pupal-specific cuticle protein genes and prevented growth and differentiation of the wing discs. Importantly, the two HTH domains in E93 are critical for inducing the expression of a subset of 20E response genes, including EcR, USP, E74, Br-C, and Atg1. By contrast, the LLQHLL and PLDLSAK motifs in E93 inhibit its transcriptional activity. E93 binds to the EcR-USP complex via a physical association with USP through its LLQHLL motif; and this association is enhanced by 20E-induced EcR-USP interaction, which attenuates the transcriptional activity of E93. E93 acts through the two HTH domains to bind to GAGA-containing motifs present in the Atg1 promoter region for inducing gene expression. In conclusion, E93 transcriptionally modulates 20E signaling to promote Bombyx larval-pupal metamorphosis. PMID:26378227
Johnson, Larry
2013-01-01
Larry Johnson, Presidente del New Media Consortium y fundador del proyecto “Horizon”, presentó, en el marco del V Encuentro Nacional de Rectores, la ponencia “The Network is Us”. Una exposición en donde se explica la importancia de implementar las nuevas tecnologías en el desarrollo académico de los colegios y las universidades.
Demonstration of Thermally Sprayed Metal and Polymer Coatings for Steel Structures at Fort Bragg, NC
2017-09-01
ER D C/ CE RL T R- 17 -3 0 DoD Corrosion Prevention and Control Program Demonstration of Thermally Sprayed Metal and Polymer Coatings...and Polymer Coatings for Steel Structures at Fort Bragg, NC Final Report on Project F07-AR10 Larry D. Stephenson, Alfred D. Beitelman, Richard G...5 2.1.2 Thermoplastic polymer coating (flame spray
2002-04-19
Ville• franche , 15"-!9V’ April 2002 Stratified shear flow in sea straits of arbitrarY cross section Larry Pratt, Chris Jones*, Jian Deng* and Lou Howard...shown. W is the the interface Red food colouring is used as dye in the dense minimum channel width, accounting and P=-0.5*f is the ro- fluid, back-lit
Agile-Lean Software Engineering (ALSE) Evaluating Kanban in Systems Engineering
2013-03-06
David Anderson (David J. Anderson and Associates) Jabe Bloom (The Library Corporation) Mike Burrows (David J. Anderson and Associates) Ian...Dominic Lepore (Stevens Institute, Howe School) Larry Maccherone (Rally Software) Don Reinertsen (Reinertsen & Associates) David Rico...ongoing, continuous integration also approximate the effect of small batch sizes. For a different approach to describing kanban, see Mike Burrows
2012-03-01
stipulated in the permit. Potential indigo snake refugia: gopher tortoise burrows , active or inactive, other holes, ground cavities, and root hollows...holes, cavities, and snake refugia other than gopher tortoise burrows will be inspected each morning before planned site manipulation of a particular...University 1999 Years Experience: 12 Larry McLain Operational Transportation Manager and Range Maintenance Manager Clarence Morgan Rangeland
Unitary symmetry, combinatorics, and special functions
Energy Technology Data Exchange (ETDEWEB)
Louck, J.D.
1996-12-31
From 1967 to 1994, Larry Biedenham and I collaborated on 35 papers on various aspects of the general unitary group, especially its unitary irreducible representations and Wigner-Clebsch-Gordan coefficients. In our studies to unveil comprehensible structures in this subject, we discovered several nice results in special functions and combinatorics. The more important of these will be presented and their present status reviewed.
Google@miljardiklubi.com / Neeme Raud
Raud, Neeme, 1969-
2004-01-01
Google'i otsingumootori loojad, ettevõtte omanikud Larry Page ja Sergei Brin kavandavad erinevat kaalu omavate aktsiate müüki, mille puhul ettevõtte juhid soovivad säilitada kontrolli firma tuleviku üle ja jätta endale 2/3 aktsiatest. Wall Street'i analüütikute arvamusi. Diagramm: Google'i puhaskasum, mln dlr. Vt. samas: Halb stsenaarium: +11 miljardit, hea +30 miljardit dollarit
Expanding the Role of Emergency Medical Services in Homeland Security
2013-03-01
this technology has the potential to provide a psychological advantage to be ahead of the event and to provide life saving and public calming...Brown, Larry E. Beutler, James N. Breckenridge, and Philip G. Zimbardo. Psychology of Terrorism. New York: Oxford University Press, 2007. Brown...Physicians and the National Association of State EMS Directors, 2011. Chapman, Wendy W., John N. Dowling, Atar Baer, David L. Buckeridge, Dennis
Damien Hirsti tige kala asus otsustavalt kunstiturgu ründama / J. S
J. S
2004-01-01
Briti kunstigalerist ja -kollektsionäär Charles Saatchi müüb Damien Hirsti installatsiooni "Surma füüsiline võimatus kellegi elava mõttes" Ameerika galeristile Larry Gagosianile 6,25 miljoni Inglise naela eest. Tegu on hiigelakvaariumis formaldehüüdis hulpiva tiigerhaiga, mis galeriisse tooduna pani aluse Hirsti karjäärile ja sai lipulaevaks Young British Artists (YBA) kunstilainele
Ettevõtted jäävad eesmärkide elluviimisega hätta / Silva Laius, Ilmar Raudsep
Laius, Silva
2004-01-01
Juhtimises on olulisimaks teemaks tõusnud ettevõtte eesmärkide elluviimine. McKinsey ja FranklinCovey uuringust, mille eesmärk oli vastata küsimusele, mida teha, et olla nende hulgas, kes saavutavad eesmärke ja loovad väärtust. Larry Bossidy ja Ram Charani raamatust "Execution". Vt. samas: xQ protsess aitab täideviimise võimet tõsta. Tabel, diagramm
A Survey of Productivity in the Construction Industry: Measurement and Causes.
1987-12-01
contingent u.pon1 the. epr r- rmanc c;-of d esir -a bl job beL-h avi or-s. T hc e esira b le botc:IDr a-f tn set--by goal sett i ng, ?1BO type programs, a...and how current collection methods etfect the -A. outcome of the proceedings. • 148 6?.. BIBLIOGRAPHY (Adams, 1935 ) Adams, Larry T., "Changing
Storybook app creation demystified a cast study
Friedlander, Amy
2013-01-01
This case study explains how Wasabi Productions created its first app, Lazy Larry Lizard, and provides insight into the development of soon-to-be-released app, Gorilla Band. Inside, you will find notes on how storybook apps are produced from start to finish, including costs, production process, people, technology, pricing, release cycle, marketing and more. You will also find insights on technology, storyboard development and pricing.
Lee, Jaimy
2012-10-08
More than 150 hospitals have signed on to the Partnership for a Healthier America's push to ditch the deep-fat fryer in their cafeterias and bulk up on fruit and veggies. "Our focus is to ensure that if people want to make a healthy choice, they can," says Larry Soler, left, president and CEO of the partnership, which is working to reduce childhood obesity.
1998-05-01
REPRESENTATIVES American Academy of Family Physicians Richard Zimmerman, M.D. Pittsburgh, Pennsylvania American Academy of Pediatrics Larry Pickering, M.D... anticonvulsant medication while taking 20 MMWR May 1,1998 rimantadine. The extent to which rimantadine might increase the incidence of seizures among...1987;257: 2047-50. Jackson CR, Vavro CL, Penningron KN, et al. Effect of influenza immunization on immunologic and Virologie parameters in HIV+ pediatric
Tibial Bowing and Pseudarthrosis in Neurofibromatosis Type 1
2015-01-01
exposed to the vector. Larry Sherman (Oregon Health and Science University) dis- cussed the underlyingmechanisms of pain in schwannomatosis.He...Sequence reads were mapped using the Burrow -Wheeler aligner (9) and final alignments generated after multiple quality controls steps applied using...Li H, Durbin R. Fast and accurate short read alignment with Burrows -Wheeler transform. Bioinformatics 2009;25(14):1754-60. 10. McKenna A, Hanna M
2016-06-10
Armstrong, 135. 132 William E. Burrows , By Any Means Necessary: America’s Secret Air War in the Cold War (New York: Farrar, Straus, and Giroux, 2001...216 Captain Larry Seaquist, USN (Ret.) interview by Thomas P. Ehrhard, 25 May 1999, quoted in Ehrhard, 359. 217 Lehman, 339...D. Unmanned Aerial Systems: A Historical Perspective. Ft. Leavenworth, KS: Combat Studies Institute Press, September 2010. Burrows , William E. By
1987-09-01
compute quenc in ates arising rbo pin-orbit interactions. The ability to include the effect of spin-spin interactions is being incorporated in our program ...PROCUREMENT INSTRUMENT IDENTIFICATION NUMBER ORGANIZATION j(if applicable) Be. ADDRESS (City. State and ZIP Code) 10. SOURCE OF FUNDING NOS. PROGRAM ... overviev Maj Larry Davis (AF Office of Scientific Research), Lt Walt Lauderdale (AF Astronautics Laboratory) . . _Ieasurement of Charge Transfer
Family Separation and Reunion, A Style of Life in the Military
1981-09-15
BOSS, P.G., WILSON, L.R., & LESTER, G.R. Developing family invulnera- bility to stress: coping patterns and strategies wives employ in managing family ...Jefferson Davis Highway University of Maryland Arlington VA 22202 College o’ Business and Management and Department of Psychology Dr. Larry Cummings...Smithsonian Institution 801 N. Pitt Street, Suite 120 Alexandria VA 22314 Dr. Richard Steers Graduate School of Management and Business University of Oregon
Military Retention and Retirement. Reciprocal Family/Organization Effects,
1981-06-30
the Chief of Naval Operations, 1978. Derr, C.B. Managing marriage/ family issues across career stages: the case of the U.S. Naval officers. Unpublished...Jeffers-, Davis Highway University of Maryland Arlingtcn VA , #02 College of Business and Management and Department of Psychology Dr. Larry Cummings...Institution 801 N. Pitt Street, Suite 120 Alexandria VA 22314 Dr. Richard Steers Graduate School of Management and Business University of Oregon Eugene
21st Century Small Unit Leaders: Developing the Ultimate Smart Power Weapon
2011-06-17
thinking skills and problem solving ability in general. Task driven thinking can often be learned by rote, like mastering the steps of a recipe ...technology allowing for the identification and location of all trainees and role players. Pan -tilt-zoom cameras were installed to automatically record...DC: U.S. Marine Corps, 20 June 1997. Useem, Michael, James Cook , and Larry Sutton, “Developing Leaders for Decision Making Under Stress: Wildland
Project Air Force Annual Report 2007
2007-01-01
China has developed options that would make it a formidable adversary, particularly in a conflict over Taiwan , which the United States remains...he focused on China’s relationship with Taiwan . Since then, he has worked with other RAND analysts, such as David Orletsky, Evan Medeiros, Keith Crane...Hamilton, engineers Jeff Hagen and David Vaughan, Air Force Fellow Michelle Grace, behavioral scientist Larry Hanser, and information scientist Herb Shukiar
2010 Homeland Security Symposium and Exhibition Held in Arlington, Virginia on September 28-29, 2010
2010-09-29
Embassy Bombing in Nairobi, Kenya; The Pentagon response; Earthquakes twice in Turkey, Taiwan , and Iran; Hurricane responses such as Katrina and...Davis Hazmed, Inc. Mr. Patrick Dawson Layer 7 Technologies Mr. Jay DeCianno General Dynamics Mr. Herb Dempsey ARCADIS Mr. Larry DeRoche Vectronix...Consequences of "Mother Nature” September 28, 2010 Chris Royse Parsons History of Disaster Response 2 1949 Post-World War II Reconstruction Taiwan 1957
The Hammer and the Anvil: The Need for A Comprehensive Southwest Border Security Strategy
2010-06-02
ublic figures voiced concern about the “war on drugs,” the right level and kind of immigration, problems along the southwest border, migration , crises...thesis, Naval Postgraduate School, 2006), 1. 27 K. Larry Stores, Mexico-U.S. Dialogue on Migration and Border Issues 2001-2005, (Washington, DC...13 Seven organized crime families operate the drug trade in and from Mexico. The Sinaloa Federation is a cocaine smuggling organization headed by
Modeling Climate-Change Effects on Snake Range Extents for Military Land Management
2013-09-01
Kirankumar Topudurti and the Director was Dr. Ilker Adiguzel. Special appreciation is owed to Fort Stewart, GA personnel John Macey, Larry Carlile, and...fatalities by intentional killing and motor-vehicle encounters, and loss of tortoise burrows (used as winter shelter) through both dwindling tortoise...numbers and gassing of burrows by rattlesnake hunters (US Fish and Wildlife Service 1982, Stevenson et al. 2003). Since it has a very large home
Final Environmental Assessment for Land Exchange at Dyess Air Force Base, Taylor County, Texas
2011-10-01
Analysis (Past) Mr. Larry McMillon, Tanks Program Manager, Toxics Program Manager Mr. Gary Burling, Waste Program Manager Mr. Jim Armstrong, Air...locally common in coastal grasslands, uncommon to rare further west; sensitive to patch size and avoids edges. Western Burrowing Owl Athene cunicularia...plains, and savanna, sometimes in open areas such as vacant lots near human habitation or airports; nests and roosts in abandoned burrows Western Snowy
2017-02-10
Anthony Thurman, Larry Hsu, Lesley Doyle, and Patty Masino of Code 106; and Robert Miller, John Bartlett, and other members of the Dive Team; Puget...biological activity ( burrows , voids, or actual animals) were viewed in the images and the maximum biological mixing depth was determined (Germano and...underlying sediment by the burrowing activities of resident infauna and other mixing processes (Germano and Associates 2014a). Visual evidence of
2012-03-01
document should be directed to Mr. Larry Chavers. Public comments should be directed to Mr. Mike Spaits. Mr. Chavers and Mr. Spaits can be reached...Section. • Should a gopher tortoise burrow be identified within the proposed path of construction by construction personnel, work will cease until...Natural Resources personnel have investigated the burrow and relocated any gopher tortoise or commensals to a suitable location. 3 • Gopher tortoise and
Training Dismounted Soldiers in Virtual Environments: Task and Research Requirements
1994-10-01
u Z’ ELon ~9 inrp of sli puhns on ~ veh- r Read_ _ _k IsIO a Usi No vike 5 4 talk juw arnimuthe &-A dziExzziizz to J lntoj idntf asal is ~ o -a~o...13 ~ Larry prwadilve musk 19 11 1’ositioraigh~ht wispon. 16 I1i- Move Imptht vapidly. tactially 1 18 9L1 COOAOmfaloemsadthus qaad 12 9 I I i1h,MW
International Nuclear Information System (INIS)
Watve, Apurva; Gupta, Mamta; Trivedi, Richa; Khushu, Subash; Rana, Poonam
2016-01-01
Moderate dose of radiation exposure occurs during radiation accidents or radiation therapy induces pathophysiological alterations in CNS that may persist for longer duration. Studies suggest that late delayed injury is irreversible leading to metabolic and cognitive impairment. Our earlier studies have illustrated the varied response of brain at acute and early delayed phase on exposure to cranial and whole body radiation. Hence in continuation with our previous studies, present study focuses on comparative microstructural changes in brain at late delayed phase of radiation injury using Diffusion Tensor Imaging (DTI) technique. Region of interest (ROIs) were drawn on corpus callosum (CC), hippocampus (HIP), sensory-motor cortex (SMC), thalamus (TH), hypothalamus (HTH), cingulum (CG), caudeto-putamen (CUP) and cerebral peduncle (CP). The differences in FA (Fractional Anisotropy) and MD (Mean Diffusivity) values generated from these regions of all the groups were evaluated by ANOVA with multiple comparisons using Bonferroni, Post Hoc test. Maximum changes have been observed in MD values mainly in cranial group showing significantly increased MD in CC and SMC region while both the groups showed changes in TH and CUP region as compared to control. FA showed more prominent changes in whole body radiation group than cranial group by decreasing significantly in CP region while in HTH and CUP region in both the groups. Reduced FA indicates compromised structural integrity due to the loss of glial progenitor cells causing transient demyelination while increased MD has been equated with cellular membrane disruption, cell death and vasogenic edema. Thus, present study reveals late delayed CNS response after cranial and whole body radiation exposure. These findings can help us differentiate and monitor the pathophysiological changes at later stages either due to accidental or intentional exposure to ionizing radiation
Directory of Open Access Journals (Sweden)
Adriana Costa
2011-06-01
Full Text Available Estudo sobre a assimilação do jazz na cultura popular francesa dos anos de 1930 e criação de uma sociedade de entusiastas desse estilo, especialmente em torno do Le Quintette du Hot Club de France. A transcrição e análise de Tiger Rag, música dos membros da Original Dixieland Jazz Band (Nick La Rocca, Eddie Edwards, Tony Sbarbaro, Larry Shields e Harry da Costa na interpretação do Le Quintette (LE QUINTETTE DU HOT CLUB DE FRANCE, 1934, remasterizado em 1993 revela suas práticas de performance, especialmente de seus solistas: Django Reinhardt, no violão, e Stephane Grappelli, no violino.Study about the assimilation of jazz into French popular culture of the 1930s and the emergence of a society of jazz enthusiasts, especially around Le Quintette du Hot Club de France. The transcription and analysis of Tiger Rag, composed by the members of the Original Dixieland Jazz Band (Nick La Rocca, Eddie Edwards, Tony Sbarbaro, Larry Shields and Harry da Costa and performed by Le Quintette reveal performance practices of its main soloists: Django Reinhardt on the guitar and Stephane Grappelli on the violin.
1981-12-01
DTIC _JUN ,I 51982 UNITED STATES AIR FORCE AIR UNIVERSITY E AIR FORCE INSTITUTE OF TECHNOLOGY Wright-Patterson Air-force Base,Ohio S 2 B 14 Best...t’re Air F:or- e -ns"it’.,, e of Technclogy Air Uv-ýerz.tyj in Partial ulfilIThent Reýquirements fol- ,-hth D,ýýr.e c4" MastLer of’ OperaZ-ins...iesearc- VeTA 3 MohamedO ’’’’Jo SpD’ Fas.abal-la Lt. C ol. Egyplt.’.an Army Gradua~’p ( ler ons Research December 1981 Approcved fL~r pu>ý’ rclea.se
Functional Design of Breakwaters for Shore Protection: Empirical Methods
1990-09-01
prepred by the Principal Investigator of the work unit, Ms. Julie Dean Rosati, Hy1. aulic Engineer, EAU, CSEB. COL Larry B. Fulton, EN, was Commander and...transmissibility, wave climate , etc.), morphologica. beach response may be either a salient or tombolo. Reef breakwaters are a type of detached breakwaters... climate chosen for design (USAED, Buffalo 1975; Pope and Dean 1986), as waves from the northwest were inappropriately weighted. Pope and Dean (1986) 26
Struggling to Target: Airpower’s Historical Challenge Continues
2002-04-01
targeting. Notes 1 Larry A. Weaver and Robert D. Pollock, “Campaign Planning for the 21st Century,” in Airpower Studies Coursebook , ed. Lt...Around,” in Airpower Studies Coursebook , ed. Lt Colonel Anthony C. Cain, Dr. Doug Peifer, Llewellyn A. Lamar et al. (Maxwell AFB, Ala.: Air Command...In addition, the list of installations considered viable targets increased by 50% during the same timeframe.26 These statistics are only a small
Brooks, Larry; Hadi, Joseph; Amber, Kyle T; Weiner, Michelle; La Riche, Christopher L; Ference, Tamar
2015-01-01
Larry Brooks,1 Joseph Hadi,2 Kyle T Amber,1 Michelle Weiner,3 Christopher L La Riche,4 Tamar Ference1 1Department of Rehabilitation Medicine, University of Miami Miller School of Medicine, Miami, 2Anesco Interventional Pain Institute, Margate, 3Miami Pain and Diagnostics, Miami, 4Department of Psychiatry and Behavioral Health, Florida International University Wertheim College of Medicine, University Park, FL, USABackground: This retrospective chart review investigated differences in the preva...
Protein Crystal Recombinant Human Insulin
1994-01-01
The comparison of protein crystal, Recombiant Human Insulin; space-grown (left) and earth-grown (right). On STS-60, Spacehab II indicated that space-grown crystals are larger and of greater optical clarity than their earth-grown counterparts. Recombiant Human Insulin facilitates the incorporation of glucose into cells. In diabetics, there is either a decrease in or complete lack of insulin, thereby leading to several harmful complications. Principal Investigator is Larry DeLucas.
Legitimacy and Penetration in Stability Operations; Setting the Conditions for Perpetual Failure
2011-12-02
the exceptional sanctity, heroism or exemplary character of an individual person and on the normative patterns of order revealed or ordained by him...James Scott notes that ‘these subtle patterns of resistance are unique to a population as a result of their distinct history and culture.’ 63...people, in attempts to ‘control’ the indigenous populace. Larry Addington identifies the use of force, “Kitchener resorted to the very un- Victorian
Le prix Prince des Asturies de la recherche attribue aux peres de l'internet
2002-01-01
Tim Berners-Lee, Larry Roberts, Vinton Cerf et Robert Kahn, have been rewarded for their contributions to the development of the internet. The jury described their work as "sans aucun doute l'une des avancees technologiques les plus importantes de notre temps" and said the 4 prize winners "ont concu et realise un systeme qui change le monde en offrant des possibilites auparavant impensables pour le progres scientifique et social" (1/2 page).
Virtual Environment TBI Screen (VETS)
2016-12-01
Burrows H, Pinto R, et al. Evidence of central and peripheral vestibular pathology in blast-related trau- matic brain injury. Otol Neurotol. 2011;32:571... Burrows , H., Pinto, R., Littlefield, P., French, L.M., Tarbett, A.K., and Schubert, M.C. (2011). Evidence of central and peripheral vestibular pathology in...Please!contact!the!NPS!IRB!Chair!Dr.! Larry !Shattuck! (lgshattu@nps.edu)!with!any!questions!regarding!your!rights!as!a!participant.!!! APPENDIX D
A Historical Review and Analysis of Army Physical Readiness Training and Assessment
2013-03-01
gender; screening weights for 17-20 year old women/men for 60/72” respectively were: 111/132, 190/160. 150. Reynold A. Burrowes , Revolution and Rescue in...Colonel Larry Hicks was responsible for developing the Master Fitness Trainer course (MFT); Director of Doctrine-Lieutenant Colonel Mark Saunders was... Burrowes , Reynold A. Revolution and Rescue in Grenada: an Account of the US Caribbean Invasion. New York: Greenwood Press, 1988. Butts, Edmund. Manual
Technical Digest of the 1998 Summer Topical Meeting on Organic Optics and Optoelectronics
1998-07-01
Larry Dalton, University of Southern California, Los Angeles, CA Harold Fetterman , University of California, Los Angeles, CA Steve Forrest...OPTIC MODULATORS H. Fetterman , D. Chen, A. Udupa. D. Bhattachaya, B. Tsap University of Califonia, Los Angeles 90024 S. Lee, A. Chen, J. Chen, W...Chen, H.R. Fetterman , A. Chen, W.H. Steier, and L. R. Dalton, Appl. Phys. Lett. 70, (1997). 2. T.A. Tumolillo and P.R. Ashley, Appl. Phys. Lett. 62
Steve Jobs, Larry Page ja Sergei Brin teavad iga mu liigutust / Jan Jõgis-Laats
Jõgis-Laats, Jan
2011-01-01
iPhone on vähemalt 2010. a. juunist jälginud uusima operatsioonisüsteemi kasutajate telefoni liikumist. Nutitelefonides on tohutult andmeid, mis võõraste inimeste kätte sattudes võivad telefoniomanikule kahju teha. Soovitusi, kuidas oma andmeid kaitsta. Kümme nutitelefoniga seotud suuremat riski
2009-06-01
Jansen, The Dual Nature of Islamic Fundamentalism (Ithica: Cornell University Press, 1997), 24. 26 Ariel Merari, “ Psychological Aspects of Suicide...Terrorism,” in Bruce Bongar, Lisa M. Brown, Larry E. Beutler, James N. Breckenridge, and Phillip G. Zimbardo (eds.), Psychology of Terrorism, 110. 16...8 $14 .2 Portugal 0 $219 .5 Tunisia 98 $34 .5 Puerto R ico 0 $0 .0 Turkey 99 .8 $482 .0 Q atar 77 .5 $65 .8 Turkm enistan 89 $26 .2
Family Roles in Transition. In a Changing Military.
1981-06-18
and Management and Department of Psychology Dr. Larry Cummings College Park MD 20742 University of Wisconsin-Madison Graduate School of Business Dr. D...Graduate School of Management and Business University of Oregon Eugene OR 97403 Dr. James R. Terborg University of Houston Department of Psychology Houston...AD-A107 348 UNdITED STATES INTERNATIONAL UNIV SAN DIEGO CA FAMILY --ETC PIG 5/1l FAMILY ROLES IN TRANSITION IN A CHANGING MILITARY (U) JUN 81 E J
Porque é Tão Difícil Ter Boas Escolas
Satar, Edma A.
2010-01-01
Nesta recensão crítica do livro do autor Larry Cuban pretende-se, em primeiro lugar, destacar as preocupações do autor da reforma educativa do sistema americano, através da implantação das tecnologias de informação e comunicação, com a distribuição de microcomputadores nas salas de aula destinados ao desenvolvimento da aprendizagem dos alunos do ensino elementar. Descreve-se o ambiente polí...
AxiaLIF system: minimally invasive device for presacral lumbar interbody spinal fusion
Block, Jon; Rapp,; Miller,Larry E.
2011-01-01
Steven M Rapp1, Larry E Miller2,3, Jon E Block31Michigan Spine Institute, Waterford, MI, USA; 2Miller Scientific Consulting Inc, Biltmore Lake, NC, USA; 3Jon E. Block, Ph.D., Inc., San Francisco, CA, USAAbstract: Lumbar fusion is commonly performed to alleviate chronic low back and leg pain secondary to disc degeneration, spondylolisthesis with or without concomitant lumbar spinal stenosis, or chronic lumbar instability. However, the risk of iatrogenic injury during traditional anterior, post...
Block, Jon; Miller,Larry
2014-01-01
Larry E Miller,1,2 Jon E Block21Miller Scientific Consulting, Inc., Asheville, NC, USA; 2The Jon Block Group, San Francisco, CA, USA Abstract: Chronic sacroiliac (SI) joint-related low back pain (LBP) is a common, yet under-diagnosed and undertreated condition due to difficulties in accurate diagnosis and highly variable treatment practices. In patients with debilitating SI-related LBP for at least 6 months duration who have failed conservative management, arthrodesis is a viable option. The...
Multiexpandable cage for minimally invasive posterior lumbar interbody fusion
Miller, Larry E.; Coe,Jeffrey; Zucherman,James; Kucharzyk,Donald; Poelstra,Kornelis; Kunwar,Sandeep
2016-01-01
Jeffrey D Coe,1 James F Zucherman,2 Donald W Kucharzyk,3 Kornelis A Poelstra,4 Larry E Miller,5 Sandeep Kunwar,6 1Silicon Valley Spine Institute, Campbell, 2San Francisco Orthopaedic Surgeons, San Francisco, CA, 3Orthopaedic Pediatric and Spine, Crown Point, IN, 4Department of Surgery, Sacred Heart Hospital on the Emerald Coast, Miramar Beach, FL, 5Miller Scientific Consulting, Inc., Asheville, NC, 6Bell Neuroscience Institute, Washington Hospital Healthcare System, Fremont, CA, USA Abstract:...
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Piernikarczyk, R.J.J.; Týcová, Anna; Duraisamy, Ganesh Selvaraj; Kocábek, Tomáš; Steger, G.
2015-01-01
Roč. 183, JUL (2015), s. 85-94 ISSN 0176-1617 R&D Projects: GA ČR GCP501/10/J018 Institutional support: RVO:60077344 Keywords : mRNA target * RNA decay * Biolistic plant inoculation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.971, year: 2015
2013-05-23
2012), 35. 36Irving Lachow, “Cyber Terrorism: Menace of Myth ?” in Franklin D. Kramer, Stuart H. Starr, and Larry Wentz, eds., Cyberpower and National...of the Begin-Sadat Center for Strategic Studies, describes this period of thinking in the IDF as “’long dark age’ is explained by the myth of Israeli...knowing why they were broken.175 The scary part of this cyber weapon is in the fact that if engineered only slightly differently, Stuxnet could have
23rd Annual National Test and Evaluation Conference
2007-03-15
Mr. Gene Hudgins, BAE Systems FS D1.6 TRACER: A Tradespace Analysis Framework - Mr. Jerry Belcher, ASARDA Focus Session D1 Session Chair: Dr. Anne...Lockheed Martin Joe Sweeney Lockheed Martin Jon Neasham Cubic Gene Fraser Northrop Grumman Tom Quinn BAH Larry Graviss Jacobs Engineering • MEETINGS The...Des/Fab/Test UM CEV ATP UM Demo UM CEV1 Des/Fab UM LV ATP UM LV1 LV2 ATP Rework PPass PFail (Rework) PFail (Redesign)Des/Fab Man-rated Escape
Max Weber Visits America: A Review of the Video
Michael Wise
2006-01-01
The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976) to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided...
BURNER RIG TESTING OF A500 C/SiC
2018-03-17
AFRL-RX-WP-TR-2018-0071 BURNER RIG TESTING OF A500® C /SiC Larry P. Zawada Universal Technology Corporation Jennifer Pierce UDRI...TITLE AND SUBTITLE BURNER RIG TESTING OF A500® C /SiC 5a. CONTRACT NUMBER In-House 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62102F 6...test program characterized the durability behavior of A500® C /SiC ceramic matrix composite material at room and elevated temperature. Specimens were
Chemistries for Protection and Decontamination
2008-03-01
t i o n Measurement of Oxygen Uptake, Supported Catalyst and CEES in Solvent-Free System TDA R e s e a r c h Tests with HD • At CUBRC (Buffalo...dual gas burettes for HD tests at CUBRC . The dual burette on the left was connected to a flask with the catalyst and HD (and to an empty flask as a...Hill, Zhen Luo, Daniel Hillesheim • ECBC: Larry Procell • CUBRC : Meg Stapleton, Rich Fitzpatrick • Battelle: John Ontiveros, Walter Miller • ARO
Moeslund, Thomas B
2011-01-01
This unique text/reference provides a coherent and comprehensive overview of all aspects of video analysis of humans. Broad in coverage and accessible in style, the text presents original perspectives collected from preeminent researchers gathered from across the world. In addition to presenting state-of-the-art research, the book reviews the historical origins of the different existing methods, and predicts future trends and challenges. This title: features a Foreword by Professor Larry Davis; contains contributions from an international selection of leading authorities in the field; includes
Modeling Innovations Advance Wind Energy Industry
2009-01-01
In 1981, Glenn Research Center scientist Dr. Larry Viterna developed a model that predicted certain elements of wind turbine performance with far greater accuracy than previous methods. The model was met with derision from others in the wind energy industry, but years later, Viterna discovered it had become the most widely used method of its kind, enabling significant wind energy technologies-like the fixed pitch turbines produced by manufacturers like Aerostar Inc. of Westport, Massachusetts-that are providing sustainable, climate friendly energy sources today.
Rapid Translation of a Novel and Potent Vaccine in HER2+ Metastatic Breast Cancer Patients
2013-10-01
Xia3, Neil Spector2,3, Larry S Barak4, Timothy M Clay5, Takuya Osada2, Erika Hamilton6, Kimberly Blackwell6, Amy C Hobeika2, Michael A Morse2,3, H Kim...Zhang L, Boehm MF, Fritz LC, Burrows FJ: A high-affinity conformation of Hsp90 confers tumour selectivity on Hsp90 inhibitors. Nature 2003, 425:407...410. 13. Zhang H, Burrows F: Targeting multiple signal transduction pathways through inhibition of Hsp90. J Mol Med (Berl) 2004, 82:488-499. 14. Basso
Accuracy, Precision, Ease-Of-Use, and Cost of Methods to Test Ebola-Relevant Chlorine Solutions.
Directory of Open Access Journals (Sweden)
Emma Wells
Full Text Available To prevent transmission in Ebola Virus Disease (EVD outbreaks, it is recommended to disinfect living things (hands and people with 0.05% chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies with 0.5% chlorine solution. In the current West African EVD outbreak, these solutions (manufactured from calcium hypochlorite (HTH, sodium dichloroisocyanurate (NaDCC, and sodium hypochlorite (NaOCl have been widely used in both Ebola Treatment Unit and community settings. To ensure solution quality, testing is necessary, however test method appropriateness for these Ebola-relevant concentrations has not previously been evaluated. We identified fourteen commercially-available methods to test Ebola-relevant chlorine solution concentrations, including two titration methods, four DPD dilution methods, and six test strips. We assessed these methods by: 1 determining accuracy and precision by measuring in quintuplicate five different 0.05% and 0.5% chlorine solutions manufactured from NaDCC, HTH, and NaOCl; 2 conducting volunteer testing to assess ease-of-use; and, 3 determining costs. Accuracy was greatest in titration methods (reference-12.4% error compared to reference method, then DPD dilution methods (2.4-19% error, then test strips (5.2-48% error; precision followed this same trend. Two methods had an accuracy of <10% error across all five chlorine solutions with good precision: Hach digital titration for 0.05% and 0.5% solutions (recommended for contexts with trained personnel and financial resources, and Serim test strips for 0.05% solutions (recommended for contexts where rapid, inexpensive, and low-training burden testing is needed. Measurement error from test methods not including pH adjustment varied significantly across the five chlorine solutions, which had pH values 5-11. Volunteers found test strip easiest and titration hardest; costs per 100 tests were $14-37 for test strips and $33-609 for titration
Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides
International Nuclear Information System (INIS)
Heintz, Udo; Meinhart, Anton; Winkler, Andreas
2014-01-01
Crystal structures of two truncated variants of the transcription factor PpsR from R. sphaeroides are presented that enabled the phasing of a triple PAS domain construct. Together, these structures reveal the importance of α-helical PAS extensions for multi-PAS domain-mediated protein oligomerization and function. Per–ARNT–Sim (PAS) domains are essential modules of many multi-domain signalling proteins that mediate protein interaction and/or sense environmental stimuli. Frequently, multiple PAS domains are present within single polypeptide chains, where their interplay is required for protein function. Although many isolated PAS domain structures have been reported over the last decades, only a few structures of multi-PAS proteins are known. Therefore, the molecular mechanism of multi-PAS domain-mediated protein oligomerization and function is poorly understood. The transcription factor PpsR from Rhodobacter sphaeroides is such a multi-PAS domain protein that, in addition to its three PAS domains, contains a glutamine-rich linker and a C-terminal helix–turn–helix DNA-binding motif. Here, crystal structures of two N-terminally and C-terminally truncated PpsR variants that comprise a single (PpsR Q-PAS1 ) and two (PpsR N-Q-PAS1 ) PAS domains, respectively, are presented and the multi-step strategy required for the phasing of a triple PAS domain construct (PpsR ΔHTH ) is illustrated. While parts of the biologically relevant dimerization interface can already be observed in the two shorter constructs, the PpsR ΔHTH structure reveals how three PAS domains enable the formation of multiple oligomeric states (dimer, tetramer and octamer), highlighting that not only the PAS cores but also their α-helical extensions are essential for protein oligomerization. The results demonstrate that the long helical glutamine-rich linker of PpsR results from a direct fusion of the N-cap of the PAS1 domain with the C-terminal extension of the N-domain that plays an important
Numerical predicting of the structure and stresses state in hardened element made of tool steel
Directory of Open Access Journals (Sweden)
A. Bokota
2008-03-01
Full Text Available The paper presents numerical model of thcrmal phcnomcna, phasc transformation and mcchanical phcnomcna associated with hardeningof carbon tool steel. Model for evaluation or fractions OF phases and their kinetics bascd on continuous heating diagram (CHT andcontinuous cooling diagram (CCT. The stresses generated during hardening were assumed to rcsult from ~hermal load. stntcturaI plasticdeformations and transformation plasricity. Thc hardened material was assumed to be elastic-plastic, and in ordcr to mark plastic strains the non-isothermal plastic law of flow with the isotropic hardening and condition plasticity of Huber-Misses were used. TherrnophysicaI values of mechanical phenomena dependent on bo~hth e phase composition and temperature. In the numerical example thc simulated estimation of the phasc Fraction and strcss distributions in the hardened axisimmetrical elemcnt was performed.
Sport et société aux États-Unis : bibliographie sélective, 1981-2008
Peter Marquis
2012-01-01
Bilans historiographiques et critiques DEARDOFF II, Donald L., Sports, A Reference Guide and Critical Commentary, 1980-1999, Westport, Greenwood Press, 2000.GERLACH, Larry R., « Not Quite Ready for Prime Time: Baseball History, 1983-1993 », Journal of Sport History, vol. 21, n°2, été 1994, 103-37.HARDY, Stephen et Alan INGHAM, « Games, Structures, and Agency: Historians of the American Play Movement », Journal of Social History, vol. 17, hiver 1983, 285-301.POPE, Steven W., « Sport History: I...
Sport et société aux États-Unis : bibliographie sélective, 1981-2008
Directory of Open Access Journals (Sweden)
Peter Marquis
2012-03-01
Full Text Available Bilans historiographiques et critiquesDEARDOFF II, Donald L., Sports, A Reference Guide and Critical Commentary, 1980-1999, Westport, Greenwood Press, 2000.GERLACH, Larry R., « Not Quite Ready for Prime Time: Baseball History, 1983-1993 », Journal of Sport History, vol. 21, n°2, été 1994, 103-37.HARDY, Stephen et Alan INGHAM, « Games, Structures, and Agency: Historians of the American Play Movement », Journal of Social History, vol. 17, hiver 1983, 285-301.POPE, Steven W., « Sport History: In...
Directory of Open Access Journals (Sweden)
Didier Aubert
2011-04-01
Full Text Available When I called him in early February, fine art-documentary-advertising photographer Larry Fink was just returning from men’s fashion week in Milan. The occasion for the trip was an exhibit of his work in collaboration with one of his regular clients, Woolrich Woolen Mills. Fink had shot the clothing company’s catalogue several times, but this was a different project. Documentary pictures of the logging community he had taken in the 1980s were used as background for a fashion show evoking “Man ...
Software performance and scalability a quantitative approach
Liu, Henry H
2009-01-01
Praise from the Reviewers:"The practicality of the subject in a real-world situation distinguishes this book from othersavailable on the market."—Professor Behrouz Far, University of Calgary"This book could replace the computer organization texts now in use that every CS and CpEstudent must take. . . . It is much needed, well written, and thoughtful."—Professor Larry Bernstein, Stevens Institute of TechnologyA distinctive, educational text onsoftware performance and scalabilityThis is the first book to take a quantitative approach to the subject of software performance and scalability
Wrox SharePoint 2010 SharePoint911 three-pack
Klindt, Todd; Mason, Jennifer; Rogers, Laura; Drisgill, Randy; Ross, John; Riemann, Larry; Perran, Amanda; Perran, Shane; Sanford, Jacob J; Stubbs, Paul; Caravajal, Steve
2012-01-01
The Wrox SharePoint 2010 SharePoint911 Three-Pack combines the contents of three full e-books written by the experts from SharePoint911. That's over 1800 pages of hands-on advice from Todd Klindt, Shane Young, Laura Rogers, Randy Drisgill, Jennifer Mason, John Ross, and Larry Riemann, among others. In Beginning SharePoint 2010: Building Business Solutions with SharePoint (ISBN 978-0-470-61789-2) by Amanda Perran, Shane Perran, Jennifer Mason, and Laura Rogers, readers learn the core concepts, terminology, and features of SharePoint 2010. In Professiona
The phenomenological method in qualitative psychology and psychiatry.
Englander, Magnus
2016-01-01
This article will closely examine the phenomenological method as applied to qualitative inquiry in psychology and psychiatry. In a critical comparison between Amedeo Giorgi's and Larry Davidson's qualitatively methods, conclusions were drawn with regard to how different kinds of qualitative inquiry are possible while remaining faithful to Husserlian philosophical foundations. Utilizing Lester Embree's recent articulation of how Husserl's method of the epochē can be disclosed as specific to a discipline, varieties of these two qualitative methods were seen in their relation to the original scientific aim instigated by the developer.
Methodological Guidelines for Advertising Research
DEFF Research Database (Denmark)
Rossiter, John R.; Percy, Larry
2017-01-01
In this article, highly experienced advertising academics and advertising research consultants John R. Rossiter and Larry Percy present and discuss what they believe to be the seven most important methodological guidelines that need to be implemented to improve the practice of advertising research....... Their focus is on methodology, defined as first choosing a suitable theoretical framework to guide the research study and then identifying the advertising responses that need to be studied. Measurement of those responses is covered elsewhere in this special issue in the article by Bergkvist and Langner. Most...
Directory of Open Access Journals (Sweden)
Anne Barnhill
2013-01-01
Full Text Available In “Buying Health: the Costs of Commercialization and an Alternative Philosophy”, Larry R. Churchill and Shelley C. Churchill discuss the commercialization of health and, in particular, the commercialization of nutrition. In this commentary on their article, I draw a connection between Churchill and Churchill’s account of the commercialization of nutrition and Michael Pollan’s critique of “nutritionism”. I also offer a friendly amendment to Churchill and Churchill’s account, suggesting that the commercialization of nutrition is not a monolithic experience but it is rather widely challenged.
The phenomenological method in qualitative psychology and psychiatry
Directory of Open Access Journals (Sweden)
Magnus Englander
2016-03-01
Full Text Available This article will closely examine the phenomenological method as applied to qualitative inquiry in psychology and psychiatry. In a critical comparison between Amedeo Giorgi's and Larry Davidson's qualitatively methods, conclusions were drawn with regard to how different kinds of qualitative inquiry are possible while remaining faithful to Husserlian philosophical foundations. Utilizing Lester Embree's recent articulation of how Husserl's method of the epochē can be disclosed as specific to a discipline, varieties of these two qualitative methods were seen in their relation to the original scientific aim instigated by the developer.
Planning and Organizing the Postwar Air Force 1943-1947,
1982-01-01
power and air organization as formed over the decades since World War 1. These had great influence after World War 11 on the collective frame of mind of...author in the collections of’ the Air Force Chief’s of’ Staff. A special debt is due Larry Paszek. f’or his persistent search for photos, and F his...FIfil ’Nc Hranch ,ince 1970. During,- 1959-1966. he had been hi’t4orian at Stratee-i, \\it Commiand Hleadquartters. Offutt AFB3. Nebraska. Mr. \\\\ odk hold
Normal Impingement of a Supersonic Jet on a Plane - A Basic Study of Shock-Interference Heating
1975-12-01
George Xaler, Pail Zone Dr. H. Lew 28i0 Mr. J. W. Paust A . Mkrtallucci W. Daskin J. D. Cresaswell J. pvttu" J. Cor%.nto C. l!arri, F. GCOrge1. 4...NSWC/WOL/TR 75195 low zE ~ 1 WHITE OAK LABORATORY SNORMAL IMPINGEMENT OF A SUPERSONIC JET ON A PLANE - A BASIC STUDY OF SHOCK-INTERFERENCE HEATING...OF THIS PAGE ("oin DomejaE’ored) __________________ REPORT DOCUMENTATION PAGE READ INSTRUCTIONS4 2. OV ACE.~ CONTRAT O0GRN NUMBER~ a NS. P ER OR M I
Roubert, Paul-Louis
2008-01-01
Cet ouvrage est le catalogue de la version espagnole de l'exposition marquant le bicentenaire de la naissance de W. H. Fox Talbot qui s'était tenue à Bradford au printemps 2001 puis au Museo Nacional Reina Sofia de Madrid à l'été suivant. Quelque peu éclipsé par la sortie contemporaine de l'imposant ouvrage de Larry J. Schaaf, The Photographic Art of William Henry Fox Talbot, ce catalogue constitue pourtant une excellente introduction à l'oeuvre photographique complexe et multiple de T...
Transculturalidad en los cuidados de salud mental
Cañada Sánchez, Mario
2016-01-01
La Enfermería Transcultural es el área de estudio de la enfermería que combina sus propios saberes con los de la antropología, introduciendo los valores, creencias y modos de vida de los pacientes en la práctica del profesional de enfermería, para así brindar unos cuidados culturalmente competentes. M. Leininger, Larry D. Purnell, y otros autores, han creado distintas teorías y modelos mediante los cuales incorporar los cuidados culturales a nuestra práctica diaria y así cuidar de los pacient...
Kõigis meis on tegelikult olemas igavene teismeline / Elen Lotman
Lotman, Elen
2007-01-01
25. novembrist - 2. detsembrini 2006 toimunud PÖFFi laste- ja noortefilmide festivali "Just Film" filmidest: "Wholetrain" (rezh. Florian Gaag, Saksamaa 2006), "Wassup Rockers" (rezh. Larry Clark, 2005), "Kaunitar ja kodutu" (rezh. Dome Karukoski, Soome 2005), "Karm värk" (rezh. Detlev Buck, Saksamaa 2006), kassett-film "Kõik nähtamatud lapsed" (erinevad režissöörid,. Itaalia 2005), "Seitse neitsit" (rezh. Alberto Rodrigueze, Hispaania 2007), "Pobby ja Dingani" (rezh. Peter Cattaneo, Austraalia 2006), "Me saame sellest üle" (rezh. Niels Arden Oplev, Taani 2006), "Tommy põrgu" (rezh. Ove Raymond Gyldenas, Norra), "Pilv" (rezh. Gregor Schnitzler, Saksamaa 2006)
Design and Analysis of Composite Roadwheels for LVTP7 and M113A1
1984-08-01
mid radius of the wheel. As this laminate turns the corner into the rim it becomes mixed with layers in the hoop direction until, at the outer...Owens Corning Fiberglas, Advanced Composites, Marketing Section, Fiberglas Tower, Toledo, OH 43659 1 ATTN: Larry Dickson Goodyear Aerospace...4 3 -« 4*4 3*4 4 kfc . 4 4 kk-4k0« O • 4 I 4 •£ *i >. 4 3 i’H)*ssK£Hire •>k fi««*004-40 k M 4 0 • ft-H 4 C -4 b 4 44
Lindl, John D.
2016-10-01
In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program...
Lindl, John D.
In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program.
Performance of the Defense Acquisition System, 2015 Annual report
2015-09-16
report was conducted by Dan Davis, Ken Munson, Susan L. Rose, and Philip S. Antón, with much-appreciated assistance from Larry Axtell, Gary R. Bliss ...primary writers, with very helpful reviews and comments provided by Philip D. Rodgers, Gary R. Bliss , Mildred Bonilla-Lucia, Michael E. Lebrun, and the...11 n/ a 20 12 n/ a 20 13 20 13 Un re al is tic p er fo rm an ce e xp ec ta tio ns 10 % 2 X X Un re al is tic b as el in e es tim at es fo r c os
Cine e imperio tecnológico: de Blade Runner a Matrix
Gómez Tarín, Francisco Javier
2010-01-01
Las nuevas tecnologías digitales han disparado el fenómeno de los efectos especiales y cambiado significativamente la percepción espacio-temporal, fruto también de la moderna publicidad y las técnicas del vídeo-clip (acción inmediata, rápida, sin límite). Matrix (The Matrix), que realizan los hermanos LARRY Y ANDY WACHOWSKI en 1999, incorpora una trama argumental de indudable interés (confusión entre el mundo real y el virtual) y una brillante realización formal que responde en esencia a ese ...
Energy Technology Data Exchange (ETDEWEB)
Walker, S. [Independent Editorial and Technical Services, Oxford (United Kingdom)
2000-05-01
Room-and-pillar has traditionally satisfied the need for a low-cost, flexible coal mining system. Its downside can be low resource recovery. With accessible reserves falling steadily, can mining companies afford to accept this? Simon Walker looks into this problem using evidence presented recently on the US experience by Richard Bonskorski of the US Energy Information Administration, Dr Michael Karmis of Virgina Tech, Roger O'Quinn from Eimco, an equipment manufacturer, and Larry Howe from J H Fletcher. An urgent need is identified to develop new systems to allow significant gains in extraction, using novel concepts such as remote mining. 2 refs., 1 fig., 4 photos.
An Efficient PageRank Approach for Urban Traffic Optimization
Directory of Open Access Journals (Sweden)
Florin Pop
2012-01-01
to determine optimal decisions for each traffic light, based on the solution given by Larry Page for page ranking in Web environment (Page et al. (1999. Our approach is similar with work presented by Sheng-Chung et al. (2009 and Yousef et al. (2010. We consider that the traffic lights are controlled by servers and a score for each road is computed based on efficient PageRank approach and is used in cost function to determine optimal decisions. We demonstrate that the cumulative contribution of each car in the traffic respects the main constrain of PageRank approach, preserving all the properties of matrix consider in our model.
1993-01-01
An article in NASA Tech Briefs describing a vacuum bagging process for forming composite parts helped a small Oklahoma Company to improve its manufacturing process. President of Performance Extremes, Larry Ortega, and his partners make motorcycle parts from carbon/epoxy to reduce weight. Using vacuum bags, parts have a better surface and fewer voids inside. When heat used in the vacuum bag process caused deformation upon cooling, a solution found in another tech brief solved the problem. A metal plate inside the vacuum bag made for more even heat transfer. A third article described a simple procedure for repairing loose connector pins, which the company has also utilized.
International trade and waste and fuel managment issue, 2006
Energy Technology Data Exchange (ETDEWEB)
Agnihotri, Newal (ed.)
2006-01-15
The focus of the January-February issue is on international trade and waste and fuel managment. Major articles/reports in this issue include: HLW management in France, by Michel Debes, EDF, France; Breakthroughs from future reactors, by Jacques Bouchard, CEA, France; 'MOX for peace' a reality, by Jean-Pierre Bariteau, AREVA Group, France; Swedish spent fuel and radwaste, by Per H. Grahn and Marie Skogsberg, SKB, Sweden; ENC2005 concluding remarks, by Larry Foulke, 'Nuclear Technology Matters'; Fuel crud formation and behavior, by Charles Turk, Entergy; and, Plant profile: major vote of confidence for NP, by Martti Katka, TVO, Finland.
A global network for monitoring ocean acidification
CSIR Research Space (South Africa)
Celliers, Louis
2012-10-01
Full Text Available BASICally – It works! 15 Ma-Re Students Network – get involved! 15 A different kind of Carnival - Rio +20 dialogues 16 Science education—getting the message across 17 MCEN National Conference 2012 18 Mandela Day Celebrations 19 Kudos to Larry Hutchings 20...Ɵon: How applicable is the ‘knowledge negoƟaƟon’ model for producing appropriate knowledge for coastal govern-ance in the context of a neo-liberal, develop-ing society in the process of transformaƟon? The main objecƟve of the research is the...
Directory of Open Access Journals (Sweden)
María del Pilar San Pablo Moreno
2012-06-01
Full Text Available Resumen: El estreno de la película Matrix, (Larry y Andy Wachowsky 1999, ha supuesto uno de los mayores hitos cinematográficos de estos últimos veinte años. Esta película, primera de una trilogía, introdujo cambios notables en el género de ciencia-ficción. Sin embargo, el impacto, que aún hoy sigue produciendo el film, no fue puramente formal. El trasfondo de su guión interpeló a toda una generación sobre la necesidad de revisar profundamente el concepto de realidad. Esta llamada se produce, precisamente, en el instante del despliegue masivo del uso de los computadores y de la extensión de la red mundial de Internet. Un contexto inmejorable que aprovecha Matrix para revisar aspectos esenciales de la filosofía perenne y proponer un salto más allá hacia la transformación de la percepción de la conciencia. // Abstract: Matrix movie premiere of Larry and Andy Wachowski brothers in 1999, represented a significant milestone film of the past twenty years. This film, first of a trilogy, introduced fundamental changes in the genre of science fiction. However, the impact, which is still producing the film was not purely formal. The background of his script summons an entire generation about the need to review completely the concept of reality. This call comes just at the moment the massive deployment of the use of computers and the extent of the global Internet network. Matrix uses a memorable backdrop to review key aspects of the perennial philosophy and propose a leap beyond the transformation of perception of consciousness.
IMRE LAKATOS E IL PROBLEMA DELLA DEMARCAZIONE
Directory of Open Access Journals (Sweden)
Balletta, Sandro
2015-12-01
Full Text Available The aim of the paper is resurrecting the “Demarcation Problem”, which was considered dead in a paper written by Larry Laudan in 1983. I will go through the analysis of Imre Lakatos’ thought, which represents the most mature synthesis between the fallibilism of science and the rationality of the demarcation attitude. Lakatos’ philosophical trick is directed to acknowledge the inclinations of the contemporary philosophers, to grasp the best they can offer, and to propose a more suitable philosophy of science. He follows the middle path between dogmatism and skepticism: the favorite position in order to safeguard the phenomena suggesting a rational unity of the science in an “anarchic” historical period.
Max Weber Visits America: A Review of the Video
Directory of Open Access Journals (Sweden)
Michael Wise
2006-11-01
Full Text Available The North Carolina Sociological Society is proud to announce the long-awaited video of Max Weber's trip to North Carolina as retold by two of his cousins. Max Weber made a trip to visit relatives in Mount Airy, North Carolina, in 1904. This 2004 narrative by Larry Keeter and Stephen Hall is the story of locating and interviewing two living eyewitnesses (1976 to Max Weber's trip. The video includes information about Weber's contributions to modern sociology. Dowloadable files are provided using the .mp4 format. The video should appeal to students and professors interested in Max Weber. It can be included in courses ranging from introductory sociology to theory.
Functional genomics identifies specific vulnerabilities in PTEN-deficient breast cancer.
Tang, Yew Chung; Ho, Szu-Chi; Tan, Elisabeth; Ng, Alvin Wei Tian; McPherson, John R; Goh, Germaine Yen Lin; Teh, Bin Tean; Bard, Frederic; Rozen, Steven G
2018-03-22
Phosphatase and tensin homolog (PTEN) is one of the most frequently inactivated tumor suppressors in breast cancer. While PTEN itself is not considered a druggable target, PTEN synthetic-sick or synthetic-lethal (PTEN-SSL) genes are potential drug targets in PTEN-deficient breast cancers. Therefore, with the aim of identifying potential targets for precision breast cancer therapy, we sought to discover PTEN-SSL genes present in a broad spectrum of breast cancers. To discover broad-spectrum PTEN-SSL genes in breast cancer, we used a multi-step approach that started with (1) a genome-wide short interfering RNA (siRNA) screen of ~ 21,000 genes in a pair of isogenic human mammary epithelial cell lines, followed by (2) a short hairpin RNA (shRNA) screen of ~ 1200 genes focused on hits from the first screen in a panel of 11 breast cancer cell lines; we then determined reproducibility of hits by (3) identification of overlaps between our results and reanalyzed data from 3 independent gene-essentiality screens, and finally, for selected candidate PTEN-SSL genes we (4) confirmed PTEN-SSL activity using either drug sensitivity experiments in a panel of 19 cell lines or mutual exclusivity analysis of publicly available pan-cancer somatic mutation data. The screens (steps 1 and 2) and the reproducibility analysis (step 3) identified six candidate broad-spectrum PTEN-SSL genes (PIK3CB, ADAMTS20, AP1M2, HMMR, STK11, and NUAK1). PIK3CB was previously identified as PTEN-SSL, while the other five genes represent novel PTEN-SSL candidates. Confirmation studies (step 4) provided additional evidence that NUAK1 and STK11 have PTEN-SSL patterns of activity. Consistent with PTEN-SSL status, inhibition of the NUAK1 protein kinase by the small molecule drug HTH-01-015 selectively impaired viability in multiple PTEN-deficient breast cancer cell lines, while mutations affecting STK11 and PTEN were largely mutually exclusive across large pan-cancer data sets. Six genes showed PTEN
Letter report: Evaluation of dryer/calciner technologies for testing
International Nuclear Information System (INIS)
Sevigny, G.
1996-02-01
This letter report describes some past experiences on the drying and calcination of radioactive materials or corresponding simulants; and the information needed from testing. The report also includes an assessment of informational needs including possible impacts to a full-scale plant. This includes reliability, maintenance, and overall size versus throughput. Much of the material was previously compiled and reported by Mike Elliott of PNL open-quotes Melter Performance Assessmentclose quotes and Larry Eisenstatt of SEG on contract to WHC in a letter to Rod Powell. Also, an annotated bibliography was prepared by Reagan Seymour of WHC. Descriptions of the drying and calciner technologies, development status, advantages and disadvantages of using a WFE or calciner, and recommendations for future testing are discussed in this report
Towards Establishing Fiscal Legitimacy Through Settled Fiscal Principles in Global Health Financing.
Waris, Attiya; Latif, Laila Abdul
2015-12-01
Scholarship on international health law is currently pushing the boundaries while taking stock of achievements made over the past few decades. However despite the forward thinking approach of scholars working in the field of global health one area remains a stumbling block in the path to achieving the right to health universally: the financing of heath. This paper uses the book Global Health Law by Larry Gostin to reflect and take stock of the fiscal support provided to the right to health from both a global and an African perspective. It then sets out the key fiscal challenges facing global and African health and proposes an innovative solution for consideration: use of the domestic principles of tax to design the global health financing system.
2004-01-01
KENNEDY SPACE CENTER, FLA. This panel comprising former and current Safety and Mission Assurance (S&MA) management talk about identifying and comparing safety challenges of the past, present and future during Spaceport Super Safety and Health Day (SS&H) at KSC. Larry Crawford, left, is director of S&MA. SS&H Day included guest speakers Dr. Pamela Peeke, Navy Com. Stephen E. Iwanowicz, NASAs Dr. Kristine Calderon and Olympic-great Bruce Jenner. In addition, many vendors exhibits were on display for employees. Super Safety and Health Day was initiated at KSC in 1998 to increase awareness of the importance of safety and health among the government and contractor workforce. The theme for this years event was Safety and Health: A Winning Combination.
Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada
International Nuclear Information System (INIS)
2009-01-01
The drilling program described in this report is part of a new corrective action strategy for Corrective Action Unit (CAU) 443 at the Central Nevada Test Area (CNTA). The drilling program included drilling two boreholes, geophysical well logging, construction of two monitoring/validation (MV) wells with piezometers (MV-4 and MV-5), development of monitor wells and piezometers, recompletion of two existing wells (HTH-1 and UC-1-P-1S), removal of pumps from existing wells (MV-1, MV-2, and MV-3), redevelopment of piezometers associated with existing wells (MV-1, MV-2, and MV-3), and installation of submersible pumps. The new corrective action strategy includes initiating a new 5-year proof-of-concept monitoring period to validate the compliance boundary at CNTA (DOE 2007). The new 5-year proof-of-concept monitoring period begins upon completion of the new monitor wells and collection of samples for laboratory analysis. The new strategy is described in the Corrective Action Decision Document/Corrective Action Plan addendum (DOE 2008a) that the Nevada Division of Environmental Protection approved (NDEP 2008)
Towards novel amino acid-base contacts in gene regulatory proteins: AraR--a case study.
Directory of Open Access Journals (Sweden)
Isabel Lopes Correia
Full Text Available AraR is a transcription factor involved in the regulation of carbon catabolism in Bacillus subtilis. This regulator belongs to the vast GntR family of helix-turn-helix (HTH bacterial metabolite-responsive transcription factors. In this study, AraR-DNA specific interactions were analysed by an in vitro missing-contact probing and validated using an in vivo model. We show that amino acid E30 of AraR, a highly conserved residue in GntR regulators, is indirectly responsible for the specificity of amino acid-base contacts, and that by mutating this residue it will be possible to achieve new specificities towards DNA contacts. The results highlight the importance in DNA recognition and binding of highly conserved residues across certain families of transcription factors that are located in the DNA-binding domain but not predicted to specifically contact bases on the DNA. These new findings not only contribute to a more detailed comprehension of AraR-operator interactions, but may also be useful for the establishment of a framework of rules governing protein-DNA recognition.
Well Completion Report for Corrective Action Unit 443 Central Nevada Test Area Nye County, Nevada
Energy Technology Data Exchange (ETDEWEB)
None
2009-12-01
The drilling program described in this report is part of a new corrective action strategy for Corrective Action Unit (CAU) 443 at the Central Nevada Test Area (CNTA). The drilling program included drilling two boreholes, geophysical well logging, construction of two monitoring/validation (MV) wells with piezometers (MV-4 and MV-5), development of monitor wells and piezometers, recompletion of two existing wells (HTH-1 and UC-1-P-1S), removal of pumps from existing wells (MV-1, MV-2, and MV-3), redevelopment of piezometers associated with existing wells (MV-1, MV-2, and MV-3), and installation of submersible pumps. The new corrective action strategy includes initiating a new 5-year proof-of-concept monitoring period to validate the compliance boundary at CNTA (DOE 2007). The new 5-year proof-of-concept monitoring period begins upon completion of the new monitor wells and collection of samples for laboratory analysis. The new strategy is described in the Corrective Action Decision Document/Corrective Action Plan addendum (DOE 2008a) that the Nevada Division of Environmental Protection approved (NDEP 2008).
Directory of Open Access Journals (Sweden)
Barend J. van der Walt
2013-03-01
Full Text Available ’n Tradisie, wat ’n filosofiese tradisie insluit, kan alleen lewend bly as die verhaal daarvan aan die jonger geslag oorvertel word. Daarom bied hierdie inleidende en oorsigtelike artikel aan die leser iets oor die unieke filosofie van die Suid-Afrikaanse denker, Henk Stoker. Ter inleiding behandel dit die moontlike redes waarom sy denke in Suid-Afrika en elders vandag relatief onbekend is en minder invloedryk was in vergelyking met dié van die twee ander vaders van ’n reformatoriese filosofie, naamlik Dirk H.Th. Vollenhoven en veral Herman Dooyeweerd. Daarna word aandag geskenk aan die Suid-Afrikaanse milieu waarbinne sy filosofie gebore is. Die moontlike interne en eksterne teologiese en filosofiese invloede van veral Herman Bavinck (1854–1921 en Max Scheler (1874–1928 word behandel. Vervolgens word op enkele van Stoker se oorspronklikste bydraes tot die Christelik-filosofiese tradisie gewys. ’n Vlugtige blik word op die wedersydse kritiek tussen Stoker, Dooyeweerd en sekere leerlinge van Dooyeweerd gewerp. Ten slotte kan daar, in die lig van hierdie onderlinge verskille, sekere wanopvattings reggestel word, byvoorbeeld dat ’n Reformatoriese filosofie ’n statiese en geslote sisteem is. H.G. Stoker (1899–1993 as Christian philosopher: historical legend and icon, or still a contemporary mentor? Tradition which includes a philosophical tradition, can only been kept alive when its story is told to younger generations. This is the motivation behind this introductory overview of the unique philosophy of the South African philosopher, Henk Stoker. In comparison with the two other founders of a reformational philosophy, Dirk H.Th. Vollenhoven (1892–1978 and especially Herman Dooyeweerd (1994–1977, Stoker’s ideas are in South Africa, as well as abroad, less well-known among reformed people. The introductory part of this article, therefore, investigates the possible reasons for the relatively small impact of his thinking. The
2008-01-01
Larry Edson’s workshop will show examples of quantitative reliability predictions based upon accelerated testing and demonstrates that reliability testing during the prototyping phase will help ascertain product shortcomings. When these weak points are addressed and the redesigned product is re-tested, the reliability of that product will become much higher. These methodologies successfully used in industry might be exceedingly useful also for component development in particle physics where reliability is of utmost importance. This training will provide participants with the skills necessary to demonstrate reliability requirements using accelerated testing methods. The workshop will focus on accelerated test design that employs increased stress levels. This approach has the advantage of reducing test time, sample size and test facility resources. The methodologies taught are applicable to all types of stresses, spanning the electro...
2008-01-01
Larry Edson’s workshop will show examples of quantitative reliability predictions based upon accelerated testing and demonstrate that reliability testing during the prototyping phase will help ascertain product shortcomings. When these weak points are addressed and the redesigned product is re-tested, the reliability of that product will become much higher. These methodologies successfully used in industry might be exceedingly useful also for component development in particle physics where reliability is of the utmost importance. This training will provide participants with the skills necessary to demonstrate reliability requirements using accelerated testing methods. The workshop will focus on accelerated test design that employs increased stress levels. This approach has the advantage of reducing test time, sample size and test facility resources. The methodologies taught are applicable to all types of stresses, spanning the elec...
2008-01-01
Larry Edson’s workshop will show examples of quantitative reliability predictions based upon accelerated testing and demonstrate that reliability testing during the prototyping phase will help ascertain product shortcomings. When these weak points are addressed and the redesigned product is re-tested, the reliability of that product will become much higher. These methodologies successfully used in industry might be exceedingly useful also for component development in particle physics where reliability is of the utmost importance. This training will provide participants with the skills necessary to demonstrate reliability requirements using accelerated testing methods. The workshop will focus on accelerated test design that employs increased stress levels. This approach has the advantage of reducing test time, sample size and test facility resources. The methodologies taught are applicable to all types of stresses, spanning the elec...
Directory of Open Access Journals (Sweden)
Valeriano Iranzo
2012-12-01
Full Text Available El artículo discute la posición de Thomas Kuhn sobre el estatus epistemológico de las ciencias sociales. Su obra más conocida, La estructura de las revoluciones científicas, pretendió entender el cambio en la ciencia mediante las nociones de “paradigma” y “revolución”, despertando gran interés entre los científicos sociales, a pesar de haber sido elaborada pensando exclusivamente en las ciencias naturales. Basándome en un modelo alternativo, el modelo “reticular” de Larry Laudan, argumento que la distinción kuhniana entre “ciencia normal” y “ciencia revolucionaria” es demasiado esquemática y no sirve para dar cuenta de las diferencias actualmente existentes entre las ciencias naturales y las sociales.
Measurement and modelling of high temperature thermodynamic properties of actinide alloys
International Nuclear Information System (INIS)
Raju, S.; Rai, Arun Kumar; Tripathy, Haraprasanna
2011-01-01
The high temperature phase stability of cubic URh 3 intermetallic compound has been investigated using drop and scanning calorimetry techniques. The drop calorimetry measurements performed up to 1273 K yielded accurate values for the enthalpy increment (HT-H 298. 1 5 ) from which C P , the specific heat has been estimated. Since URh 3 exists as a line compound with very little or negligible solubility range, the arc melted alloy contained small amount of γ(fcc)-Rh solid solution phase. This is confirmed by scanning calorimetry experiments carried out up to 1823 K, which indicated the presence of a eutectic reaction involving, γ(fcc-Rh) + URh 3 Liquid at 1692 ± 2 K. The quantitative analysis of the transformation peak area indicated that less than about 5 % mass percent of γ(fcc-Rh) is present along with URh 3 . The enthalpy data obtained in this study have been combined with the previous low temperature C P measurements for a comprehensive theoretical analysis using Debye-Grueneisen formalism. It is found that this model with due allowance for thermal expansion effects can successfully account for the experimentally measured thermal property data in the entire temperature region spanning 0-1273 K. (author)
Menu, E; Mognetti, B; Moussa, M; Nardese, V; Tresoldi, L; Tscherning, C; Mbopi Keou, F X; Dubanchet, S; Mauclere, P; Fenyö, E M; Scarlatti, G; Barre-Sinoussi, F; Chaouat, G
1997-12-01
This paper is a summary of three oral presentations, as well as the ensuing discussion, at the Rijeka/Opatija 3rd Alps Adria Immunology meeting by three members of the European Biomed group on vertical transmission of HIV (G. Chaouat, F. Barre-Sinoussi, G. Scarlatti). This group also involves the laboratories of D. Dormont (CEA, Fontenay aux roses, France), P. Gounon (Electron Microscopy, the Pasteur Institute, France; Irène Athanassakis, University of Crete, Greece; Eva Maria Fenyö, Karolinska Institute, Sweden; and Larry Guilbert, Canada). As such, this paper intends to be neither a review, nor an original article, but rather is an opinion paper discussing the working hypothesis of this network, as well as some of their recent results, which were presented at this meeting. The paper was issued at the request of the organizers of the meeting.
Neoliberal ideology, global capitalism, and science education: engaging the question of subjectivity
Bazzul, Jesse
2012-12-01
This paper attempts to add to the multifaceted discussion concerning neoliberalism and globalization out of two Cultural Studies of Science Education journal issues along with the recent Journal of Research in Science Teaching devoted to these topics. However, confronting the phenomena of globalization and neoliberalism will demand greater engagement with relevant sociopolitical thought in fields typically outside the purview of science education. Drawing from thinkers Michel Foucault, Jean Baudrillard, Judith Butler, and Louis Althusser this paper attempts to extend some key ideas coming from Ken Tobin, Larry Bencze, and Lyn Carter and advocates science educators taking up notions of ideology, discourse, and subjectivity to engage globalization and neoliberalism. Subjectivity (and its constitution in science education) is considered alongside two relevant textbook examples and also in terms of its importance in formulating political and culturally relevant questions in science education.
Parker, Timothy J.; Tanaka, Kenneth L.; Senske, David A.
2002-01-01
The annual Planetary Geologic Mappers Meeting serves two purposes. In addition to giving mappers the opportunity to exchange ideas, experiences, victories, and problems with others, presentations are reviewed by the Geologic Mapping Subcommittee (GeMS) to provide input to the Planetary Geology and Geophysics Mapping Program review panel’s consideration of new proposals and progress reports that include mapping tasks. Funded mappers bring both oral presentation materials (slides or viewgraphs) and map products to post for review by GeMS and fellow mappers. Additionally, the annual meetings typically feature optional field trips offering earth analogs and parallels to planetary mapping problems. The 2001 Mappers Meeting, June 18-19, was convened by Tim Parker, Dave Senske, and Ken Tanaka and was hosted by Larry Crumpler and Jayne Aubele of the New Mexico Museum of Natural History and Science in Albuquerque, New Mexico. Oral presentations were given in the Museum’s Honeywell Auditorium, and maps were posted in the Sandia Room. In addition to active mappers, guests included local science teachers who had successfully competed for the right to attend and listen to the reports. It was a unique pleasure for mappers to have the opportunity to interact with and provide information to teachers responding so enthusiastically to the meeting presentation. On Sunday, June 17, Larry and Jayne conducted an optional pre-meeting field trip. The flanks of Rio Grande Rift, east and west of Albuquerque and Valles Caldera north of town presented tectonic, volcanic, and sedimentary examples of the Rift and adjoining areas analogous to observed features on Mars and Venus. The arid but volcanically and tectonically active environment of New Mexico’s rift valley enables focus on features that appear morphologically young and spectacular in satellite images and digital relief models. The theme of the trip was to see what, at orbiter resolution, "obvious" geologic features look like at
International Nuclear Information System (INIS)
Spencer, T.
1992-01-01
This report details and UNDP/FAO/IAEA consultancy undertaken from Monday 13 February to Saturday 25 February 1989. The purpose of the consultancy was to provide practical and theoretical training to Indonesian scientists in ELISA technology. This occurred under the program title of ''National Training Course on the Use of ELISA for Serodiagnosis of Animal Diseases, with Emphasis on Brucellosis''. The course was held in the Bacteriology Department, Research Institute for Veterinary Sciences (Balitvet), Bogor, Indonesia. The majority of the 19 participants came from the Regional Disease Investigation Centre Laboratories within Indonesia. The principal course instructor was Dr. Richard Jacobson who was assisted by Dr. Larry McClure, Dr. Susan Sutherland, Dr. Mark Eisler, Dr. Barry Patten and myself. The course concluded with a one day seminar organized by BATAN, DITKESWAN and BALITVET entitled ''Bovine Brucellosis: A Challenging Disease for Indonesia'' which was attended by approximately fifty people. Refs and tabs
Mask industry quality assessment
Strott, Al; Bassist, Larry
1994-12-01
Product quality and timely delivery are two of the most important parameters in determining the success of a mask manufacturing facility. Because of the sensitivity of this data, very little was known about industry performance in these areas until an assessment was authored and presented at the 1993 BACUS Symposium by Larry Regis of Intel Corporation, Neil Paulsen of Intel Corporation, and James A. Reynolds of Reynolds Consulting. This data has been updated and will be published and presented at this year's BACUS Symposium. Contributor identities will again remain protected by utilizing Arthur Andersen & Company to compile the submittals. Participation was consistent with last year's representation of over 75% of the total merchant and captive mask volume in the United States. The data compiled includes shipments, customer return rate, customer return reasons from 1988 through Q2, 1994, performance to schedule, plate survival yield, and throughput time (TPT).
Kümme teed maailma lõppu / Margit Tõnson
Tõnson, Margit, 1978-
2009-01-01
Kümme apokalüptilist filmi: animafilm "Wall-E" (režissöör Andrew Stanton), ulmefantaasia "Inimlapsed" ("Children of Men", režissöör Alfonso Cuaron), "Matrix" triloogia (režissöörid Andy ja Larry Wachowski), "12 ahvi" ("Twelve Monkeys", režissöör Terry Gilliam), "Dr. Strangelove ehk kuidas ma lõpetasin muretsemise ja õppisin armastama pommi" ("Dr. Strangelove", režissöör Stanley Kubrick), "Päikesepaiste" ("Sunshine", režissöör Danny Boyle), "Maximum Overdrive" (režissöör Stephen King), "Pöidlaküüdi teejuht galaktikasse" ("Hitchhiker's Guide to the Galaxy", režissöör Garth Jennings), "Maailmade sõda" ("War of the Worlds", režissöör Steven Spielberg) ja "2012" (režissöör Roland Emmerich, USA 2009)
Directory of Open Access Journals (Sweden)
Ran Qin
2016-11-01
Full Text Available Nε-lysine acetylation is an abundant and important Post-translational modification in bacteria. We used the bacterial two-hybrid system to screen the genome library of the Salmonella Typhimurium to identify potential proteins involved in acetyltransferase Pat - or deacetylase CobB-mediated acetylation. Then, the in vitro (deacetylation assays were used to validate the potential targets, such as STM14_1074, NrdF, RhaR. Lrp, a leucine-responsive regulatory protein and global regulator, was shown to interact with Pat. We further demonstrate that Lrp could be acetylated by Pat and deacetylated by NAD+-dependent CobB in vitro. Specifically, the conserved lysine residue 36 (K36 in helix-turn-helix (HTH DNA-binding domain of Lrp was acetylated. Acetylation of K36 impaired the function of Lrp through altering the affinity with the target promoter. The mutation of K36 in chromosome mimicking acetylation enhanced the transcriptional level of itself and attenuated the mRNA levels of Lrp-regulated genes including fimA, which was confirmed by yeast agglutination assay. These findings demonstrate that the acetylation regulates the DNA-binding activity of Lrp, suggesting that acetylation modification of transcription factors is a conserved regulatory manner to modulate gene expression in bacteria and eukaryotes.
Schmidt, Eric; Eagle, Alan
2014-01-01
Google Executive Chairman and ex-CEO Eric Schmidt and former SVP of Products Jonathan Rosenberg came to Google over a decade ago as proven technology executives. At the time, the company was already well-known for doing things differently, reflecting the visionary--and frequently contrarian--principles of founders Larry Page and Sergey Brin. If Eric and Jonathan were going to succeed, they realized they would have to relearn everything they thought they knew about management and business. Today, Google is a global icon that regularly pushes the boundaries of innovation in a variety of fields. HOW GOOGLE WORKS is an entertaining, page-turning primer containing lessons that Eric and Jonathan learned as they helped build the company. The authors explain how technology has shifted the balance of power from companies to consumers, and that the only way to succeed in this ever-changing landscape is to create superior products and attract a new breed of multifaceted employees whom Eric and Jonathan dub "smart creat...
Arms control in space: workshop proceedings, Washington, DC, January 30-31, 1984
International Nuclear Information System (INIS)
1984-05-01
In late 1982 and early 1983, the Subcommittee on Arms Control, Oceans, International Operations, and Environment of the Senate Committee on Foreign Relations held hearings on space weapons and arms control. To explore these issues further in a discussion format not easily achieved in hearings, Sen. Larry Pressler, Chairman of the Subcommittee, asked OTA to conduct a workshop focusing on antisatellite (ASAT) weapons as one aspect of space arms control. The workshop held in Washington, DC on January 30 and 31, 1984, provided an opportunity for technical, diplomatic, military, and policy-analysis experts to interact, think out loud, and build each other's ideas. The workshop was organized into six sessions, although issues involving anti-satellite weapons and arms control are not easily compartmentalized into distinct subject areas. Each session was introduced by a 10- or 15-minute informal oral presentation which set the stage for further discussion. This workshop proceedings volume is organized along the same divisions as the sessions, with some rearrangement
Directory of Open Access Journals (Sweden)
Zsuzsanna Ajtony
2012-01-01
Full Text Available This paper presents the discursive construction of ethnic identities in the verbal behaviour of the three major characters of G. B. Shaw’s John Bull’s Other Island (1904: the English protagonist Thomas Broadbent, and two ethnic Irish characters, Larry Doyle and Father Keegan. The play is approached with the help of micro-sociolinguistic methods, focusing on face-to-face conversational interactions between characters, as ethnic stereotypes. The main linguistic means of expressing ethnic sameness and difference (deictic ‘we’ vs. ‘they’, politeness strategies, markers of power and solidarity, etc. are analysed as conversational strategies that foreground the relationship among these characters and their attitude towards their own and the other’s ethnicity and home country. The analysis of these strategies reveal an unusual result: the reversal of ethnic roles which – as a technique of character treatment – proves Shaw to be wellahead his age, at the same time constructing and subverting ethnic stereotypes.
Directory of Open Access Journals (Sweden)
Zsuzsanna Ajtony
2012-11-01
Full Text Available This paper presents the discursive construction of ethnic identities in the verbal behaviour of the three major characters of G. B. Shaw’s John Bull’s Other Island (1904: the English protagonist Thomas Broadbent, and two ethnic Irish characters, Larry Doyle and Father Keegan. The play is approached with the help of micro-sociolinguistic methods, focusing on face-to-face conversational interactions between characters, as ethnic stereotypes. The main linguistic means of expressing ethnic sameness and difference (deictic ‘we’ vs. ‘they’, politeness strategies, markers of power and solidarity, etc. are analysed as conversational strategies that foreground the relationship among these characters and their attitude towards their own and the other’s ethnicity and home country. The analysis of these strategies reveal an unusual result: the reversal of ethnic roles which – as a technique of character treatment – proves Shaw to be well-ahead his age, at the same time constructing and subverting ethnic stereotypes.
ERAST: Scientific Applications and Technology Commercialization
Hunley, John D. (Compiler); Kellogg, Yvonne (Compiler)
2000-01-01
This is a conference publication for an event designed to inform potential contractors and appropriate personnel in various scientific disciplines that the ERAST (Environmental Research Aircraft and Sensor Technology) vehicles have reached a certain level of maturity and are available to perform a variety of missions ranging from data gathering to telecommunications. There are multiple applications of the technology and a great many potential commercial and governmental markets. As high altitude platforms, the ERAST vehicles can gather data at higher resolution than satellites and can do so continuously, whereas satellites pass over a particular area only once each orbit. Formal addresses are given by Rich Christiansen, (Director of Programs, NASA Aerospace Technology Ent.), Larry Roeder, (Senior Policy Advisor, U.S. Dept. of State), and Dr. Marianne McCarthy, (DFRC Education Dept.). The Commercialization Workshop is chaired by Dale Tietz (President, New Vista International) and the Science Workshop is chaired by Steve Wegener, (Deputy Manager of NASA ERAST, NASA Ames Research Center.
All of statistics a concise course in statistical inference
Wasserman, Larry
2004-01-01
This book is for people who want to learn probability and statistics quickly It brings together many of the main ideas in modern statistics in one place The book is suitable for students and researchers in statistics, computer science, data mining and machine learning This book covers a much wider range of topics than a typical introductory text on mathematical statistics It includes modern topics like nonparametric curve estimation, bootstrapping and classification, topics that are usually relegated to follow-up courses The reader is assumed to know calculus and a little linear algebra No previous knowledge of probability and statistics is required The text can be used at the advanced undergraduate and graduate level Larry Wasserman is Professor of Statistics at Carnegie Mellon University He is also a member of the Center for Automated Learning and Discovery in the School of Computer Science His research areas include nonparametric inference, asymptotic theory, causality, and applications to astrophysics, bi...
Paradigmas para o Ensino da Composição Musical nos séculos XX e XXI
Directory of Open Access Journals (Sweden)
Liduino Pitombeira
2011-05-01
Full Text Available Neste artigo, são examinados seis textos do século XX, paradigmáticos para o ensino da composição: [1] Learning to Compose, de Larry Austin e Thomas Clark, [2] Materials and Techniques of Twentieth-Century Music, de Stefan Kostka, [3] Techniques of Twentieth-Century Composition, de Leon Dallin, [4] Creative Music Composition, de Margaret Lucy Wilkins, [5] Techniques of the Contemporary Composer, de David Cope e [6] Simple Composition, de Charles Wuorinen. Busca-se, através desse exame, sintetizar os conceitos centrais e os enfoques pedagógicos, bem como revelar conexões com a teoria e a história. Propõe-se, então, uma discussão sobre as possíveis perspectivas no ensino da composição, face ao estabelecimento cada vez maior de abordagens texturais, espectrais, ultracomplexas e sistêmicas no campo da composição musical.
Cine club
2015-01-01
Wednesday 8 July 2015 at 20:00 CERN Council Chamber Contact Directed by Robert Zemeckis USA, 1997, 150 minutes Contact is the story of a free thinking radio astronomer who discovers an intelligent signal broadcast from deep space. She and her fellow scientists are able to decipher the Message and discover detailed instructions for building a mysterious Machine. Will the Machine spell the end of our world, or the end of our superstitions? Will we take our place among the races of the Galaxy, or are we just an upstart species with a long way to go? Original version english; french subtitles Wednesday 15 July 2015 at 20:00 CERN Council Chamber A Serious Man Directed by by Ethan Coen and Joel Coen USA, 2009, 106 minutes Larry Gopnik, a Midwestern physics teacher, watches his life unravel over multiple sudden incidents. Though seeking meaning and answers amidst his turmoils, he seems to keep sinking. Original version english; french subtitles
Clinton, Larry
2009-01-01
Võrguturvalisusega tegeleva Internet Security Alliance'í juht räägib, kuidas on võimalik muuta Internetti praegusest märkimisväärselt turvalisemaks ning avaldab arvamust, kas sõjaväed peaksid moodustama ka küberründe üksusi
Sharma, Gangavaram V M; Nagendar, Pendem; Ramakrishna, Kallaganti V S; Chandramouli, Nagula; Choudhary, Madavi; Kunwar, Ajit C
2008-06-02
A new three-residue turn was serendipitously discovered in alpha/beta hybrid peptides derived from alternating C-linked carbo-beta-amino acids (beta-Caa) and L-Ala residues. The three-residue beta-alpha-beta turn at the C termini, nucleated by a helix at the N termini, resulted in helix-turn (HT) supersecondary structures in these peptides. The turn in the HT motif is stabilized by two H bonds-CO(i-2)-NH(i), with a seven-membered pseudoring (gamma turn) in the backward direction, and NH(i-2)-CO(i), with a 13-membered pseudoring in the forward direction (i being the last residue)--at the C termini. The study was extended to generalize the new three-residue turn (beta-alpha-beta) by using different alpha- and beta-amino acids. Furthermore, the HT motifs were efficiently converted, by an extension with helical oligomers at the C termini, into peptides with novel helix-turn-helix (HTH) tertiary structures. However, this resulted in the destabilization of the beta-alpha-beta turn with the concomitant nucleation of another three-residue turn, alpha-beta-beta, which is stabilized by 11- and 15-membered bifurcated H bonds. Extensive NMR spectroscopic studies were carried out to delineate the secondary and tertiary structures in these peptides, which are further supported by molecular dynamics (MD) investigations.
Sorption of uranyl ions on hydrous oxides
International Nuclear Information System (INIS)
Gupta, A.R.; Venkataramani, B.
1988-01-01
Sorption of uranyl ions on hydrous titanium oxide (HTiO), magnetite (MAG), and hydrous thorium oxide (HThO) has been studied as a function of pH. Hydrous oxides have been characterized by their pH-titration curves, intrinsic dissociation constants (pK ai * ) and point of zero charge (pH pzc ). The fraction of protonated surface hydroxyl groups as well as the surface pH (pH surf ) as a function of solution pH have been computed. The distribution of various hydrolyzed species of uranyl ions with solution pH have been compared with uranyl sorption isotherm on these oxides. Sorption edge in all the cases occurs when free hydroxyl groups are available on the surface and pH surf is sufficiently high to favor the formation of dimer-like species on the surface. A new model for the sorption process, called surface hydrolysis model, which explains these and other features of uranyl sorption on hydrous oxides has been proposed. The model visualizes the sorption process as linking of uranyl ions with two adjacent free surface hydroxyl groups without deprotonation (provided the surface pH is high for the hydrolysis of uranyl ions) and formation of dimer-like structures on the surface. The new model has been successfully applied to the present and other available data on uranyl ion sorption on hydrous oxides. (author)
Grimm, Frauke; Dobler, Nadine; Dahl, Christiane
2010-03-01
Sulfur globules are formed as obligatory intermediates during the oxidation of reduced sulfur compounds in many environmentally important photo- and chemolithoautotrophic bacteria. It is well established that the so-called Dsr proteins are essential for the oxidation of zero-valent sulfur accumulated in the globules; however, hardly anything is known about the regulation of dsr gene expression. Here, we present a closer look at the regulation of the dsr genes in the phototrophic sulfur bacterium Allochromatium vinosum. The dsr genes are expressed in a reduced sulfur compound-dependent manner and neither sulfite, the product of the reverse-acting dissimilatory sulfite reductase DsrAB, nor the alternative electron donor malate inhibit the gene expression. Moreover, we show the oxidation of sulfur to sulfite to be the rate-limiting step in the oxidation of sulfur to sulfate as sulfate production starts concomitantly with the upregulation of the expression of the dsr genes. Real-time RT-PCR experiments suggest that the genes dsrC and dsrS are additionally expressed from secondary internal promoters, pointing to a special function of the encoded proteins. Earlier structural analyses indicated the presence of a helix-turn-helix (HTH)-like motif in DsrC. We therefore assessed the DNA-binding capability of the protein and provide evidence for a possible regulatory function of DsrC.
Bioglass: A novel biocompatible innovation.
Krishnan, Vidya; Lakshmi, T
2013-04-01
Advancement of materials technology has been immense, especially in the past 30 years. Ceramics has not been new to dentistry. Porcelain crowns, silica fillers in composite resins, and glass ionomer cements have already been proved to be successful. Materials used in the replacement of tissues have come a long way from being inert, to compatible, and now regenerative. When hydroxyapatite was believed to be the best biocompatible replacement material, Larry Hench developed a material using silica (glass) as the host material, incorporated with calcium and phosphorous to fuse broken bones. This material mimics bone material and stimulates the regrowth of new bone material. Thus, due to its biocompatibility and osteogenic capacity it came to be known as "bioactive glass-bioglass." It is now encompassed, along with synthetic hydroxyapatite, in the field of biomaterials science known as "bioactive ceramics." The aim of this article is to give a bird's-eye view, of the various uses in dentistry, of this novel, miracle material which can bond, induce osteogenesis, and also regenerate bone.
The effects of droplet characteristics on the surface features in a rain field
Liu, R.; Brown, H.; Liu, X.; Duncan, J. H.
2013-11-01
The characteristics of the shape of a water surface in response to the impact of simulated raindrops are studied experimentally in a 1.22-m-by-1.22-m water pool with a water depth of 0.3 m. A rain generator consisting of an open-surface water tank with an array of 22-gauge hypodermic needles (typical needle-to-needle spacing of about L0 = 3 . 5 cm) attached to holes in the tank bottom is mounted 2 m above the water pool. The tank is connected to a 2D translation stage to provide a small-radius (volumetric flow rate (nπd3 / 6) through control of the water depth in the generator tank. The water surface features, including the crown, stalk and ring waves, due to the impacts of the drops are measured with a cinematic laser-induced- fluorescence (LIF) technique. The dependence of these features on the rain characteristics are discussed. The support of the National Science Foundation, Division of Ocean Sciences, and the assistance of Mr. Larry Gong are gratefully acknowledged.
2008-04-01
Local Organizing Committee Takeshi Kodama Chair, UFRJ Jun Takahashi Co-chair, UNICAMP Ignácio Bediaga e Hickman CBPF Eduardo Fraga UFRJ Frederique Grassi USP Yogiro Hama USP Gastão Krein IFT Erasmo Madureira Ferreira UFRJ Marcelo G. Munhoz USP Fernando Navarra USP Sandra Padula IFT Alejandro Szanto de Toledo USP César Augusto Zen Vasconcellos UFRGS International Advisory Committee Jörg Aichelin Nantes Federico Antinori Padova Tamás Biró Budapest Peter Braun-Munzinger GSI Jean Cleymans Cape Town Láaszló Csernai Bergen Timothy Hallman BNL Huan Zhong Huang UCLA Takeshi Kodama Rio de Janeiro Yu-Gang Ma Shanghai Jes Madsen Aarhus Ágnes Mócsy Pratt University Berndt Müller Duke University Grazyna Odyniec LBNL Helmut Oeschler Darmstadt Johann Rafelski Arizona Hans Georg Ritter LBNL Gunther Rolland MIT Karel Šafařík CERN Ladislav Sandor Kosice University Jack Sandweiss Yale University George S F Stephans MIT Horst Stöcker Frankfurt Larry McLerranBNL Helmut Satz Universitä Bielefeld Nu Xu LBNL Fuqiang Wang Purdue University William A. Zajc Columbia University Pengfei Zhuang Tsinghua University
SEQUENCING AND SEQUENCE ANALYSIS OF MYOSTATIN GENE IN THE EXON 1 OF THE CAMEL (CAMELUS DROMEDARIUS
Directory of Open Access Journals (Sweden)
M. G. SHAH, A. S. QURESHI1, M. REISSMANN2 AND H. J. SCHWARTZ3
2006-10-01
Full Text Available Myostatin, also called growth differentiation factor-8 (GDF-8, is a member of the mammalian growth transforming family (TGF-beta superfamily, which is expressed specifically in developing an adult skeletal muscle. Muscular hypertrophy allele (mh allele in the double muscle breeds involved mutation within the myostatin gene. Genomic DNA was isolated from the camel hair using NucleoSpin Tissue kit. Two animals of each of the six breeds namely, Marecha, Dhatti, Larri, Kohi, Sakrai and Cambelpuri were used for sequencing. For PCR amplification of the gene, a primer pair was designed from homolog regions of already published sequences of farm animals from GenBank. Results showed that camel myostatin possessed more than 90% homology with that of cattle, sheep and pig. Camel formed separate cluster from the pig in spite of having high homology (98% and showed 94% homology with cattle and sheep as reported in literature. Sequence analysis of the PCR amplified part of exon 1 (256 bp of the camel myostatin was identical among six camel breeds.
Directory of Open Access Journals (Sweden)
Miller LE
2014-05-01
Full Text Available Larry E Miller,1,2 Jon E Block21Miller Scientific Consulting, Inc., Asheville, NC, USA; 2The Jon Block Group, San Francisco, CA, USA Abstract: Chronic sacroiliac (SI joint-related low back pain (LBP is a common, yet under-diagnosed and undertreated condition due to difficulties in accurate diagnosis and highly variable treatment practices. In patients with debilitating SI-related LBP for at least 6 months duration who have failed conservative management, arthrodesis is a viable option. The SImmetry® SI Joint Fusion System is a novel therapy for SI joint fusion, not just fixation, which utilizes a minimally invasive surgical approach, instrumented fixation for immediate stability, and joint preparation with bone grafting for a secure construct in the long term. The purpose of this report is to describe the minimally invasive SI Joint Fusion System, including patient selection criteria, implant characteristics, surgical technique, postoperative recovery, and biomechanical testing results. Advantages and limitations of this system will be discussed. Keywords: arthrodesis, fusion, minimally invasive, sacroiliac, SImmetry
Bioglass: A novel biocompatible innovation
Directory of Open Access Journals (Sweden)
Vidya Krishnan
2013-01-01
Full Text Available Advancement of materials technology has been immense, especially in the past 30 years. Ceramics has not been new to dentistry. Porcelain crowns, silica fillers in composite resins, and glass ionomer cements have already been proved to be successful. Materials used in the replacement of tissues have come a long way from being inert, to compatible, and now regenerative. When hydroxyapatite was believed to be the best biocompatible replacement material, Larry Hench developed a material using silica (glass as the host material, incorporated with calcium and phosphorous to fuse broken bones. This material mimics bone material and stimulates the regrowth of new bone material. Thus, due to its biocompatibility and osteogenic capacity it came to be known as "bioactive glass-bioglass." It is now encompassed, along with synthetic hydroxyapatite, in the field of biomaterials science known as "bioactive ceramics." The aim of this article is to give a bird′s-eye view, of the various uses in dentistry, of this novel, miracle material which can bond, induce osteogenesis, and also regenerate bone.
Human NUP98-HOXA9 promotes hyperplastic growth of hematopoietic tissues in Drosophila.
Baril, Caroline; Gavory, Gwenaëlle; Bidla, Gawa; Knævelsrud, Helene; Sauvageau, Guy; Therrien, Marc
2017-01-01
Acute myeloid leukemia (AML) is a complex malignancy with poor prognosis. Several genetic lesions can lead to the disease. One of these corresponds to the NUP98-HOXA9 (NA9) translocation that fuses sequences encoding the N-terminal part of NUP98 to those encoding the DNA-binding domain of HOXA9. Despite several studies, the mechanism underlying NA9 ability to induce leukemia is still unclear. To bridge this gap, we sought to functionally dissect NA9 activity using Drosophila. For this, we generated transgenic NA9 fly lines and expressed the oncoprotein during larval hematopoiesis. This markedly enhanced cell proliferation and tissue growth, but did not alter cell fate specification. Moreover, reminiscent to NA9 activity in mammals, strong cooperation was observed between NA9 and the MEIS homolog HTH. Genetic characterization of NA9-induced phenotypes suggested interference with PVR (Flt1-4 RTK homolog) signaling, which is similar to functional interactions observed in mammals between Flt3 and HOXA9 in leukemia. Finally, NA9 expression was also found to induce non-cell autonomous effects, raising the possibility that its leukemia-inducing activity also relies on this property. Together, our work suggests that NA9 ability to induce blood cell expansion is evolutionarily conserved. The amenability of NA9 activity to a genetically-tractable system should facilitate unraveling its molecular underpinnings. Copyright © 2016 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Barbosa, Rosicler Lázaro; Rinaldi, Fábio Cupri; Guimarães, Beatriz Gomes; Benedetti, Celso Eduardo
2007-01-01
In order to gain new insights into the protein structure and its possible interaction with a metal ion or effector ligand, BigR from X. fastidiosa was crystallized in native and selenomethionine (SeMet) labelled forms using the hanging-drop vapour-diffusion method. BigR (biofilm growth-associated repressor) is a novel repressor protein that regulates the transcription of an operon implicated in biofilm growth in both Xylella fastidiosa and Agrobacterium tumefaciens. This protein binds to a palindromic TA-rich element located in the promoter of the BigR operon and strongly represses transcription of the operon. BigR contains a helix–turn–helix (HTH) domain that is found in some members of the ArsR/SmtB family of metal sensors, which control metal resistance in bacteria. Although functional studies have suggested that BigR does not act as a metal sensor, the presence of two cysteines and a methionine in its primary structure raised the possibility of BigR being a metal-ligand protein. In order to gain new insights into the protein structure and its possible interaction with a metal ion or effector ligand, BigR from X. fastidiosa was crystallized in native and selenomethionine (SeMet) labelled forms using the hanging-drop vapour-diffusion method. X-ray diffraction data were collected from native and SeMet crystals to resolutions of 1.95 and 2.2 Å, respectively. Both crystals belong to space group P321 and contain one molecule per asymmetric unit
Variation in LOV Photoreceptor Activation Dynamics Probed by Time Resolved Infrared Spectroscopy
Iuliano, James N.; Gil, Agnieszka A.; Laptenok, Sergey P.; Hall, Christopher R.; Tolentino Collado, Jinnette; Lukacs, Andras; Hag Ahmed, Safaa A; Abyad, Jenna; Daryaee, Taraneh; Greetham, Gregory M.; Sazanovich, Igor V.; Illarionov, Boris; Bacher, Adelbert; Fischer, Markus; Towrie, Michael; French, Jarrod B.; Meech, Stephen R.; Tonge, Peter J
2017-01-01
The light, oxygen, voltage (LOV) domain proteins are blue light photoreceptors that utilize a non-covalently bound flavin mononucleotide (FMN) cofactor as the chromophore. The modular nature of these proteins has led to their wide adoption in the emerging fields of optogenetics and optobiology, where the LOV domain has been fused to a variety of output domains leading to novel light-controlled applications. In the present work, we extend our studies of the sub-picosecond to several hundred microsecond transient infrared spectroscopy of the isolated LOV domain AsLOV2 to three full-length photoreceptors in which the LOV domain is fused to an output domain: the LOV-STAS protein, YtvA, the LOV-HTH transcription factor, EL222, and the LOV-histidine kinase, LovK. Despite differences in tertiary structure, the overall pathway leading to cysteine adduct formation from the FMN triplet state is highly conserved, although there are slight variations in rate. However significant differences are observed in the vibrational spectra and kinetics after adduct formation, which are directly linked to the specific output function of the LOV domain. While the rate of adduct formation varies by only 3.6-fold amongst the proteins, the subsequent large-scale structural changes in the full-length LOV photoreceptors occur over the micro- to sub-millisecond timescales and vary by orders of magnitude depending on the different output function of each LOV domain.
Variation in LOV Photoreceptor Activation Dynamics Probed by Time Resolved Infrared Spectroscopy
Iuliano, James N.
2017-12-14
The light, oxygen, voltage (LOV) domain proteins are blue light photoreceptors that utilize a non-covalently bound flavin mononucleotide (FMN) cofactor as the chromophore. The modular nature of these proteins has led to their wide adoption in the emerging fields of optogenetics and optobiology, where the LOV domain has been fused to a variety of output domains leading to novel light-controlled applications. In the present work, we extend our studies of the sub-picosecond to several hundred microsecond transient infrared spectroscopy of the isolated LOV domain AsLOV2 to three full-length photoreceptors in which the LOV domain is fused to an output domain: the LOV-STAS protein, YtvA, the LOV-HTH transcription factor, EL222, and the LOV-histidine kinase, LovK. Despite differences in tertiary structure, the overall pathway leading to cysteine adduct formation from the FMN triplet state is highly conserved, although there are slight variations in rate. However significant differences are observed in the vibrational spectra and kinetics after adduct formation, which are directly linked to the specific output function of the LOV domain. While the rate of adduct formation varies by only 3.6-fold amongst the proteins, the subsequent large-scale structural changes in the full-length LOV photoreceptors occur over the micro- to sub-millisecond timescales and vary by orders of magnitude depending on the different output function of each LOV domain.
Energy Technology Data Exchange (ETDEWEB)
Barbosa, Rosicler Lázaro; Rinaldi, Fábio Cupri; Guimarães, Beatriz Gomes, E-mail: beatriz@lnls.br; Benedetti, Celso Eduardo, E-mail: beatriz@lnls.br [Center for Molecular and Structural Biology, Brazilian Synchrotron Light Laboratory, Campinas, SP, CP 6192, CEP 13083-970 (Brazil)
2007-07-01
In order to gain new insights into the protein structure and its possible interaction with a metal ion or effector ligand, BigR from X. fastidiosa was crystallized in native and selenomethionine (SeMet) labelled forms using the hanging-drop vapour-diffusion method. BigR (biofilm growth-associated repressor) is a novel repressor protein that regulates the transcription of an operon implicated in biofilm growth in both Xylella fastidiosa and Agrobacterium tumefaciens. This protein binds to a palindromic TA-rich element located in the promoter of the BigR operon and strongly represses transcription of the operon. BigR contains a helix–turn–helix (HTH) domain that is found in some members of the ArsR/SmtB family of metal sensors, which control metal resistance in bacteria. Although functional studies have suggested that BigR does not act as a metal sensor, the presence of two cysteines and a methionine in its primary structure raised the possibility of BigR being a metal-ligand protein. In order to gain new insights into the protein structure and its possible interaction with a metal ion or effector ligand, BigR from X. fastidiosa was crystallized in native and selenomethionine (SeMet) labelled forms using the hanging-drop vapour-diffusion method. X-ray diffraction data were collected from native and SeMet crystals to resolutions of 1.95 and 2.2 Å, respectively. Both crystals belong to space group P321 and contain one molecule per asymmetric unit.
Energy Technology Data Exchange (ETDEWEB)
Velge,P.; Herler, M.; Johansson, J.; Roches, S.; Temoin, S.; Fedorov, A.; Gracieux, P.; Almo, S.; Goebel, W.; Cossart, P.
2007-01-01
The sequencing of prfA, encoding the transcriptional regulator of virulence genes, in 26 low-virulence field Listeria monocytogenes strains showed that eight strains exhibited the same single amino-acid substitution: PrfAK220T. These strains exhibited no expression of PrfA-regulated proteins and thus no virulence. This substitution inactivated PrfA, since expression of the PrfAK220T mutant gene in an EGD{Delta}prfA strain did not restore the haemolytic and phosphatidylcholine phospholipase C activities, in contrast to the wild-type prfA gene. The substitution of the lysine at position 220 occurred in the helix H. However, the data showed that the PrfAK220T protein is dimerized just as well as its wild-type counterpart, but does not bind to PrfA-boxes. PrfAK220T did not form a PrfA-DNA complex in electrophoretic mobility shift assays, but low concentrations of CI complexes (PrfAK220T-RNA polymerase-DNA complex) were formed by adding RNA polymerase, suggesting that PrfA interacted with RNA polymerase in solution in the absence of DNA. Formation of some transcriptionally active complexes was confirmed by in vitro runoff transcription assays and quantitative RT-PCR. Crystallographic analyses described the structure of native PrfA and highlighted the key role of allosteric changes in the activity of PrfA and especially the role of the Lys220 in the conformation of the helix-turn-helix (HTH) motif.
Directory of Open Access Journals (Sweden)
Jingru Zhao
2016-04-01
Full Text Available Although quorum-sensing (QS systems are important regulators of virulence gene expression in the opportunistic human pathogen Pseudomonas aeruginosa, their detailed regulatory mechanisms have not been fully characterized. Here, we show that deletion of PA2588 resulted in increased production of pyocyanin and biofilm, as well as enhanced pathogenicity in a mouse model. To gain insights into the function of PA2588, we performed a ChIP-seq assay and identified 28 targets of PA2588, including the intergenic region between PA2588 and pqsH, which encodes the key synthase of Pseudomonas quinolone signal (PQS. Though the C-terminal domain was similar to DNA-binding regions of other AraC family members, structural studies revealed that PA2588 has a novel fold at the N-terminal region (NTR, and its C-terminal HTH (helix-turn-helix domain is also unique in DNA recognition. We also demonstrated that the adaptor protein ClpS, an essential regulator of ATP-dependent protease ClpAP, directly interacted with PA2588 before delivering CdpR to ClpAP for degradation. We named PA2588 as CdpR (ClpAP-degradation and pathogenicity Regulator. Moreover, deletion of clpP or clpS/clpA promotes bacterial survival in a mouse model of acute pneumonia infection. Taken together, this study uncovered that CdpR is an important QS regulator, which can interact with the ClpAS-P system to regulate the expression of virulence factors and pathogenicity.
The Political Use of the Figure of John Coltrane in American Poetry
Directory of Open Access Journals (Sweden)
Samo Šalamon
2007-06-01
Full Text Available John Coltrane; one of the most influential and important musicians and composers of the 20th century; began to inspire jazz musicians and American poets in the 1960s with the Black Arts Movement poets. His music was interpreted and used for the promotion of political ideas in the poetics of Amiri Baraka; Sonia Sanchez; Askia Muhammad Toure; Larry Neal and others. This is the political Coltrane poetry. On the other hand; Coltrane’s music inspired another kind of poets; the musical poets; which began to emerge in the 1970s. In this case; the poetry reflects the true nature of Coltrane’s spiritual music quest. The poets belonging to this group; like Michael S. Harper; William Matthews; Jean Valentine; Cornelius Eady; Philip Levine; Nathaniel Mackey and others; go beyond politics; beyond race or gender. The paper will examine the first type of the Coltrane poetry; where Coltrane’s music was used to promote the political ideas of the Black Art Movement in connection with the political movement of Malcolm X. These poets changed; rearticulated and shifted Coltrane’s spiritually musical message towards the principles of the black nationalism.
International Nuclear Information System (INIS)
Samios, N.P.
2005-01-01
The RIKEN BNL Research Center (RBRC) was established in April 1997 at Brookhaven National Laboratory. It is funded by the ''Rikagaku Kenkyusho,'' (RIKEN) The Institute of Physical and Chemical Research, of Japan. The Center is dedicated to the study of strong interactions, including hard QCD/spin physics, lattice QCD and RHIC (Relativistic Heavy Ion Collider) physics through nurturing of a new generation of young physicists. The agreement was extended in 2002 for another five year period. This 11th steering group meeting consisted of a series of reports on current activities and future perspectives. Presentation titles and authors included: 'RBRC operations and accomplishments' by Nicholas P. Samios, 'Theoretical physics at RIKEN-BNL Center: strong interactions and QCD' by Larry McLerran, 'RBRC experimental group and Wako base', by Hideto En'yo, 'The QCDOC project overview and status' by Norman H. Christ, 'RHIC spin physics' by Gerry Bunce, 'RHIC heavy ion progam' by Yasuyuki Akiba, 'RIKEN's current status and future plans' by Samuel Aronson, 'Procedure for proposing renewal of the collaboration agreement in 2007' by Chiharu Shimoyamada, and 'New direction of RPRC beyond JFY 2007' by Nicholas P. Samios
Directory of Open Access Journals (Sweden)
André L.F. Souza
2008-01-01
Full Text Available In prokaryotes molybdenum is taken up by a high-affinity ABC-type transporter system encoded by the modABC genes. The endophyte β-Proteobacterium Herbaspirillum seropedicae has two modABC gene clusters and two genes encoding putative Mo-dependent regulator proteins (ModE1 and ModE2. Analysis of the amino acid sequence of the ModE1 protein of H. seropedicae revealed the presence of an N-terminal domain containing a DNA-binding helix-turn-helix motif (HTH and a C-terminal domain with a molybdate-binding motif. The second putative regulator protein, ModE2, contains only the helix-turn-helix motif, similar to that observed in some sequenced genomes. We cloned the modE1 (810 bp and modE2 (372 bp genes and expressed them in Escherichia coli as His-tagged fusion proteins, which we subsequently purified. The over-expressed recombinant His-ModE1 was insoluble and was purified after solubilization with urea and then on-column refolded during affinity chromatography. The His-ModE2 was expressed as a soluble protein and purified by affinity chromatography. These purified proteins were analyzed by DNA band-shift assays using the modA2 promoter region as probe. Our results indicate that His-ModE1 and His-ModE2 are able to bind to the modA2 promoter region, suggesting that both proteins may play a role in the regulation of molybdenum uptake and metabolism in H. seropedicae.
Magnetic and thermal behaviour of the amorphous ferromagnet Fe79B16Si5
International Nuclear Information System (INIS)
Shaisha, E.E.; Bahgat, A.A.
1985-01-01
Spin waves in the amorphous ferromagnet Fe 79 B 16 Si 5 are studied by Moessbauer effect spectroscopy. The magnetic hyperfine field (MHF) is measured at the Fe sites of such a ferromagnet, which exhibits a temperature dependence of the form, H(T)/H(0) = (1 - BT/sup 3/2/ - CT/sup 5/2/), indicative of spin wave excitations in amorphous ferromagnets. The T/sup 3/2/ behaviour and the distribution of the exchange interactions are studied in detail as a function of the MHF. The spin wave excitations constant B/sub 3/2/ = BT/sub C//sup 3/2/ = 0.3 +- 0.05 and C/sub 5/2/ = CT/sub C//sup 5/2/ = 0.3 +- 0.05,Are obtained by fitting the experimental data, and where T/sub C/ = 670 K. The results sh=ow that the contribution of C/sub 5/2/ is extremely effective above 124 K, while the ratio C/sub 5/2//C/sub 3/2/ = 1.0 indicates that the present magnetic interaction is of long range order character. On the other hand, fluctuations of the exchange interaction constant are found to decrease with increasing temperature. Some information regarding the directions of the magnetic moments are obtained during the study of the magnetic anisotropy course. The values of the Einstein and Debye temperatures as measured from the thermal shift results are theta/sub E/ = 250 K and theta/sub D/ = 350 K,And from the Moessbauer factor measurements theta/sub E/ = 165 K and theta/sub D/ = 285 K. (autho=r)
Disco’s Revenge: House Music’s Nomadic Memory
Directory of Open Access Journals (Sweden)
Hillegonda C. Rietveld
2011-03-01
Full Text Available This article addresses the role of house music as a nomadic archival institution, constituted by the musical history of disco, invigorating this dance genre by embracing new production technologies and keeping disco alive through a rhizomic assemblage of its affective memory in the third record of the DJ mix. This exploration will be illustrated through a close analysis of a specific DJ set by a Chicago house music producer, Larry Heard, in the setting of Rotterdam, 2007, in which American house music is recontextualised. Refining the analysis through close attention to one of the tracks played during that particular set, Grand High Priest’s 2006 “Mary Mary”, the analysis shows how DJ and music production practices intertwine to produce a plurality of unstable cultural and musical connections that are temporarily anchored within specific DJ sets. The conceptual framework draws on the work of Deleuze, Guattari and Foucault, as well as Baudrillard’s sense of seduction, with the aim to introduce a fluid notion of mediated nomadic cultural memory, a type of counter-memory, enabled by the third record and thereby to playfully re-imagine the dynamic function of a music archive. Keywords: house music, DJ practices, third record, cultural memory, nomadology
AxiaLIF system: minimally invasive device for presacral lumbar interbody spinal fusion
Directory of Open Access Journals (Sweden)
Rapp SM
2011-08-01
Full Text Available Steven M Rapp1, Larry E Miller2,3, Jon E Block31Michigan Spine Institute, Waterford, MI, USA; 2Miller Scientific Consulting Inc, Biltmore Lake, NC, USA; 3Jon E. Block, Ph.D., Inc., San Francisco, CA, USAAbstract: Lumbar fusion is commonly performed to alleviate chronic low back and leg pain secondary to disc degeneration, spondylolisthesis with or without concomitant lumbar spinal stenosis, or chronic lumbar instability. However, the risk of iatrogenic injury during traditional anterior, posterior, and transforaminal open fusion surgery is significant. The axial lumbar interbody fusion (AxiaLIF system is a minimally invasive fusion device that accesses the lumbar (L4–S1 intervertebral disc spaces via a reproducible presacral approach that avoids critical neurovascular and musculoligamentous structures. Since the AxiaLIF system received marketing clearance from the US Food and Drug Administration in 2004, clinical studies of this device have reported high fusion rates without implant subsidence, significant improvements in pain and function, and low complication rates. This paper describes the design and approach of this lumbar fusion system, details the indications for use, and summarizes the clinical experience with the AxiaLIF system to date.Keywords: AxiaLIF, fusion, lumbar, minimally invasive, presacral
Advances in the physics of radiation oncology - 50 years of contributions by US Medical Physicists
International Nuclear Information System (INIS)
Suntharalingam, N.
2008-01-01
Medical Physicists have a long standing record in the advancement of the discipline of Radiation Oncology, not only in the United States but world-wide, going back to the pre-world war II era. In the United States the contributions of Failla and Quimby, first at Memorial Hospital and then at Columbia University in New York, laid the foundation for the Profession of Medical Physics in the US. Radiation Therapy first used low and high kilovoltage machines for external beam therapy. Radium (Parker) and radon seeds (Quimby) were used for brachytherapy. Subsequently, clinical Van-de-Graaff machines (Trump and Wright) and the Betatron (Kerst, Adams and Skaggs) provided the required photon beams and also made available clinically useful electron beams. The work of John Laughlin, Larry Lanzl, Jacques Ovadia together with Gail Adams and Lester Skaggs, needs to be recognized for their pioneering efforts. With the introduction of Cobalt-60 Teletherapy (Harold Johns and the Canadian Group, Gilbert Fletcher and the MD Anderson Group) and Linear Accelerators (Henry Kaplan and the Stanford Group, and Varian), in the late 1950s ∼ 1960, there was even a greater need for the strong participation of medical physicists, as a useful technical resource to the physicians
Psy-feld: An Innovative Didactic Using the TV Show Seinfeld to Teach Delusional Disorder Subtypes.
Tobia, Anthony; Bisen, Viwek; Zimmerman, Aphrodite; Trenton, Adam; Dix, Ebony; Dobkin, Roseanne
2015-08-01
The primary purpose of this article is to introduce Psy-feld, an innovative didactic used to review mental disorders through discussion of the interpersonal relationships of the fictional characters created in Larry David's situational comedy, Seinfeld. To introduce this novel didactic, several peripheral Seinfeld characters were selected, who while not afflicted with a psychotic disorder, demonstrate traits that serve to facilitate discussion to review the different subtypes of Delusional Disorder. Psy-feld is a 30-min faculty-facilitated didactic where a selected episode of the sitcom allows for review of multidisciplinary content areas considered germane to the practice of psychiatry. At Rutgers-Robert Wood Johnson Medical School, 104 third-year medical students rotated on the Consultation-Liaison Service from July 2011-March 2014 and participated in Psy-feld. Of the 104 students who participated in Psy-feld, 99 completed surveys on the didactic. Students found the didactic to be of high quality, believed it enhanced their learning, and thought that it prepared them for their final SHELF exam. Students also found it enjoyable and preferred the didactic to more traditional forms of teaching such as large group lectures. Psy-feld is an example of an innovative teaching method that medical students found informative in reviewing teaching points of Delusional Disorder.
Bioactive Glasses: Where Are We and Where Are We Going?
Directory of Open Access Journals (Sweden)
Francesco Baino
2018-03-01
Full Text Available Bioactive glasses caused a revolution in healthcare and paved the way for modern biomaterial-driven regenerative medicine. The first 45S5 glass composition, invented by Larry Hench fifty years ago, was able to bond to living bone and to stimulate osteogenesis through the release of biologically-active ions. 45S5-based glass products have been successfully implanted in millions of patients worldwide, mainly to repair bone and dental defects and, over the years, many other bioactive glass compositions have been proposed for innovative biomedical applications, such as soft tissue repair and drug delivery. The full potential of bioactive glasses seems still yet to be fulfilled, and many of today’s achievements were unthinkable when research began. As a result, the research involving bioactive glasses is highly stimulating and requires a cross-disciplinary collaboration among glass chemists, bioengineers, and clinicians. The present article provides a picture of the current clinical applications of bioactive glasses, and depicts six relevant challenges deserving to be tackled in the near future. We hope that this work can be useful to both early-stage researchers, who are moving with their first steps in the world of bioactive glasses, and experienced scientists, to stimulate discussion about future research and discover new applications for glass in medicine.
Bioactive Glasses: Where Are We and Where Are We Going?
Baino, Francesco; Hamzehlou, Sepideh; Kargozar, Saeid
2018-03-19
Bioactive glasses caused a revolution in healthcare and paved the way for modern biomaterial-driven regenerative medicine. The first 45S5 glass composition, invented by Larry Hench fifty years ago, was able to bond to living bone and to stimulate osteogenesis through the release of biologically-active ions. 45S5-based glass products have been successfully implanted in millions of patients worldwide, mainly to repair bone and dental defects and, over the years, many other bioactive glass compositions have been proposed for innovative biomedical applications, such as soft tissue repair and drug delivery. The full potential of bioactive glasses seems still yet to be fulfilled, and many of today's achievements were unthinkable when research began. As a result, the research involving bioactive glasses is highly stimulating and requires a cross-disciplinary collaboration among glass chemists, bioengineers, and clinicians. The present article provides a picture of the current clinical applications of bioactive glasses, and depicts six relevant challenges deserving to be tackled in the near future. We hope that this work can be useful to both early-stage researchers, who are moving with their first steps in the world of bioactive glasses, and experienced scientists, to stimulate discussion about future research and discover new applications for glass in medicine.
Krogmann, David W
2002-01-01
The history of photosynthesis research can be found in original papers and books. However, a special history is available from the prefatory chapters and the personal perspectives of various researchers who published them in several journals over the last 40 years. We have compiled a list of such perspectives published since 1964. Selection is not easy, especially of authors who were not directly engaged in photosynthesis research; some are included for their special insights related to central issues in the study of photosynthesis. Our journal, Photosynthesis Research, contains other valuable historic data in the occasional tributes, obituaries and historical notes, that have been published. Lists of these items are included. This article ends by listing the Nobel prizes related to photosynthesis and the Kettering Awards for Excellence in Photosynthesis Research. Wherever possible, a web page address is provided. The web page addresses have been taken from the article 'Photosynthesis and the Web: 2001' by Larry Orr and Govindjee, available at http://www.life.uiuc.edu/govindjee/photoweb and at http://photoscience.la.asu.edu/photosyn/ photoweb/default.html.When I find a bit of leisureI trifle with my papers.This is one of the lesserfrailities.'- Horace, Satires I, IV.
International Nuclear Information System (INIS)
Albrecht, H.
1997-04-01
Ten different methods for the extraction of tritium from the purge gas of a ceramic blanket are described and evaluated with respect to their applicability for ITER and DEMO. The methods are based on the conditions that the purge gas is composed of helium with an addition of up to 0.1% of H 2 or O 2 and H 2 O to facilitate the release of tritium, and that tritium occurs in the purge gas in two main chemical forms, i.e. HT and HTO. Individual process steps of many methods are identical; in particular, the application of cold traps, molecular sieve beds, and diffusors are proposed in several cases. Differences between the methods arise mainly from the ways in which various process steps are combined and from the operating conditions which are chosen with respect to temperature and pressure. Up to now, none of the methods has been demonstrated to be reliably applicable for the purge gas conditions foreseen for the operation of an ITER blanket test module (or larger ceramic blanket designs such as for DEMO). These conditions are characterized by very high gas flow rates and extremely low concentrations of HT and HTO. Therefore, a proposal has been made (FZK concept) which is expected to have the best potential for applicability to ITER and DEMO and to incorporate the smallest development risk. In this concept, the extraction of tritium and excess hydrogen is accomplished by using a cold trap for freezing out HTO/H 2 O and a 5A molecular sieve bed for the adsorption of HT/H 2 . (orig.) [de
Relations between pH, oxygen partial pressure and growth in cultured cell spheroids.
Carlsson, J; Acker, H
1988-11-15
The pH gradients, oxygen partial-pressure gradients and growth curves were measured for 7 different types of spheroids. Growth curves were measured in liquid overlay culture and thereafter the spheroids were attached to cover glasses and transferred to a chamber for micro-electrode measurements. The spheroids were randomly divided for pH or pO2 measurements which then were made under conditions as identical as possible. The decreases in pO2 and pH, delta pO2 and delta pH were calculated as the difference between the values in the culture medium and the values 200 micron inside the spheroids. Each type of spheroid had a certain relation between delta pO2 and delta pH. The human colon carcinoma HT29, the mouse mammary carcinoma EMT6 and the hamster lung V79-379A spheroids had high values of the quotient delta pO2/delta pH. The human thyroid carcinoma HTh7 spheroids and the 3 types of human glioma spheroids had lower quotients. There was a tendency for fast-growing spheroids to have high quotients. Two extreme types of spheroids, HT29 (high quotient) and U-118 MG (low quotient) were analyzed for lactate production and oxygen consumption. The U-118 MG spheroids produced about 3 times more lactate and consumed about 3 times less oxygen than the HT29 spheroids. The differences in lactate production could not be explained by differences in the pyruvate Km values of lactate dehydrogenase. The results indicate that there are significant metabolic differences between the spheroid systems studied.
Magnesium-rich Basalts on Mercury
Martel, L. M. V.
2013-05-01
X-ray and gamma-ray spectrometers on NASA's MESSENGER spacecraft are making key measurements regarding the composition and properties of the surface of Mercury, allowing researchers to more clearly decipher the planet's formation and geologic history. The origin of the igneous rocks in the crust of Mercury is the focus of recent research by Karen Stockstill-Cahill and Tim McCoy (National Museum of Natural History, Smithsonian Institution), along with Larry Nittler and Shoshana Weider (Carnegie Institution of Washington) and Steven Hauck II (Case Western Reserve University). Using the well-known MELTS computer code Stockstill-Cahill and coauthors worked with MESSENGER-derived and rock-analog compositions to constrain petrologic models of the lavas that erupted on the surface of Mercury. Rock analogs included a partial melt of the Indarch meteorite and a range of Mg-rich terrestrial rocks. Their work shows the lavas on Mercury are most similar to terrestrial magnesian basalt (with lowered FeO content). The implications of the modeling are that Mg-rich lavas came from high-temperature sources in Mercury's mantle and erupted at high temperature with exceptionally low viscosity into thinly bedded and laterally extensive flows, concepts open to further evaluation by laboratory experiments and by geologic mapping of Mercury's surface using MESSENGER's imaging system and laser altimeter to document flow features and dimensions.
CONTEMPORARY DIGITAL TECHNOLOGIES AND INNOVATIONS IN HUMAN INTELLIGENCE
Directory of Open Access Journals (Sweden)
Riabtseva, N.K.
2017-09-01
Full Text Available New digital technologies not only “change language” (David Cristal, but also “upgrade” human intelligence making it perform new and uncommon operations. The present paper is an analysis and a survey of most prominent innovations in human intelligence, which are instigated by the latest digital information technologies. These innovations include, according to the point of view of outstanding specialists in contemporary digital technologies, such operations as multitasking, serendipity, connectivity, hypermodality, visuality, and cybersemiotic convergence of objective and virtual reality. The paper is based on the data presented in the publications of such outstanding “digital” specialists as Larry Rosen, Jay David Bolter, Steven Downes, Jay Lemke, Gunther Kress, Soren Brier, etc. In their works they particularly stress the impact of digital technologies and internet communication on all spheres of human activities, their role in the inner psychological and mental states, in professional and educational domain, as well as the importance of their investigation and a gap between the intensive development of digital technologies and their insufficient usage in scientific, didactic, social and cultural life. Special attention in the paper focuses on the tendency towards visualization in the global information flows and its role in information processing and knowledge transfer. The paper particularly stresses the fact that the impact of contemporary digital technologies on all spheres of human activities, including the intellectual one, needs further and profound investigation.
PI in the sky: The astronaut science advisor on SLS-2
Hazelton, Lyman R.; Groleau, Nicolas; Frainier, Richard J.; Compton, Michael M.; Colombano, Silvano P.; Szolovits, Peter
1994-01-01
The Astronaut Science Advisor (ASA, also known as Principal-Investigator-in-a-Box) is an advanced engineering effort to apply expert systems technology to experiment monitoring and control. Its goal is to increase the scientific value of information returned from experiments on manned space missions. The first in-space test of the system will be in conjunction with Professor Larry Young's (MIT) vestibulo-ocular 'Rotating Dome' experiment on the Spacelab Life Sciences 2 mission (STS-58) in the Fall of 1993. In a cost-saving effort, off-the-shelf equipment was employed wherever possible. Several modifications were necessary in order to make the system flight-worthy. The software consists of three interlocking modules. A real-time data acquisition system digitizes and stores all experiment data and then characterizes the signals in symbolic form; a rule-based expert system uses the symbolic signal characteristics to make decisions concerning the experiment; and a highly graphic user interface requiring a minimum of user intervention presents information to the astronaut operator. Much has been learned about the design of software and user interfaces for interactive computing in space. In addition, we gained a great deal of knowledge about building relatively inexpensive hardware and software for use in space. New technologies are being assessed to make the system a much more powerful ally in future scientific research in space and on the ground.
Brotherton, M.
2004-12-01
My first science fiction novel, Star Dragon, just recently available in paperback from Tor, features a voyage to the cataclysmic variable star system SS Cygni. My second novel, Spider Star, to appear early in 2006, takes place in and around a dark matter ``planet'' orbiting a neutron star. Both novels are ``hard'' science fiction, relying on accurate physics to inform the tales. It's possible to bring to life abstract concepts like special relativity, and alien environments like accretion disks, by using science fiction. Novels are difficult to use in a science class, but short stories offer intriguing possibilities. I'm planning to edit an anthology of hard science fiction stories that contain accurate science and emphasize fundamental ideas in modern astronomy. The working title is Diamonds in the Sky. The collection will be a mix of original stories and reprints, highlighting challenging concepts covered in a typical introductory astronomy course. Larry Niven's classic story, ``Neutron Star," is an excellent demonstration of extreme tidal forces in an astronomical context. Diamonds in the Sky will include forewards and afterwards to the stories, including discussion questions and mathematical formulas/examples as appropriate. I envision this project will be published electronically or through a print-on-demand publisher, providing long-term availabilty and keeping low cost. I encourage interested parties to suggest previously published stories, or to suggest which topics must be included.
The VIII International Congress on Stress Proteins in Biology and Medicine: täynnä henkeä.
Bonorino, Cristina; Sistonen, Lea; Eriksson, John; Mezger, Valérie; Santoro, Gabriella; Hightower, Lawrence E
2018-03-01
About 150 international scientists gathered in Turku, Finland, in August of 2017 for the eighth in a series of international congresses about the roles of stress proteins in biology and medicine. The scientific theme and title of the 2017 Congress was "Stress Management Mechanisms and Pathways." The meeting covered a broad range of topics, reflecting the wide scope of the Cell Stress Society International (CSSI) and highlighting the numerous recent breakthroughs in stress response biology and medicine. The keynote lecturers included Marja Jäättelä, Richard Morimoto, Anne Bertolotti, and Peter Walter. The Executive Council of the CSSI elected new Fellows and Senior Fellows. The Spirit of Budapest Award was presented to Peter Csermely, Wolfgang Schumann, and Subhash Lakhotia in recognition of pioneering service contributions to the CSSI. The CSSI Medallion for Career Achievement was awarded to Larry Hightower and CSSI president Gabriella Santoro proclaimed Tuesday, August 15, 2017, Robert M. Tanguay Day at the congress in recognition of Robert's many years of scientific accomplishment and work on behalf of the CSSI. Additional special events were the awarding of the Ferruccio Ritossa Early Career Award to Serena Carra and the Alfred Tissières Young Investigator Award to Ayesha Murshid. As is the tradition at CSSI congresses, there were social events that included an exciting piano performance by a trio of young Finnish pianists, at the Sibelius Museum.
Subramoni, Sujatha; Florez Salcedo, Diana Vanessa; Suarez-Moreno, Zulma R.
2015-01-01
LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal) and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal), but are not associated with a cognate N-acyl homoserine lactone (AHL) synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs) available in the InterPro database (IPR005143), and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information. PMID:25759807
Subramoni, Sujatha; Florez Salcedo, Diana Vanessa; Suarez-Moreno, Zulma R
2015-01-01
LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal) and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal), but are not associated with a cognate N-acyl homoserine lactone (AHL) synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs) available in the InterPro database (IPR005143), and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information.
Directory of Open Access Journals (Sweden)
Sujatha eSubramoni
2015-02-01
Full Text Available LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal, but are not associated with a cognate N-acyl homoserine lactone (AHL synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs available in the InterPro database (IPR005143, and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information.
The effect of thermal treatment on the fracture properties of alloy X-750 in aqueous environments
International Nuclear Information System (INIS)
Ballinger, R.; Elliott, C.S.; Hwang, I.S.; Prybylowski, J.
1993-05-01
Alloy X-750 is a high strength, age hardenable nickel-base alloy used in light water nuclear reactors. The excellent corrosion resistance and high temperature strength of alloy X-750 make it suitable for use in a variety of structure components in both pressurized water reactors and boiling water reactors. These applications involve exposure of highly stressed material to aqueous media. Operational stresses are subject to low frequency thermally induced fluctuations and high frequency flow induced fluctuations. In general, alloy X-750 has performed well in light water reactors. However, an economically significant number of components have failed unexpectedly due to localized forms of attack such as corrosion fatigue and stress corrosion cracking. Thermal processing history is known to play a significant role in the fracture properties of alloy X-750 in aqueous environments. While thermal treatments have been developed recently to improve performance, in many cases the reason for improved performance remains unclear. Therefore, identification of the mechanisms responsible for the degradation of fracture properties in aqueous environments is necessary. As a corollary it is necessary to achieve an understanding of how thermal treatment influences microstructure and, in turn, how microstructure influences fracture properties in aqueous environments. This report discusses five thermal treatments which were studied: (1) SA-1 hr at 1093 degree C, (2) AH - 24 hr at 885 degree C + 20 hr at 704 degree C, (3) HTH - 1 hr at 1093 degree C + 20 hr at 704 degree C, (4) AHTH - 1 hr at 1093 degree C + 24 hr at 885 degree C + 20 hr at 704 degree C, and (5) HOA - 1 hr at 1093 degree C + 100 hrs at 760 degree C. Microstructural characterization of these materials was accomplished through the use of optical microscopy, transmission electron microscopy,scanning transmission electron microscopy, energy dispersive x-ray spectroscopy, and x-ray diffractometry
Tritium effluent control project progress report, July--September 1975
International Nuclear Information System (INIS)
Kershner, C.J.; Bixel, J.C.
1976-01-01
In the Tritiated Liquid Waste Decontamination (Molecular Excitation) program, it was found that a 1/4'' Nd:YAG amplifier and a Faraday rotator isolator must be added to the oscillator to obtain the required power for the laser excitation experiments. The isotopic selectivity of the two-photon dissociation process was examined in more detail. The selectivity or ratio of HTO to H 2 O molecules that are photodissociated was found to be on the order of 25, which is inadequate for application to large-scale detritiation projects, e.g., nuclear fuel reprocessing plant waste. The selectivity is such that most of the laser energy is wasted in photodissociation of H 2 O. This obstacle may be overcome by pumping more vibrational energy into the HTO molecules. Various schemes towards this end are being considered. Extensive ab initio calculations on the potential surface for the hydrogen atom-water exchange reaction have been carried out. The energy barrier is calculated to be 38 1/2 kcal/mole, which implies that the exchange reaction T + H 2 O → HTO + H is at least 10 9 times slower than the exchange reaction T + H 2 → HT + H. Calculations were also performed on the analogous hydrogen atom-hydrogen fluoride exchange reaction. In lieu of other disposal methods a system using a General Electric UCT-1 regenerative cell has been assembled and tested. This system should be capable of decomposing pure water into hydrogen and oxygen gases. The tritium from this process can be purified and reused instead of buried. A preliminary economic evaluation was made of the HT/H 2 O catalytic exchange detritiation stripping process as it might apply to a 5 metric ton/day nuclear fuel reprocessing plant. A tritiated water shipping container has been designed and developed for use with the ERDA--DOT approved AL--MI secondary container
Keyamura, Kenji; Katayama, Tsutomu
2011-08-19
Chromosomal replication is initiated from the replication origin oriC in Escherichia coli by the active ATP-bound form of DnaA protein. The regulatory inactivation of DnaA (RIDA) system, a complex of the ADP-bound Hda and the DNA-loaded replicase clamp, represses extra initiations by facilitating DnaA-bound ATP hydrolysis, yielding the inactive ADP-bound form of DnaA. However, the mechanisms involved in promoting the DnaA-Hda interaction have not been determined except for the involvement of an interaction between the AAA+ domains of the two. This study revealed that DnaA Leu-422 and Pro-423 residues within DnaA domain IV, including a typical DNA-binding HTH motif, are specifically required for RIDA-dependent ATP hydrolysis in vitro and that these residues support efficient interaction with the DNA-loaded clamp·Hda complex and with Hda in vitro. Consistently, substitutions of these residues caused accumulation of ATP-bound DnaA in vivo and oriC-dependent inhibition of cell growth. Leu-422 plays a more important role in these activities than Pro-423. By contrast, neither of these residues is crucial for DNA replication from oriC, although they are highly conserved in DnaA orthologues. Structural analysis of a DnaA·Hda complex model suggested that these residues make contact with residues in the vicinity of the Hda AAA+ sensor I that participates in formation of a nucleotide-interacting surface. Together, the results show that functional DnaA-Hda interactions require a second interaction site within DnaA domain IV in addition to the AAA+ domain and suggest that these interactions are crucial for the formation of RIDA complexes that are active for DnaA-ATP hydrolysis.
Keyamura, Kenji; Katayama, Tsutomu
2011-01-01
Chromosomal replication is initiated from the replication origin oriC in Escherichia coli by the active ATP-bound form of DnaA protein. The regulatory inactivation of DnaA (RIDA) system, a complex of the ADP-bound Hda and the DNA-loaded replicase clamp, represses extra initiations by facilitating DnaA-bound ATP hydrolysis, yielding the inactive ADP-bound form of DnaA. However, the mechanisms involved in promoting the DnaA-Hda interaction have not been determined except for the involvement of an interaction between the AAA+ domains of the two. This study revealed that DnaA Leu-422 and Pro-423 residues within DnaA domain IV, including a typical DNA-binding HTH motif, are specifically required for RIDA-dependent ATP hydrolysis in vitro and that these residues support efficient interaction with the DNA-loaded clamp·Hda complex and with Hda in vitro. Consistently, substitutions of these residues caused accumulation of ATP-bound DnaA in vivo and oriC-dependent inhibition of cell growth. Leu-422 plays a more important role in these activities than Pro-423. By contrast, neither of these residues is crucial for DNA replication from oriC, although they are highly conserved in DnaA orthologues. Structural analysis of a DnaA·Hda complex model suggested that these residues make contact with residues in the vicinity of the Hda AAA+ sensor I that participates in formation of a nucleotide-interacting surface. Together, the results show that functional DnaA-Hda interactions require a second interaction site within DnaA domain IV in addition to the AAA+ domain and suggest that these interactions are crucial for the formation of RIDA complexes that are active for DnaA-ATP hydrolysis. PMID:21708944
Wolfe, Marlene K; Gallandat, Karin; Daniels, Kyle; Desmarais, Anne Marie; Scheinman, Pamela; Lantagne, Daniele
2017-01-01
To prevent Ebola transmission, frequent handwashing is recommended in Ebola Treatment Units and communities. However, little is known about which handwashing protocol is most efficacious. We evaluated six handwashing protocols (soap and water, alcohol-based hand sanitizer (ABHS), and 0.05% sodium dichloroisocyanurate, high-test hypochlorite, and stabilized and non-stabilized sodium hypochlorite solutions) for 1) efficacy of handwashing on the removal and inactivation of non-pathogenic model organisms and, 2) persistence of organisms in rinse water. Model organisms E. coli and bacteriophage Phi6 were used to evaluate handwashing with and without organic load added to simulate bodily fluids. Hands were inoculated with test organisms, washed, and rinsed using a glove juice method to retrieve remaining organisms. Impact was estimated by comparing the log reduction in organisms after handwashing to the log reduction without handwashing. Rinse water was collected to test for persistence of organisms. Handwashing resulted in a 1.94-3.01 log reduction in E. coli concentration without, and 2.18-3.34 with, soil load; and a 2.44-3.06 log reduction in Phi6 without, and 2.71-3.69 with, soil load. HTH performed most consistently well, with significantly greater log reductions than other handwashing protocols in three models. However, the magnitude of handwashing efficacy differences was small, suggesting protocols are similarly efficacious. Rinse water demonstrated a 0.28-4.77 log reduction in remaining E. coli without, and 0.21-4.49 with, soil load and a 1.26-2.02 log reduction in Phi6 without, and 1.30-2.20 with, soil load. Chlorine resulted in significantly less persistence of E. coli in both conditions and Phi6 without soil load in rinse water (phand hygiene in Ebola contexts, considering the potential benefit of chlorine-based methods in rinse water persistence.
Directory of Open Access Journals (Sweden)
Catarina Lopes Santos
Full Text Available LuxR regulators are a widely studied group of bacterial helix-turn-helix (HTH transcription factors involved in the regulation of many genes coding for important traits at an ecological and medical level. This regulatory family is particularly known by their involvement in quorum-sensing (QS mechanisms, i.e., in the bacterial ability to communicate through the synthesis and binding of molecular signals. However, these studies have been mainly focused on gram-negative organisms, and the presence of LuxR regulators in the gram-positive Actinobacteria phylum is still poorly explored. In this manuscript, the presence of LuxR regulators among Actinobacteria was assayed using a domain-based strategy. A total of 991 proteins having one LuxR domain were identified in 53 genome-sequenced actinobacterial species, of which 59% had an additional domain. In most cases (53% this domain was REC (receiver domain, suggesting that LuxR regulators in Actinobacteria may either function as single transcription factors or as part of two-component systems. The frequency, distribution and evolutionary stability of each of these sub-families of regulators was analyzed and contextualized regarding the ecological niche occupied by each organism. The results show that the presence of extra-domains in the LuxR-regulators was likely driven by a general need to physically uncouple the signal sensing from the signal transduction. Moreover, the total frequency of LuxR regulators was shown to be dependent on genetic, metabolic and ecological variables. Finally, the functional annotation of the LuxR regulators revealed that the bacterial ecological niche has biased the specialization of these proteins. In the case of pathogens, our results suggest that LuxR regulators can be involved in virulence and are therefore promising targets for future studies in the health-related biotechnology field.
Directory of Open Access Journals (Sweden)
Jean-Michel Carter
Full Text Available The maternal effect genes responsible for patterning the embryo along the antero-posterior (AP axis are broadly conserved in insects. The precise function of these maternal effect genes is the result of the localisation of their mRNA in the oocyte. The main developmental mechanisms involved have been elucidated in Drosophila melanogaster, but recent studies have shown that other insect orders often diverge in RNA localisation patterns. A recent study has shown that in the butterfly Pararge aegeria the distinction between blastodermal embryonic (i.e. germ band and extra-embryonic tissue (i.e. serosa is already specified in the oocyte during oogenesis in the ovariole, long before blastoderm cellularisation. To examine the extent by which a female butterfly specifies and patterns the AP axis within the region fated to be the germ band, and whether she specifies a germ plasm, we performed in situ hybridisation experiments on oocytes in P. aegeria ovarioles and on early embryos. RNA localisation of the following key maternal effect genes were investigated: caudal (cad, orthodenticle (otd, hunchback (hb and four nanos (nos paralogs, as well as TDRD7 a gene containing a key functional domain (OST-HTH/LOTUS shared with oskar. TDRD7 was mainly confined to the follicle cells, whilst hb was exclusively zygotically transcribed. RNA of some of the nos paralogs, otd and cad revealed complex localisation patterns within the cortical region prefiguring the germ band (i.e. germ cortex. Rather interestingly, otd was localised within and outside the anterior of the germ cortex. Transcripts of nos-O formed a distinct granular ring in the middle of the germ cortex possibly prefiguring the region where germline stem cells form. These butterfly RNA localisation patterns are highly divergent with respect to other insects, highlighting the diverse ways in which different insect orders maternally regulate early embryogenesis of their offspring.
Carter, Jean-Michel; Gibbs, Melanie; Breuker, Casper J.
2015-01-01
The maternal effect genes responsible for patterning the embryo along the antero-posterior (AP) axis are broadly conserved in insects. The precise function of these maternal effect genes is the result of the localisation of their mRNA in the oocyte. The main developmental mechanisms involved have been elucidated in Drosophila melanogaster, but recent studies have shown that other insect orders often diverge in RNA localisation patterns. A recent study has shown that in the butterfly Pararge aegeria the distinction between blastodermal embryonic (i.e. germ band) and extra-embryonic tissue (i.e. serosa) is already specified in the oocyte during oogenesis in the ovariole, long before blastoderm cellularisation. To examine the extent by which a female butterfly specifies and patterns the AP axis within the region fated to be the germ band, and whether she specifies a germ plasm, we performed in situ hybridisation experiments on oocytes in P. aegeria ovarioles and on early embryos. RNA localisation of the following key maternal effect genes were investigated: caudal (cad), orthodenticle (otd), hunchback (hb) and four nanos (nos) paralogs, as well as TDRD7 a gene containing a key functional domain (OST-HTH/LOTUS) shared with oskar. TDRD7 was mainly confined to the follicle cells, whilst hb was exclusively zygotically transcribed. RNA of some of the nos paralogs, otd and cad revealed complex localisation patterns within the cortical region prefiguring the germ band (i.e. germ cortex). Rather interestingly, otd was localised within and outside the anterior of the germ cortex. Transcripts of nos-O formed a distinct granular ring in the middle of the germ cortex possibly prefiguring the region where germline stem cells form. These butterfly RNA localisation patterns are highly divergent with respect to other insects, highlighting the diverse ways in which different insect orders maternally regulate early embryogenesis of their offspring. PMID:26633019
International Nuclear Information System (INIS)
Ribeiro, Franclim Ricardo; Meireles, Ana Margarida; Rocha, Ana Sofia; Teixeira, Manuel Rodrigues
2008-01-01
Cell lines are often poorly characterized from a genetic point of view, reducing their usefulness as tumor models. Our purpose was to assess the genetic background of eight commonly used human thyroid carcinoma models and to compare the findings with those reported for primary tumors of the gland. We used chromosome banding analysis and comparative genomic hybridization to profile eight non-medullary thyroid carcinoma cell lines of papillary (TPC-1, FB2, K1 and B-CPAP), follicular (XTC-1) or anaplastic origin (8505C, C643 and HTH74). To assess the representativeness of the findings, we additionally performed a thorough review of cytogenetic (n = 125) and DNA copy number information (n = 270) available in the literature on clinical samples of thyroid carcinoma. The detailed characterization of chromosomal markers specific for each cell line revealed two cases of mistaken identities: FB2 was shown to derive from TPC-1 cells, whereas K1 cells have their origin in cell line GLAG-66. All cellular models displayed genomic aberrations of varying complexity, and recurrent gains at 5p, 5q, 8q, and 20q (6/7 cell lines) and losses at 8p, 13q, 18q, and Xp (4/7 cell lines) were seen. Importantly, the genomic profiles were compatible with those of the respective primary tumors, as seen in the meta-analysis of the existing literature data. We provide the genomic background of seven independent thyroid carcinoma models representative of the clinical tumors of the corresponding histotypes, and highlight regions of recurrent aberrations that may guide future studies aimed at identifying target genes. Our findings further support the importance of routinely performing cytogenetic studies on cell lines, to detect cross-contamination mishaps such as those identified here
Santos, Catarina Lopes; Correia-Neves, Margarida; Moradas-Ferreira, Pedro; Mendes, Marta Vaz
2012-01-01
LuxR regulators are a widely studied group of bacterial helix-turn-helix (HTH) transcription factors involved in the regulation of many genes coding for important traits at an ecological and medical level. This regulatory family is particularly known by their involvement in quorum-sensing (QS) mechanisms, i.e., in the bacterial ability to communicate through the synthesis and binding of molecular signals. However, these studies have been mainly focused on Gram-negative organisms, and the presence of LuxR regulators in the Gram-positive Actinobacteria phylum is still poorly explored. In this manuscript, the presence of LuxR regulators among Actinobacteria was assayed using a domain-based strategy. A total of 991 proteins having one LuxR domain were identified in 53 genome-sequenced actinobacterial species, of which 59% had an additional domain. In most cases (53%) this domain was REC (receiver domain), suggesting that LuxR regulators in Actinobacteria may either function as single transcription factors or as part of two-component systems. The frequency, distribution and evolutionary stability of each of these sub-families of regulators was analyzed and contextualized regarding the ecological niche occupied by each organism. The results show that the presence of extra-domains in the LuxR-regulators was likely driven by a general need to physically uncouple the signal sensing from the signal transduction. Moreover, the total frequency of LuxR regulators was shown to be dependent on genetic, metabolic and ecological variables. Finally, the functional annotation of the LuxR regulators revealed that the bacterial ecological niche has biased the specialization of these proteins. In the case of pathogens, our results suggest that LuxR regulators can be involved in virulence and are therefore promising targets for future studies in the health-related biotechnology field. PMID:23056438
Directory of Open Access Journals (Sweden)
Juan Carlos Fernicola
2011-06-01
Full Text Available En septiembre de 1887, Carlos Ameghino, Ayudante Preparador de Paleontología del Museo de La Plata, retornaba de una fructífera expedición a las barrancas del río Santa Cruz, encomendada por el Director de dicha institución, Francisco P. Moreno. Hacia fines de ese año, Florentino Ameghino, Secretario Subdirector del Museo de La Plata, dio a conocer dichos hallazgos describiendo sucintamente 122 taxones de los cuales 110 eran nuevas especies. Al poco tiempo, Florentino era exonerado del Museo, negándosele el acceso a las colecciones. No obstante, en 1889 Ameghino amplió sus descripciones y figuró 74 de los taxones de 1887. En 1891 Florentino Ameghino explicó que sus descripciones y figuras de 1889 se basaron en apuntes y croquis realizados antes de ser exonerado. Llamativamente, muchos de los ejemplares figurados se encuentran depositados en la Colección Naci onal Ameghino, alojada en el Museo Argentino de Ciencias Naturales "Bernardino Rivadavia". En 1980, basándose en este impensado destino de los fósiles, Larry Marshall concluyó que Florentino Ameghino se habría apropiado de una parte de la colección de 1887 y sobre ésta basó su obra de 1889. Las evidencias aquí presentadas avalan la apropiación de ejemplares propuesta por Marshall y brinda un marco de referencia para evaluar la conformación de las series tipo de las especies de 1887. Por último, revelan de que forma el contexto histórico, la competencia entre instituciones y los anhelos personales se conjugaron para romper lo que debió haber sido una asociación científica de excelencia.In September 1887, Carlos Ameghino, Assistant Preparator of Paleontology at the Museo de La Plata, returned to the museum after a successful expedition to the banks of the Santa Cruz River. He had been commissioned by the director of this institution, Francisco P. Moreno, to carry out this fieldwork. By the end of that year, Florentino Ameghino, Assistant Director of the museum
International Nuclear Information System (INIS)
Lindl, J.D.
1993-12-01
In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John's seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program. I have had the good fortune of working with an outstanding team of scientists who have established LLNL as the premier ICF laboratory in the world. John Emmett and the LLNL Laser Science team were responsible for developing a series of lasers from Janus to Nova which have given LLNL unequaled facilities. George Zimmerman and the LASNEX group developed the numerical models essential for projecting future performance and requirements as well as for designing and analyzing the experiments. Bill Kruer, Bruce Langdon and others in the plasma theory group developed the fundamental understanding of laser plasma interactions which have played such an important role in ICF. And a series of experiment program leaders including Mike Campbell and Joe Kilkenny and their laser experimental teams developed the experimental techniques and diagnostic capabilities which have allowed us to c increasingly complex and sophisticated experiments
Energy Technology Data Exchange (ETDEWEB)
Lindl, J.D.
1993-12-01
In 1972, I joined the Livermore ICF Theory and Target Design group led by John Nuckolls, shortly after publication of John`s seminal Nature article on ICF. My primary role, working with others in the target design program including Mordy Rosen, Steve Haan, and Larry Suter, has been as a target designer and theorist who utilized the LASNEX code to perform numerical experiments, which along with analysis of laboratory and underground thermonuclear experiments allowed me to develop a series of models and physical insights which have been used to set the direction and priorities of the Livermore program. I have had the good fortune of working with an outstanding team of scientists who have established LLNL as the premier ICF laboratory in the world. John Emmett and the LLNL Laser Science team were responsible for developing a series of lasers from Janus to Nova which have given LLNL unequaled facilities. George Zimmerman and the LASNEX group developed the numerical models essential for projecting future performance and requirements as well as for designing and analyzing the experiments. Bill Kruer, Bruce Langdon and others in the plasma theory group developed the fundamental understanding of laser plasma interactions which have played such an important role in ICF. And a series of experiment program leaders including Mike Campbell and Joe Kilkenny and their laser experimental teams developed the experimental techniques and diagnostic capabilities which have allowed us to c increasingly complex and sophisticated experiments.
Directory of Open Access Journals (Sweden)
Giacomo Boitani
2014-12-01
Full Text Available ‘Il pareggio elettorale è la vita’: Boris e la satira dei mass media italiani e dell’industria culturale odierni Nel 2007 il network satellitare Fox Italia ha cominciato la produzione di Boris, una serie comica del genere mockumentary messa in onda sui canali Sky Italia dal 2007 al 2010. La trama di Boris narra le peripezie di una troupe televisiva alle prese con la produzione di una soap-opera per la RAI. In Italia la serie è presto diventata un prodotto ‘cult’. Nella serie Boris i pigri e opportunisti membri della troupe televisiva fittizia sono rappresentati come succubi delle ripercussioni che gli sviluppi politici nel Paese hanno sul servile network per il quale lavorano. Gli attori nella soap-opera fittizia vengono rimpiazzati e la trama stessa della soap-opera viene riscritta a seconda delle nuove coalizioni che vengono formate in Parlamento e i membri della troupe sono costantemente alla ricerca di raccomandazioni e protezione politica. Per quanto satirizza lo stato del Paese, Boris mette anche in discussione il fatto stesso che l’industria culturale Italiana corrente possa produrre un discorso significativo. Con riferimento alla teorizzazione della ‘parodia’ da parte di Linda Hutcheon, questo articolo discute la rappresentazione che Boris ha tratteggiato dell’industria culturale, analizza il rapporto esistente tra la serie e tradizioni comiche Italiane che l’hanno preceduta (la ‘commedia all’italiana’ e il modo in cui l’ironia implementata dalla serie ricalca e/o diverge da quella tipica delle serie mockumentary estere che l’hanno ispirata (Arrested Development e The Larry Sanders Show.
Update on the usage and safety of epinephrine auto-injectors, 2017
Directory of Open Access Journals (Sweden)
Posner LS
2017-03-01
Full Text Available Larry S Posner,1 Carlos A Camargo Jr2 1North Bay Allergy and Asthma Associates, Inc., Napa, CA, 2Department of Emergency Medicine, Massachusetts General Hospital, Harvard Medical School, Boston, MA, USA Abstract: Anaphylaxis is a serious, potentially fatal allergic reaction. Guidelines recommend prompt intramuscular injections of epinephrine as the first-line therapy for anaphylaxis. Delayed epinephrine treatment may cause undesirable clinical outcomes, including death. In the community, epinephrine auto-injectors (EAIs are commonly used to treat anaphylaxis. This literature review examines several recent concerns regarding the safety of EAIs that may prevent the timely administration of epinephrine. Reports of cardiovascular complications are linked with epinephrine administration, although recent studies suggest that these events are much more commonly associated with intravenous epinephrine rather than with EAIs. Recent studies have also highlighted accidental injections of EAIs in patients’ or caregivers’ fingers and lacerations associated with the use of EAI in children. However, the data suggest that both accidental injections and lacerations are rare and require limited medical intervention. In addition, patients may receive conflicting information on the safety and efficacy of using expired EAIs. Overall, it is believed that the benefits of using EAIs far outweigh the potential risks of not administering an EAI. Although legitimate safety concerns are associated with EAIs, adverse events are rare. Continued training of medical providers, caregivers, and patients may be beneficial to address these concerns and reduce EAI-associated injuries while ensuring that patients receive necessary medical care. Keywords: allergy, anaphylaxis, asthma, pediatrics
Directory of Open Access Journals (Sweden)
Clifford AG
2013-05-01
Full Text Available Anton G Clifford,1 Stefan M Gabriel,1 Mary O’Connell,1 David Lowe,1 Larry E Miller,2,3 Jon E Block31Moximed, Inc, Hayward, CA, USA; 2Miller Scientific Consulting, Inc, Arden, NC, USA; 3The Jon Block Group, San Francisco, CA, USAAbstract: Symptomatic medial compartment knee osteoarthritis (OA is the leading cause of musculoskeletal pain and disability in adults. Therapies intended to unload the medial knee compartment have yielded unsatisfactory results due to low patient compliance with conservative treatments and high complication rates with surgical options. There is no widely available joint-unloading treatment for medial knee OA that offers clinically important symptom alleviation, low complication risk, and high patient acceptance. The KineSpring® Knee Implant System (Moximed, Inc, Hayward, CA, USA is a first-of-its-kind, implantable, extra-articular, extra-capsular prosthesis intended to alleviate knee OA-related symptoms by reducing medial knee compartment loading while overcoming the limitations of traditional joint-unloading therapies. Preclinical and clinical studies have demonstrated excellent prosthesis durability, substantial reductions in medial compartment and total joint loads, and clinically important improvements in OA-related pain and function. The purpose of this report is to describe the KineSpring System, including implant characteristics, principles of operation, indications for use, patient selection criteria, surgical technique, postoperative care, preclinical testing, and clinical experience. The KineSpring System has potential to bridge the gap between ineffective conservative treatments and irreversible surgical interventions for medial compartment knee OA.Keywords: KineSpring, knee, medial, osteoarthritis, prosthesis
Suno, Manabu; Yoshida, Toshiko; Koyama, Toshihiro; Zamami, Yoshito; Miyoshi, Tomoko; Mizushima, Takaaki; Tanimoto, Mitsune
2013-01-01
The concept of Team-Based Learning (TBL) was developed in the late 1970s by Larry Michaelsen, who wanted students to enjoy the benefits of small group learning within large classes in the business school environment. In contrast to problem-based learning (PBL), which is student centered, TBL is typically instructor centered. Recently, TBL is being used as a teaching method in over 60 health science professional schools in the US and other countries. In the present study, the impact of adopting TBL in teaching pharmaceutical care practices to students was evaluated. Students were required to answer a set of multiple-choice questions individually in individual readiness assessment test (IRAT) before the TBL sessions to assess their level of preparation. The same set of questions was then reattempted by the group readiness assessment test (GRAT) during TBL. Comparing the scores obtained in the GRAT and IRAT before the first TBL session, the scores from the GRAT were always higher than those of the IRAT, indicating that TBL has encouraged active learning. In addition, students were surveyed about their level of satisfaction with TBL and written comments about TBL were solicited. The results of the questionnaire showed that 87.3±9.3% of the students were satisfied. Moreover, no student commented that TBL was in any way inferior to the PBL. Implementation of a TBL approach was successfully integrated into the pharmaceutical care education course. In order to further improve the usefulness of TBL in teaching pharmaceutical care, a hybrid teaching approach that also comprises PBL and a lecture-based course is desirable.
How NASA's Space Science Support Network Can Assist DPS Members in Their Public Engagement Efforts
Miner, E. D.; Lowes, L. L.
2003-12-01
In her Carl Sagan Medal lecture last year, Heidi Hammel talked of the dos and don'ts of education and public outreach efforts by DPS members. She pointed out a number of misconceptions about what does and does not constitute "good EPO" and encouraged members to consult with "the experts" if they would like to improve their EPO effectiveness and reach. She named the DPS Education and Public Outreach Officer, Larry Lebofsky, his Deputy, Lou Mayo, and the DPS Press Officer, Ellis Miner, who also co-directs NASA's Solar System Exploration EPO Forum with Leslie Lowes. NASA's Space Science Support Network has been in existence for about six years. It has been directed by DPS member Jeff Rosendhal and is now serving as a model for NASA's new Education Enterprise. Members of the Support Network are prepared to assist (and haves been assisting) space scientists throughout the US and abroad in deciding where to spend their EPO efforts most effectively. The service is provided free of cost and includes, among other services, the following: (1) helping to establish partnerships between educators and scientists, (2) helping to link scientists and professional EPO organizations, (3) helping to link scientists to national youth and community groups, (4) providing ready access to EPO electronic and hardcopy products, (5) providing advice and direction in the preparation of EPO proposals to NASA, (6) helping to maintain several national networks of EPO volunteers, (7) encouraging (at home institutions) the broadening of scientist EPO efforts, (8) maintaining self-help websites for scientists interested in EPO.
Habitat Evaluation Procedures (HEP) Report; Burlington Bottoms, Technical Report 1993-2003.
Energy Technology Data Exchange (ETDEWEB)
Beilke, Susan
1993-08-01
Burlington Bottoms, consisting of approximately 417 acres of riparian and wetland habitat, was purchased by the Bonneville Power Administration in November 1991. The site is located approximately 1/2 mile north of the Sauvie Island Bridge (T2N R1W Sections 20, 21), and is bound on the east side by Multnomah Channel and on the west side by the Burlington Northern Railroad right-of-way and U.S. Highway 30 (Figures 1 and 2). Wildlife habitat values resulting from the purchase of this site will contribute toward the goal of mitigating for habitat lost as outlined in the Columbia and Willamette River Basin's Fish and Wildlife Program and Amendments. Under this Program, mitigation goals were developed as a result of the loss of wildlife habitat due to the development and operation of Federal hydro-electric facilities in the Columbia and Willamette River Basins. In 1993, an interdisciplinary team was formed to develop and implement quantitative Habitat Evaluation Procedures (HEP) to document the value of various habitats at Burlington Bottoms. Results of the HEP will be used to: (1) determine the current status and habitat enhancement potential of the site consistent with wildlife mitigation goals and objectives; and (2) develop a management plan for the area. HEP participants included; Charlie Craig, BPA; Pat Wright, Larry Rasmussen, and Ron Garst, U. S. Fish and Wildlife Service; John Christy, The Nature Conservancy; and Doug Cottam, Sue Beilke, and Brad Rawls, Oregon Department of Fish and Wildlife.
A New Moon for the Twenty-First Century
Taylor, G. J.
2000-08-01
Thirty years of lunar sample studies supplemented by spotty remote sensing and geophysical data gave us the broad outline of the nature and geologic history of the Moon. Many cherished beliefs are now being questioned on the basis of global data returned by two bargain-basement missions sent to the Moon in the 1990s, Clementine and Lunar Prospector. These data are being integrated with new and old lunar sample data, to give us new, though still controversial, ideas about the nature of the Moon. Two articles in a special section of the Journal of Geophysical Research (Planets) illustrate the point. Brad Jolliff and his colleagues at Washington University in St. Louis, Jeff Gillis, Larry Haskin, Randy Korotev, and Mark Wieczorek (now at the Massachusetts Institute of Technology) divide the Moon's crust into distinct geochemical provinces quite different from the traditional highlands (or terra) and maria. In a separate paper, Randy Korotev presents a detailed analysis of a common rock type among the samples returned by the Apollo missions. This rock type, nicknamed enigmatically "LKFM," was thought by many of us to represent the composition of the lower crust everywhere on the Moon. Korotev argues that it is confined to only one of Jolliff's provinces. If correct, this changes our estimates of the composition of the lunar crust, hence of the entire Moon. Although other lunar scientists will scrutinize these new views of the Moon, it is clear that some long-held ideas about the Moon might be modified significantly, if not tossed out completely.
E-health beyond technology: analyzing the paradigm shift that lies beneath.
Moerenhout, Tania; Devisch, Ignaas; Cornelis, Gustaaf C
2018-03-01
Information and computer technology has come to play an increasingly important role in medicine, to the extent that e-health has been described as a disruptive innovation or revolution in healthcare. The attention is very much focused on the technology itself, and advances that have been made in genetics and biology. This leads to the question: What is changing in medicine today concerning e-health? To what degree could these changes be characterized as a 'revolution'? We will apply the work of Thomas Kuhn, Larry Laudan, Michel Foucault and other philosophers-which offers an alternative understanding of progress and revolution in medicine to the classic discovery-oriented approach-to our analysis. Nowadays, the long-standing curative or reactive paradigm in medicine is facing a crisis due to an aging population, a significant increase in chronic diseases and the development of more expensive diagnostic tools and therapies. This promotes the evolution towards a new paradigm with an emphasis on preventive medicine. E-health constitutes an essential part of this new paradigm that seeks to solve the challenges presented by an aging population, skyrocketing costs and so forth. Our approach changes the focus from the technology itself toward the underlying paradigm shift in medicine. We will discuss the relevance of this approach by applying it to the surge in digital self-tracking through health apps and wearables: the recognition of the underlying paradigm shift leads to a more comprehensive understanding of self-tracking than a solely discovery-oriented or technology-focused view can provide.
Burr, A H Jay; Vidaver, Aaron; Schreiber, Ulrich; Bruce, Doug; Donnelly, Danielle J
2018-06-01
William (Bill) E. Vidaver (February 2, 1921-August 31, 2017), who did his Ph.D. with Laurence (Larry) R. Blinks at Stanford (1964) and a postdoc with C. Stacy French (1965), taught and did research at Simon Fraser University (SFU) for almost 30 years. Here he published over 80 papers in photosynthesis-related areas co-authored by his graduate students, postdocs, visiting professors and SFU colleagues. He developed a unique high-pressure cuvette for the study of oxygen exchange and studied high-pressure effects in photosynthesis. Ulrich (Uli) Schreiber, as a postdoctoral fellow from Germany, introduced measurements on chlorophyll (Chl) a fluorescence to Bill's lab, leading to the discovery of reversible inhibition of excitation energy transfer between photosynthetic pigments and of a pivotal role of O 2 in the oxidation of the electron transport chain between Photosystem II (PS II) and PS I. Bill's and Uli's work led to a patent of a portable chlorophyll fluorometer, the first available commercially, which was later modified to measure whole plantlets. The latter was used in pioneering measurement of the health of forest and crop plants undergoing in vitro clonal micropropagation. With several other researchers (including Doug Bruce, the late Radovan Popovic, and Sarah Swenson), he localized the quenching site of O 2 and showed a dampening effect on measurements of the four-step process of O 2 production by endogenous oxygen uptake. Bill is remembered as a hard-working but fun-loving person with a keen mind and strong sense of social justice.
Directory of Open Access Journals (Sweden)
Yue JJ
2016-05-01
Full Text Available James J Yue,1 Rolando Garcia Jr,2 Larry E Miller3 1Department of Orthopaedic Surgery, Yale School of Medicine, New Haven, CT, 2Orthopedic Care Center, Miami, FL, 3Miller Scientific Consulting, Inc., Asheville, NC, USA Abstract: Degeneration of the lumbar intervertebral discs is a leading cause of chronic low back pain in adults. Treatment options for patients with chronic lumbar discogenic pain unresponsive to conservative management include total disc replacement (TDR or lumbar fusion. Until recently, only two lumbar TDRs had been approved by the US Food and Drug Administration - the Charité Artificial Disc in 2004 and the ProDisc-L Total Disc Replacement in 2006. In June 2015, a next-generation lumbar TDR received Food and Drug Administration approval - the activL® Artificial Disc (Aesculap Implant Systems. Compared to previous-generation lumbar TDRs, the activL® Artificial Disc incorporates specific design enhancements that result in a more precise anatomical match and allow a range of motion that better mimics the healthy spine. The results of mechanical and clinical studies demonstrate that the activL® Artificial Disc results in improved mechanical and clinical outcomes versus earlier-generation artificial discs and compares favorably to lumbar fusion. The purpose of this report is to describe the activL® Artificial Disc including implant characteristics, intended use, surgical technique, postoperative care, mechanical testing, and clinical experience to date. Keywords: activL® Artificial Disc, artificial disc, degenerative disc disease, discogenic, implant, lumbar, motion preservation, pain
Using Checklists to Assess Your Transition to Alternative Fuels: A Technical Reference
Energy Technology Data Exchange (ETDEWEB)
Risch, C. E. [Argonne National Lab. (ANL), Argonne, IL (United States); Santini, D. J. [Argonne National Lab. (ANL), Argonne, IL (United States); Johnson, L. R. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-12-01
The Checklist for Transition to New Alternative Fuel(s) was published in September 2011 by Chuck Risch and Dan Santini. Many improvements, described below, have been incorporated into this current document, Checklists for Assessing the Transitions to New Highway Fuels.2 Further, the original authors and Larry Johnson, co-author of the current report, identified a need for a succinct version of the full report and prepared a brochure based on it to aid busy decisionmakers: Check It Out: Using Checklists to Assess Your Transition to Alternative Fuels.2 These checklists are tools for those stakeholders charged with determining a feasible alternative fuel or fuels for highway transportation systems of the future. The original had four major players whose needs had to be satisfied for a successful transition. The term “activist,” intended to encompass environmental and other special interests, was included in the “customers” category. Activists are customers of the government in the sense that they organize citizens to exert political pressure to regulate the design of vehicles, fuel infrastructure, and roadway networks. Many who evaluate alternative fuels view activists, particularly environmental activists, as a separate category. Further, “activist” has become a pejorative term to many people. Therefore, we have used the word “advocate” or “activist/advocate” instead. Thus, in this update we recognize that environmental and other activists/advocates have been--and will continue to be--a powerful force promoting change in the nature of the fuels that are used in transportation.
Directory of Open Access Journals (Sweden)
Marlene K Wolfe
Full Text Available To prevent Ebola transmission, frequent handwashing is recommended in Ebola Treatment Units and communities. However, little is known about which handwashing protocol is most efficacious. We evaluated six handwashing protocols (soap and water, alcohol-based hand sanitizer (ABHS, and 0.05% sodium dichloroisocyanurate, high-test hypochlorite, and stabilized and non-stabilized sodium hypochlorite solutions for 1 efficacy of handwashing on the removal and inactivation of non-pathogenic model organisms and, 2 persistence of organisms in rinse water. Model organisms E. coli and bacteriophage Phi6 were used to evaluate handwashing with and without organic load added to simulate bodily fluids. Hands were inoculated with test organisms, washed, and rinsed using a glove juice method to retrieve remaining organisms. Impact was estimated by comparing the log reduction in organisms after handwashing to the log reduction without handwashing. Rinse water was collected to test for persistence of organisms. Handwashing resulted in a 1.94-3.01 log reduction in E. coli concentration without, and 2.18-3.34 with, soil load; and a 2.44-3.06 log reduction in Phi6 without, and 2.71-3.69 with, soil load. HTH performed most consistently well, with significantly greater log reductions than other handwashing protocols in three models. However, the magnitude of handwashing efficacy differences was small, suggesting protocols are similarly efficacious. Rinse water demonstrated a 0.28-4.77 log reduction in remaining E. coli without, and 0.21-4.49 with, soil load and a 1.26-2.02 log reduction in Phi6 without, and 1.30-2.20 with, soil load. Chlorine resulted in significantly less persistence of E. coli in both conditions and Phi6 without soil load in rinse water (p<0.001. Thus, chlorine-based methods may offer a benefit of reducing persistence in rinse water. We recommend responders use the most practical handwashing method to ensure hand hygiene in Ebola contexts, considering
2012 Groundwater Monitoring Report Central Nevada Test Area, Subsurface Corrective Action Unit 443
Energy Technology Data Exchange (ETDEWEB)
None
2013-04-01
The Central Nevada Test Area was the site of a 0.2- to 1-megaton underground nuclear test in 1968. The surface of the site has been closed, but the subsurface is still in the corrective action process. The corrective action alternative selected for the site was monitoring with institutional controls. Annual sampling and hydraulic head monitoring are conducted as part of the subsurface corrective action strategy. The site is currently in the fourth year of the 5-year proof-of-concept period that is intended to validate the compliance boundary. Analytical results from the 2012 monitoring are consistent with those of previous years. Tritium remains at levels below the laboratory minimum detectable concentration in all wells in the monitoring network. Samples collected from reentry well UC-1-P-2SR, which is not in the monitoring network but was sampled as part of supplemental activities conducted during the 2012 monitoring, indicate concentrations of tritium that are consistent with previous sampling results. This well was drilled into the chimney shortly after the detonation, and water levels continue to rise, demonstrating the very low permeability of the volcanic rocks. Water level data from new wells MV-4 and MV-5 and recompleted well HTH-1RC indicate that hydraulic heads are still recovering from installation and testing. Data from wells MV-4 and MV-5 also indicate that head levels have not yet recovered from the 2011 sampling event during which several thousand gallons of water were purged. It has been recommended that a low-flow sampling method be adopted for these wells to allow head levels to recover to steady-state conditions. Despite the lack of steady-state groundwater conditions, hydraulic head data collected from alluvial wells installed in 2009 continue to support the conceptual model that the southeast-bounding graben fault acts as a barrier to groundwater flow at the site.
Calvo, K R; Knoepfler, P; McGrath, S; Kamps, M P
1999-12-23
The Pbx/Exd family of homeodomain (HD) proteins contribute to the transcriptional and developmental roles of other Hox and Meis/Prep1/Hth HD proteins through heterodimer formation. E2a-Pbx1 is an oncogenic derrivative of Pbx1 produced by the t(1;19) translocation in pediatric pre-B cell acute lymphoblastic leukemia. E2a-Pbx1 heterodimerizes with Hox but not with Meis/Prep1 proteins, produces acute myeloid leukemia in mice, and blocks differentiation of cultured murine myeloid progenitors. Here, we characterize negative and positive regulatory sequences that flank the Pbx1 HD and determine their importance for myeloid immortalization by E2a-Pbx1. A 25 residue predicted alpha helix preceding the Pbx1 HD bound the HD and prevented both its binding to DNA and its ability to heterodimerize with Hox proteins. Addition of 39 residues N-terminal to this inhibitory helix exposed a Pbx dimerization interface that orchestrated cooperative DNA-binding of E2a-Pbx1 and all Pbx proteins as homodimers and heterdimers. Sequences inhibiting DNA-binding and mediating Pbx dimerization coincided with those reported to have nuclear export function. An additional 103 residues N-terminal to the Pbx dimerization interface restored heterodimerization with Hox and Meis1/Prep1 proteins. This negative switch domain - comprised of the inhibitory helix and N-terminal regions required for its partner-mediated derepression - was dispensable for myeloid immortalization by E2a-Pbx1. While stabilizing the heterodimer, the 310 helix C-terminal to the Pbx1 HD was also dispensable for the ability of E2a-Pbx1 to heterodimerize with Hox proteins and immortalize myeloblasts. Retention of myeloid immortalization by E2a-Pbx1 proteins lacking all Pbx1 sequences N- or C-terminal to the HD indicates that Hox proteins, or a yet undefined factor that binds the Pbx1 HD and derepresses DNA-binding by the HD, cooperate with E2a-Pbx1 in myeloid immortalization.
The Crisis of Democracy in Europe: Between National State and European Governance
Directory of Open Access Journals (Sweden)
Damir Grubiša
2006-01-01
Full Text Available In this article the symptoms of the crises of democracy are analyzed. The author concentrates on three sets of symptoms: fi rst, on the symptoms emerged in transition, post-communist countries that joined the EU within the Fifth enlargement. One of the main indicators of such crises is the low turnout in the European Parliament elections in 2004, only one month after their joining the EU. The reasons for such a bad turnout are the disappointment in democracy and in transition, as well as the formal fulfi llment of the Copenhagen criteria for accession. The second symptom of the crises is the negative result of the European Constitutional referenda in France and in the Netherlands, which triggered the chain reaction of rejection in other European countries and a stalemate in the ratifi cation process. The third element of the crises is the democratic defi cit in the EU and the diff erent views on how to overcome it, either by strengthening federalist elements or by the domination of intergovernmentalist procedures. In conclusion, the author agrees with Larry Siedentop that three appeals of democracy exist in today’s Europe: democracy simpliciter, democratic government appeal and the appeal of a democratic society. However, most European countries are still on the fi rst or second step, and therefore the crisis of democracy is still potentially dangerous for the future development of European societies. The victory over communism did not bring about the expected triumph of democracy, and today democracy is exposed to diff erent forms of political pathology that corroborate the delusions and failed expectations of democratization.
Directory of Open Access Journals (Sweden)
Camila Guimarães
2010-06-01
Full Text Available Camila Guimarães2, Carlo A Marra1, Sabrina Gill1, Graydon Meneilly1, Scot Simpson3, Ana LPC Godoy2, Maria Cristina Foss de Freitas2, Regina HC Queiroz2, Larry Lynd11The University of British Columbia, Canada; 2University of São Paulo, Brazil; 3The University of Alberta, CanadaObjective: To explore which attributes of insulin therapy drive patients’ preferences for management in Canada and Brazil.Methods: A qualitative design was implemented in which a total of 32 patients with type 2 diabetes from Canada and Brazil, were interviewed in one of the 4 focus groups, or 16 individual interviews. Eighteen participants (56% were women and fourteen participants (44% were men (15 insulin nonusers and 17 insulin users. Two focus groups of 4 participants each and 9 individual interviews were conducted in Brazil. In Canada, 2 focus groups of 4 participants each and 7 individual interviews were conducted. A framework analysis was used to analyse all data.Results: Brazilian participants, when considering two insulin treatments, would prefer the one that had fewer side-effects (specially hypoglycemia events, was noninjectable, had the lowest cost and was most effective. Meanwhile, Canadian participants would prefer a treatment that had fewer side-effects (specially weight gain, was less invasive, was more convenient and was most effective.Conclusions: Finding the insulin-delivery system and the attributes of insulin therapy that best meet patients’ preferences may lead to improved control, through improved compliance, which may ultimately reduce the financial burden of the disease and improve quality of life.Keywords: type 2 diabetes, insulin administration, glycemic control, weight gain, hypoglycemia, qualitative study, patients’ preferences
Discovering Interdisciplinary Uses of Online Technologies in Higher Education
Directory of Open Access Journals (Sweden)
Mary Caton-Rosser
2014-06-01
Full Text Available Recent research shows both students and professors rushing to adapt learning and teaching activities accessing ever-upgrading digital and social media formats like Facebook, Twitter, YouTube, Pinterest and Prezi. Many institutions of higher education are embracing social media as viable, student-centered-classroom communication tools in a full range of subject disciplines, as well as in emerging interdisciplinary activities that prepare students for current trends in the job force. The new communication channels offer students a direct voice in discussion of topics of subject matter and current events, avenues for expedited exchange of information, and also introduction to skills needed to operate mobile computing devices, such as tablets and portable hand-held devices. The advancing tools of online technology are also being used creatively in general communication across college campuses in higher education following standardized-use policies. The use of social media, for example, is effective in recruiting and interacting with prospective students and their parents or in expedited sharing of news or updated policies and procedures. The current endorsement of new technologies in various higher-education settings aligns with historical enthusiasm in education for interactive classroom dialogue. Over the years, progressive and pragmatic educators, such as John Dewey, Paulo Freire, Elliot Eisner and Larry Cuban have promoted interactive, inclusive pedagogical communication and experiential education since the early 1900s to the present. For the past year-and-a-half, three faculty members at Black Hills State University have been conducting qualitative and quantitative research on the use of digital and social media in higher education. Since the beginning, the central goal has been to create awareness of digital technologies and social media as inter-subjective tools. More recently, the focus has become measurement of the learning experience and
Directory of Open Access Journals (Sweden)
Steffen Krüger
2018-02-01
Full Text Available In this article, I examine the Machinima film 'Finding Fanon II', by London-based artists Larry Achiampong and David Blandy, for what it can tell us about the relationship between video gaming and the postcolonial. Evoking Frantz Fanon, one of the most piercing voices of the decolonisation movement of the 1950s and 1960s, in the context of 'Grand Theft Auto' (GTA, one of the most technologically advanced and, at the same time, scandalous video game series of the 21st century, 'Finding Fanon II' amounts to a scathing critique of both the game series’ depiction of race and academic scholarship that has been defending the series on the grounds of its use of humour and irony. Shot in the in-game video editor of 'GTA V', 'Finding Fanon II' lets this critique emerge from inside the game and as an effect of the artists’ engagement with it. By suspending the game’s mechanisms and programmed forms of interaction, the artwork brings their racialised logic to the fore, pointing towards the ways in which 'GTA V' commodifies black men for the consumption of white players. This commodification has the effect of normalising and naturalising the precarious position of black people in Western society. What the artwork adds to this argument through its facilitation of a Fanonian perspective is a reminder that it is not only the gaming experience of 'white' players that is framed in this way. Players with ethnic minority backgrounds might also accept the white gaze of the game as a given. Acts of self-commodification along the lines of a white Western rationality must thus be seen as a plausible new form of cultural imperialism promoted by the GTA series.
WANTO 32: Proceedings of the 32nd Weapons Agencies Nondestructive Testing Organization meeting
International Nuclear Information System (INIS)
Majzlik, E.J. Jr.
1991-02-01
The Thirty-Second Weapons Agencies Nondestructive Testing Organization (WANTO) meeting was held at the Savannah River Site (SRS) on November 27--29, 1990. The meeting was hosted by Edward J. Majzlik, Jr., Savannah River Laboratory, Westinghouse Savannah River Company (WSRC). The Chairman of the WANTO Steering Committee is L.E. (Larry) Bryant, Los Alamos National Laboratory. This report is the sole proceedings of the meeting and includes the agenda, attendance, steering committee report, interim reports and technical presentation summaries. This report is the first to present the meeting proceedings in an unclassified form. The reader should contact individual authors directly for any additional information desired. The meeting was organized to provide coverage of a wide variety of NDE subjects relevant to the Department of Energy (DOE) Nuclear Weapons Complex (NWC). Approximately 60 technical experts and managers representing 11 DOE weapons agencies and 3 DOE offices attended. A total of 56 technical presentations and 3 special NDE workshops were included in the agenda along with two tours of the SRS Reactor Mock-up Facility. Invited presentations included five speakers who reported on the DOE sponsored conference Concurrent Engineering and the NDE Role held at Sandia National Laboratory, Albuquerque, New Mexico, October 30-November 1, 1990 and X-ray Film Retention and Disposal presented by Orville R. Pratt, DOE/AL-Martin Marietta. The WANTO Steering Committee report for the Thirty-Second Meeting immediately follows this section. The meeting Agenda and Attendance are presented in Appendices A and B, respectively. Technical presentation summaries and abstracts are presented in Appendix C. For cases in which a summary was not provided, a telephone number is offered for direct contact with the author/presenter. Interim Activity Reports are compiled in Appendix D. Special Workshop reports are presented in Appendix E. (JF)
Allain, Larry
2014-01-01
A floristics inventory was conducted to identify and photograph the vascular plants occurring at Caddo Lake National Wildlife Refuge (NWR), Texas, from March 2011 to March 2012 by the U.S. Geological Survey in cooperation with the U.S. Fish and Wildlife Service. This research resulted in the identification of 511 taxa of vascular plants representing 111 families and 317 genera. Despite the degree of development of the refuge at the time it was transferred to the U.S. Fish and Wildlife Service, plant diversity was high. Of the 511 species identified in this study, 346 species are new records for Harrison County, and 3 species are new discoveries for Texas. Caddo Lake NWR is primarily forested with 55 tree species and 35 shrub species identified in this study. Of the species identified, 289 are associated with wetlands having a wetland classification of facultative or wetter, possibly reflecting the proximity of Caddo Lake to the refuge and the three streams that intersect the refuge. Sixty-two of the species found on the refuge are introduced. Chinese tallow tree (Triadica sebifera) is one of the more common invasive tree species on the refuge and is actively controlled by refuge staff. Chinese privet (Ligustrum sinense), sacred bamboo (Nandina domestica), and King’s Ranch bluestem (Bothriochloa ischaemum var. songarica) are present on the refuge and have the potential to become invasive. More than 10,000 photographs were taken of the plants found on the refuge in an effort to document general appearance and capture diagnostic characters of each plant species. Photographs were also taken of many of the animals and landscapes encountered during the project. Select images of each of the plants and animals are included in the collection of more than 1,600 photographs (all photographs by Larry Allain).
Directory of Open Access Journals (Sweden)
London NJ
2013-09-01
Full Text Available Nicholas J London,1 Jon Smith,2 Larry E Miller,3,4 Jon E Block4 1Department of Orthopaedic Surgery, Harrogate District Foundation Trust, Harrogate, UK; 2The Mid Yorkshire Hospitals NHS Trust, Yorkshire, UK; 3Miller Scientific Consulting, Arden, NC, USA; 4The Jon Block Group, San Francisco, CA, USA Abstract: Almost 4 million Americans are within the knee osteoarthritis (OA treatment gap, the period from unsuccessful exhaustion of conservative treatment to major surgical intervention. New treatment alternatives for symptomatic knee OA are greatly needed. The purpose of this report was to assess outcomes of a joint-unloading implant (KineSpring® Knee Implant System in patients with symptomatic medial knee OA. A total of 100 patients enrolled in three clinical trials were treated with the KineSpring System and followed for a minimum of 1 year. All devices were successfully implanted and activated, with no operative complications. Knee pain severity improved 60% (P < 0.001 at 1 year, with 76% of patients reporting a minimum 30% improvement in pain severity. All Western Ontario and McMaster Universities Arthritis Index (WOMAC subscores significantly improved at 1 year, with a 56% improvement in pain, 57% improvement in function, and a 39% improvement in stiffness (all P < 0.001. The percentage of patients experiencing a minimum 20% improvement in WOMAC subscores was 74% for pain, 83% for function, and 67% for stiffness. During follow-up, six (6% patients required additional surgery, including four total knee arthroplasties and two high tibial osteotomies. The KineSpring System effectively bridges the treatment gap between failed conservative care and surgical joint-modifying procedures. Keywords: implant, KineSpring, knee, medial, osteoarthritis, unloading
Directory of Open Access Journals (Sweden)
Winnie W Leung
2007-01-01
Full Text Available Winnie W Leung1, Margaret M McClure1, Larry J Siever1,2, Deanna M Barch3, Philip D Harvey1,21Department of Veterans Affairs, VISN 3 Mental Illness Research, Education, and Clinical Center (MIRECC, Bronx, NY, USA; 2Department of Psychiatry, Mt. Sinai School of Medicine, New York, NY, USA; 3Departments of Psychology and Psychiatry, Washington University, St. Louis, MO, USAAbstract: A functional polymorphism of the gene coding for Catechol-O-methyltrasferase (COMT, an enzyme responsible for the degradation of the catecholamine dopamine (DA, epinephrine, and norepinephrine, is associated with cognitive deficits. However, previous studies have not examined the effects of COMT on context processing, as measured by the AX-CPT, a task hypothesized to be maximally relevant to DA function. 32 individuals who were either healthy, with schizotypal personality disorder, or non-cluster A, personality disorder (OPD were genotyped at the COMT Val158Met locus. Met/Met (n = 6, Val/Met (n = 10, Val/Val (n = 16 individuals were administered a neuropsychological battery, including the AX-CPT and the N-back working memory test. For the AX-CPT, Met/Met demonstrated more AY errors (reflecting good maintenance of context than the other genotypes, who showed equivalent error rates. Val/Val demonstrated disproportionately greater deterioration with increased task difficulty from 0-back to 1-back working memory demands as compared to Met/Met, while Val/Met did not differ from either genotypes. No differences were found on processing speed or verbal working memory. Both context processing and working memory appear related to COMT genotype and the AX-CPT and N-back may be most sensitive to the effects of COMT variation.Keywords: COMT, dopamine, context processing, working memory, schizotypal personality disorder
Directory of Open Access Journals (Sweden)
Miller LE
2015-01-01
Full Text Available Larry E Miller,1,2 Miki Sode,3 Thomas Fuerst,3 Jon E Block2 1Miller Scientific Consulting, Inc., Asheville, NC, USA; 2The Jon Block Group, San Francisco, CA, USA; 3Bioclinica, Newark, CA, USA Background: Knee osteoarthritis (OA is largely attributable to chronic excessive and aberrant joint loading. The purpose of this pilot study was to quantify radiographic changes in subchondral bone after treatment with a minimally invasive joint unloading implant (KineSpring® Knee Implant System.Methods: Nine patients with unilateral medial knee OA resistant to nonsurgical therapy were treated with the KineSpring System and followed for 2 years. Main outcomes included Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC pain, function, and stiffness subscores and independent core laboratory determinations of joint space width and fractal signature of the tibial cortex.Results: WOMAC scores, on average, improved by 92% for pain, 91% for function, and 79% for stiffness over the 2-year follow-up period. Joint space width in the medial compartment of the treated knee significantly increased from 0.9 mm at baseline to 3.1 mm at 2 years; joint space width in the medial compartment of the untreated knee was unchanged. Fractal signatures of the vertically oriented trabeculae in the medial compartment decreased by 2.8% in the treated knee and increased by 2.1% in the untreated knee over 2 years. No statistically significant fractal signature changes were observed in the horizontally oriented trabeculae in the medial compartment or in the horizontal or vertical trabeculae of the lateral compartment in the treated knee.Conclusion: Preliminary evidence suggests that the KineSpring System may modify knee OA disease progression by increasing joint space width and improving subchondral bone trabecular integrity, thereby reducing pain and improving joint function. Keywords: disease modification, KineSpring, joint space, pain, trabecular
Synthesis, characterization and study of the bioactivity of B2O3 based bioglass
Energy Technology Data Exchange (ETDEWEB)
Alves, L.C.F.; Gomes, J.F.; Portes, P.N.; Steimacher, A.; Pedrochi, F. [Universidade Federal do Maranhao (UFMA), MA (Brazil)
2016-07-01
Full text: Replacement of parts of living system by synthetic materials has resulted in the creation of a class of materials known as Biomaterials. The clinical use of glass as a biomaterial came up with the pioneering work of Larry Hench in the 60, with the development of Bioglass 45S5®. The main feature of this biocompatible material is its ability to promote a quick and durable chemical bonding by means of an apatitic interface, with the bone tissue, which earned him the designation of bioactive glass. Its development increased the research about restorations bone materials. The biggest disadvantage presented by bioglasses are the low mechanical strength and low fracture toughness, which have prevented their application in structural implants. Boron has some specific properties such as antiseptic (Borax), mechanical strength and thermal shock (borosilicate) and low toxicity in mammals. Recent studies have shown that the partial or complete replacement of SiO2 in Bioglass® 45S5 by B2O3, leads to a complete and faster conversion of bioglass in Hydroxyapatite. Some research found that Boron based bioglass are favourable substrates for cell attachment and proliferation of osteogenic. The samples of the boron-based bioglass were obtained from the melting-quenching process with the following reagents CaO-B2O3-CaF2-P2O5-Na2O, then were thermally treated so that internal tensions are reduced and the glass get higher mechanical strength. The samples bioactivity is tested in SBF (Simulated Body Fluid) test and the characterization are done before and after this process. The mainly properties studied are: determination of volumetric mass density, differential thermal analysis (DTA) and x-ray diffractometry. The results are discussed in terms of the bioactivity compared to Bioglass® 45S5 and other compositions studied in the literature. (author)
Directory of Open Access Journals (Sweden)
Miller LE
2016-06-01
Full Text Available Larry E Miller,1 Roy D Altman,2 Louis F McIntyre3 1Miller Scientific Consulting, Inc., Asheville, NC, 2Department of Rheumatology, University of California Los Angeles, Los Angeles, CA, 3Northwell Physician Partners, Sleepy Hollow, NY, USA Abstract: Hyaluronic acid (HA is a commonly prescribed treatment for knee pain resulting from osteoarthritis (OA. Although numerous HA products have been approved for use by the US Food and Drug Administration, the efficacy of HA injections for knee OA remains disputed with meta-analyses and societal clinical guidelines drawing disparate conclusions. The American Academy of Orthopaedic Surgeons (AAOS recently published a best-evidence systematic review and concluded that available data did not support the routine use of HA for knee OA. The purpose of the current article is to highlight issues that confound interpretation of meta-analyses on HA for knee OA, to provide realistic estimates of the true efficacy of HA injections in knee OA, and to provide commentary on the methods and conclusions from the AAOS systematic review. In general, the clinical benefit of HA is underestimated using conventional meta-analytic techniques. When accounting for differential control group effects in HA studies, it can be reasonably concluded that HA injections may be beneficial to an appreciable number of patients with knee OA. In addition, the systematic review methodology used by AAOS was questionable due to exclusion of numerous relevant studies and inclusion of studies that used HAs not approved for use in the US, both of which underestimated the true efficacy of HA injections. Overall, the efficacy of HA injections for knee OA is likely better than previously reported. Future clinical trials and meta-analyses should account for differential control group effects in order to avoid the continued confusion surrounding HA injection efficacy. Keywords: effect size, hyaluronic acid, injection, knee, minimal important difference
Karaca, Hakan; Pérez-Gago, María B; Taberner, Verònica; Palou, Lluís
2014-06-02
Common food preservative agents were evaluated in in vitro tests for their antifungal activity against Monilinia fructicola, the most economically important pathogen causing postharvest disease of stone fruits. Radial mycelial growth was measured in Petri dishes of PDA amended with three different concentrations of the agents (0.01-0.2%, v/v) after 7 days of incubation at 25 °C. Thirteen out of fifteen agents tested completely inhibited the radial growth of the fungus at various concentrations. Among them, ammonium carbonate, ammonium bicarbonate and sodium bicarbonate were the most effective while sodium acetate and sodium formate were the least effective. The effective agents and concentrations were tested as ingredients of hydroxypropyl methylcellulose (HPMC)-lipid edible coatings against brown rot disease on plums previously inoculated with M. fructicola (curative activity). 'Friar' and 'Larry Ann' plums were inoculated with the pathogen, coated with stable edible coatings about 24h later, and incubated at 20 °C and 90% RH. Disease incidence (%) and severity (lesion diameter) were determined after 4, 6, and 8 days of incubation and the 'area under the disease progress stairs' (AUDPS) was calculated. Coatings containing bicarbonates and parabens significantly reduced brown rot incidence in plums, but potassium sorbate, used at 1.0% in the coating formulation, was the most effective agent with a reduction rate of 28.6%. All the tested coatings reduced disease severity to some extent, but coatings containing 0.1% sodium methylparaben or sodium ethylparaben or 0.2% ammonium carbonate or ammonium bicarbonate were superior to the rest, with reduction rates of 45-50%. Overall, the results showed that most of the agents tested in this study had significant antimicrobial activity against M. fructicola and the application of selected antifungal edible coatings is a promising alternative for the control of postharvest brown rot in plums. Copyright © 2014 Elsevier B
Directory of Open Access Journals (Sweden)
Kevin YEE
Full Text Available Introduced in July, 2011 in a beta test of invited users only, the new social media service Google+ (or G+ quickly spread by word of mouth, and Google leader Larry Page (2011 blogged that within sixteen days it had 10 million users. By August, it had 25 million users (Cashmore, 2011. Even with slower growth ahead (still with no marketing budget, the service looks likely to crest 100 million users perhaps as early as ten months, a feat that took Facebook three years. Other social networks, most notably Facebook and Twitter, have been used increasingly as instructional tools, since they are platforms with which students are already familiar (Maloney, 2007; McLoughlin & Lee, 2007. Selwyn (2009 found that students often eschew official channels for communication in favor of less formal community-based formats such as Facebook, implying a growing need for instructional communication tools that will be used willingly by students. The question is whether Google+ can be used like Twitter or Facebook to augment instruction, or even, perhaps, to improve upon those predecessors for academic purposes. Google+ is like Twitter in that anyone can follow a given user’s posts. There is no direct “friend” relationship required to read the posts written by others. However, it also approximates some features of Facebook. Rather than friends sorted into “lists” like in Facebook, Google+ allows users to place feeds into one or more “circles,” the better to monitor (or control the flow of information to and from different audiences. Circles are more intuitive, and more central to the experience, than the Facebook lists. They provide an explicit organizational structure, compared to the less-obvious listing functionality, which feels like an afterthought, found in Facebook.
Medium Truck Duty Cycle Data from Real-World Driving Environments: Final Report
Energy Technology Data Exchange (ETDEWEB)
Lascurain, Mary Beth [ORNL; Franzese, Oscar [ORNL; Capps, Gary J [ORNL; Siekmann, Adam [ORNL; Thomas, Neil [ORNL; LaClair, Tim J [ORNL; Barker, Alan M [ORNL; Knee, Helmut E [ORNL
2012-11-01
dry-box delivery) were instrumented for the collection of one year of operational data. The Part-2 FOT involved the towing and recovery and utility vocations for a second year of data collection. The vehicles that participated in the MTDC project did so through gratis partnerships in return for early access to the results of this study. Partnerships such as these are critical to FOTs in which real-world data is being collected. In Part 1 of the project, Oak Ridge National Laboratory (ORNL) established partnerships with the H.T. Hackney Company (HTH), one of the largest wholesale distributors in the country, distributing products to 21 states; and with Knoxville Area Transit (KAT), the city of Knoxville s transit system, which operates across Knoxville and parts of Knox County. These partnerships and agreements provided ORNL access to three Class-7 day-cab tractors that regularly haul 28 ft pup trailers (HTH) and three Class-7 buses for the collection of duty cycle data. In addition, ORNL collaborated with the Federal Motor Carrier Safety Administration (FMCSA) to determine if there were possible synergies between this duty cycle data collection effort and FMCSA s need to learn more about the operation and duty cycles of medium trucks. FMCSA s primary interest was in collecting safety data relative to the driver, carrier, and vehicle. In Part 2 of the project, ORNL partnered with the Knoxville Utilities Board, which made available three Class-8 trucks. Fountain City Wrecker Service was also a Part 2 partner, providing three Class-6 rollback trucks. In order to collect the duty cycle and safety-related data, ORNL developed a data acquisition system (DAS) that was placed on each test vehicle. Each signal recorded in this FOT was collected by means of one of the instruments incorporated into each DAS. Other signals were obtained directly from the vehicle s J1939 and J1708 data buses. A VBOX II Lite collected information available from a global positioning system (GPS
Oligomeric stability of Rapana venosa hemocyanin (RvH) and its structural subunits.
Dolashka-Angelova, Pavlina; Schwarz, Heinz; Dolashki, Aleksandar; Stevanovic, Stefan; Fecker, Miriam; Saeed, Muhammad; Voelter, Wolfgang
2003-03-21
The two structural subunits RvH1 and RvH2 were separated after overnight dialysis of Rapana venosa Hc against 130 mM Gly/NaOH buffer, pH 9.6, on an ion exchange column Hiload 26/10 Sepharose Q using a fast performance liquid chromatography (FPLC) system. The reassociation characteristics of these two RvH isoforms and the native molecule were studied in buffers with different pH values and concentrations of Ca(2+) and Mg(2+). Reassociation of mixed RvH subunits was performed over a period of several days using a stabilizing buffer (SB) of pH 7.0 containing different concentrations of Ca(2+) and Mg(2+) ions. After 2 days of dialysis, an RvH subunit mixture of didecamers and multidecamers was observed in the presence of 100 mM CaCl(2) and MgCl(2), though RvH1 and RvH2 are biochemically and immunologically different and have also different dissociation properties. The reassociation, performed at pH 9.6 with 2 mM CaCl(2) and MgCl(2) at 4 degrees C over a period of one to several weeks, led to the formation of decameric oligomers, while didecamers formed predominantly in the SB at pH 7.0. Higher concentrations of calcium and magnesium ions led to a more rapid reassociation of RvH1 resulting in long stable multidecamers and helical tubules, which were stable and slowly dissociated into shorter multidecamers and decamers at higher pH values. The reassociation of the RvH2 structural subunit in the same buffers processed slowly and yielded didecamers, shorter tubule polymers and long multidecamers which are less stable at higher pH values. The stability of RvH isoforms under varying ionic conditions is compared with the stability of keyhole limpet (KLH, Megathura crenulata) hemocyanin (KLH) and Haliotis tuberculata hemocyanin (HtH) isoforms. The process of dissociation and reassociation is connected with changes of the fluorescence intensity at 600 nm, which can be explained by differences in opalescence of the solutions of these two isoforms. The solutions of longer tubule
Target fuels for plutonium and minor actinide transmutation in pressurized water reactors
International Nuclear Information System (INIS)
Washington, J.; King, J.; Shayer, Z.
2017-01-01
Highlights: • We evaluate transmutation fuels for plutonium and minor actinide destruction in LWRs. • We model a modified AP1000 fuel assembly in SCALE6.1. • We evaluate spectral shift absorber coatings to improve transmutation performance. - Abstract: The average nuclear power plant produces twenty metric tons of used nuclear fuel per year, containing approximately 95 wt% uranium, 1 wt% plutonium, and 4 wt% fission products and transuranic elements. Fast reactors are a preferred option for the transmutation of plutonium and minor actinides; however, an optimistic deployment time of at least 20 years indicates a need for a nearer-term solution. This study considers a method for plutonium and minor actinide transmutation in existing light water reactors and evaluates a variety of transmutation fuels to provide a common basis for comparison and to determine if any single target fuel provides superior transmutation properties. A model developed using the NEWT module in the SCALE 6.1 code package provided performance data for the burnup of the target fuel rods in the present study. The target fuels (MOX, PuO_2, Pu_3Si_2, PuN, PuUZrH, PuZrH, PuZrHTh, and PuZrO_2) are evaluated over a 1400 Effective Full Power Days (EFPD) interval to ensure each assembly remained critical over the entire burnup period. The MOX (5 wt% PuO_2), Pu_0_._3_1ZrH_1_._6Th_1_._0_8, and PuZrO_2MgO (8 wt% Pu) fuels result in the highest rate of plutonium transmutation with the lowest rate of curium-244 production. This study selected eleven different burnable absorbers (B_4C, CdO, Dy_2O_3, Er_2O_3, Eu_2O_3, Gd_2O_3, HfO_2, In_2O_3, Lu_2O_3, Sm_2O_3, and TaC) for evaluation as spectral shift absorber coatings on the outside of the fuel pellets to determine if an absorber coating can improve the transmutation properties of the target fuels. The PuZrO_2MgO (8 wt% Pu) target fuel with a coating of Lu_2O_3 resulted in the highest rate of plutonium transmutation with the greatest reduction in curium
Target fuels for plutonium and minor actinide transmutation in pressurized water reactors
Energy Technology Data Exchange (ETDEWEB)
Washington, J., E-mail: jwashing@gmail.com [Nuclear Science and Engineering Program, Colorado School of Mines, 1500 Illinois St., Golden, CO 80401 (United States); King, J., E-mail: kingjc@mines.edu [Nuclear Science and Engineering Program, Colorado School of Mines, 1500 Illinois St., Golden, CO 80401 (United States); Shayer, Z., E-mail: zshayer@mines.edu [Department of Physics, Colorado School of Mines, 1500 Illinois St., Golden, CO 80401 (United States)
2017-03-15
Highlights: • We evaluate transmutation fuels for plutonium and minor actinide destruction in LWRs. • We model a modified AP1000 fuel assembly in SCALE6.1. • We evaluate spectral shift absorber coatings to improve transmutation performance. - Abstract: The average nuclear power plant produces twenty metric tons of used nuclear fuel per year, containing approximately 95 wt% uranium, 1 wt% plutonium, and 4 wt% fission products and transuranic elements. Fast reactors are a preferred option for the transmutation of plutonium and minor actinides; however, an optimistic deployment time of at least 20 years indicates a need for a nearer-term solution. This study considers a method for plutonium and minor actinide transmutation in existing light water reactors and evaluates a variety of transmutation fuels to provide a common basis for comparison and to determine if any single target fuel provides superior transmutation properties. A model developed using the NEWT module in the SCALE 6.1 code package provided performance data for the burnup of the target fuel rods in the present study. The target fuels (MOX, PuO{sub 2}, Pu{sub 3}Si{sub 2}, PuN, PuUZrH, PuZrH, PuZrHTh, and PuZrO{sub 2}) are evaluated over a 1400 Effective Full Power Days (EFPD) interval to ensure each assembly remained critical over the entire burnup period. The MOX (5 wt% PuO{sub 2}), Pu{sub 0.31}ZrH{sub 1.6}Th{sub 1.08}, and PuZrO{sub 2}MgO (8 wt% Pu) fuels result in the highest rate of plutonium transmutation with the lowest rate of curium-244 production. This study selected eleven different burnable absorbers (B{sub 4}C, CdO, Dy{sub 2}O{sub 3}, Er{sub 2}O{sub 3}, Eu{sub 2}O{sub 3}, Gd{sub 2}O{sub 3}, HfO{sub 2}, In{sub 2}O{sub 3}, Lu{sub 2}O{sub 3}, Sm{sub 2}O{sub 3}, and TaC) for evaluation as spectral shift absorber coatings on the outside of the fuel pellets to determine if an absorber coating can improve the transmutation properties of the target fuels. The PuZrO{sub 2}MgO (8 wt% Pu) target
Norton, Larry
2014-01-01
At the root of science lie basic rules, if we can discover or deduce them. This is not an abstract project but practical; if we can understand the why then perhaps we can rationally intervene. One of the unifying unsolved problems in physics is the hypothetical "Theory of Everything." In a similar vein, we can ask whether our own field contains such hidden fundamental truths and, if so, how we can use them to develop better therapies and outcomes for our patients. Modern oncology has developed as drugs and translational science have matured over the 50 years since ASCO's founding, but almost from that beginning tumor modeling has been a key tool. Through this general approach Norton and Simon changed our understanding of cancer biology and response to therapy when they described the fit of Gompertzian curves to both clinical and animal observations of tumor growth. The practical relevance of these insights has only grown with the development of DNA sequencing promising a raft of new targets (and drugs). In that regard, Larry Norton's contribution to this year's Educational Book reminds us to always think creatively about the fundamental problems of tumor growth and metastases as well as therapeutic response. Demonstrating the creativity and thoughtfulness that have marked his remarkable career, he now incorporates a newer concept of self-seeding to further explain why Gompertzian growth occurs and, in the process, provides a novel potential therapeutic target. As you read his elegantly presented discussion, consider how this understanding, wisely applied to the modern era of targeted therapies, might speed the availability of better treatments. But even more instructive is his personal model-not only the Norton-Simon Hypothesis-of how to live and approach science, biology, patients and their families, as well as the broader community. He shows that with energy, enthusiasm, optimism, intellect, and hard work we can make the world better. Clifford A. Hudis, MD, FACP
The new history of psychology: Some (different) answers to Lovett's five questions.
Brock, Adrian C
2017-05-01
[Correction Notice: An Erratum for this article was reported in Vol 20(2) of History of Psychology (see record 2016-53552-001). In this article there was an error in the 11th paragraph of the Lovett's Five Questions for the New Historians section. The conference paper "The "new" history of science: Implications for philosophy of science" by Rachel Laudan (1992) was wrongly attributed to her husband, Larry Laudan. All versions of this article have been corrected.] The professionalization of the history of psychology from the 1960s led to significant changes in the way that history was written. Several authors tried to summarize these changes in the 1980s, and Laurel Furumoto's (1989) G. Stanley Hall lecture, "The new history of psychology" is the best-known example of this genre. This journal published a critique of the new history by Benjamin R. Lovett (2006) with the title, "The new history of psychology: A review and critique," and it is still being cited as an authoritative source. The article consists of 3 parts. First, the author attempts to show that the new history is not as different from the old as its proponents claim. He then discusses some problems that he considers to be unique to the new history, and he presents them in the form of 5 questions for the new historians, which he then goes on to answer himself. Finally, he discusses the problematic relationship between critical history and psychology. This article is a reply to Lovett's article. The author argues that the new history is different from the old in every way that Lovett claims that it is not. It critically analyzes Lovett's answers to his own 5 questions and offers some alternative answers to these questions. It also suggests that many psychologist-historians are opposed to new history of psychology, especially in its critical versions, and that this explains why Lovett's article has been uncritically received. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Directory of Open Access Journals (Sweden)
D'Elia JA
2017-06-01
Full Text Available John A D’Elia,1 Alissa R Segal,1,2 George P Bayliss,3 Larry A Weinrauch1 1Kidney and Hypertension Section, Joslin Diabetes Center, Harvard Medical School, 2Department of Pharmacy Practice, MCPHS University, Boston, MA, 3Division of Kidney Diseases and Hypertension, Rhode Island Hospital, Alpert Medical School, Brown University, Providence, RI, USA Objective: To evaluate whether adverse event reports to the US Food and Drug Administration on incidents of ketoacidosis from use of sodium glucose cotransport inhibitors (SGLT2 inhibitors provide insight into ways this new class of drugs is being prescribed with other antihyperglycemic agents; to examine possible mechanisms to explain ketoacidosis.Design and methods: Reports of adverse events concerned to SGLT2 inhibitors, namely, empagliflozin, dapagliflozin, and canagliflozin were obtained under the Freedom of Information Act for 5 years ending in August 31, 2015. The data were evaluated for incidents of ketoacidosis by looking for keywords such as diabetic ketoacidosis, ketoacidosis, lactic acidosis, acidosis, and metabolic acidosis. Results were tabulated individually for empagliflozin (n=260 adverse event reports, dapagliflozin (n=520, and canagliflozin (n=2159. Adverse events were categorized according to age, gender, and insulin use.Results: There were 46, 144, and 450 reports of ketoacidosis concerned with the use of empagliflozin, dapagliflozin, and canagliflozin, respectively. The use of SGLT2 inhibitors was not strictly limited to patients with type 2 diabetes but was cut across categories of insulin use, including a total of 172 cases of SGLT2-related ketoacidosis in individuals above the age of 40 who were not on insulin.Conclusion: Further studies should focus to detect pleiotropic effects of SGLT2 inhibitors, particularly with other oral antihyperglycemic drugs or insulin. A review of the literature suggests that patients with type 2 diabetes with low C-peptide level may be at
Minimally invasive treatment of lumbar spinal stenosis with a novel interspinous spacer
Directory of Open Access Journals (Sweden)
Shabat S
2011-09-01
Full Text Available Shay Shabat1, Larry E Miller2,3, Jon E Block3, Reuven Gepstein11Spinal Care Unit, Sapir Medical Center, Kfar Saba, Israel; 2Miller Scientific Consulting, Inc, Biltmore Lake, NC, USA; 3Jon E Block, PhD, Inc, San Francisco, CA, USAPurpose: To assess the safety and effectiveness of a novel, minimally invasive interspinous spacer in patients with moderate lumbar spinal stenosis (LSS.Methods: A total of 53 patients (mean age, 70 ± 11 years; 45% female with intermittent neurogenic claudication secondary to moderate LSS, confirmed on imaging studies, were treated with the Superion® Interspinous Spacer (VertiFlex, Inc, San Clemente, CA and returned for follow-up visits at 6 weeks, 1 year, and 2 years. Study endpoints included axial and extremity pain severity with an 11-point numeric scale, Zurich Claudication Questionnaire (ZCQ, back function with the Oswestry Disability Index (ODI, health-related quality of life with the Physical Component Summary (PCS and Mental Component Summary (MCS scores from the SF-12, and adverse events.Results: Axial and extremity pain each decreased 54% (both P < 0.001 over the 2-year follow-up period. ZCQ symptom severity scores improved 43% (P < 0.001 and ZCQ physical function improved 44% (P < 0.001 from pre-treatment to 2 years post-treatment. A statistically significant 50% improvement (P < 0.001 also was noted in back function. PCS and MCS each improved 40% (both P < 0.001 from pre-treatment to 2 years. Clinical success rates at 2 years were 83%–89% for ZCQ subscores, 75% for ODI, 78% for PCS, and 80% for MCS. No device infection, implant breakage, migration, or pull-out was observed, although two (3.8% patients underwent explant with subsequent laminectomy.Conclusion: Moderate LSS can be effectively treated with a minimally invasive interspinous spacer. This device is appropriate for select patients who have failed nonoperative treatment measures for LSS and meet strict anatomical criteria.Keywords: Superion, axial
WATER RESISTANCE OF RECYCLED PAPER PANEL
Directory of Open Access Journals (Sweden)
Alexander Rani Suryandono
2017-06-01
Alice Wisler (2015 Facts about Recycling Paper. http://greenliving.lovetoknow.com/Facts_About_Recycling_Paper. Accessed 2 April 2016 Clay Miller (2011 5 Benefits of Recycling Paper. http://www.ways2gogreenblog.com/2011/09/28/5-benefits-of-recycling-paper/. Accessed 10 May 2016 Hari Goyal (2015 Grades of Paper. http://www.paperonweb.com/grade.htm. Accessed 2 April 2016 Hari Goyal (2015 Properties of Paper. http://www.paperonweb.com/paperpro.htm. Accessed 2 April 2016 Kathryn Sukalich (2016 Everything You Need to Know about Paper Recycling. http://earth911.com/business-policy/business/paper-recycling-details-basics/. Accessed 15 July 2016 [U1] Larry West (2015 Why Recycle Paper. http://environment.about.com/od/recycling/a/The-Benefits-Of-Paper-Recycling-Why-Recycle-Paper.htm. Accesed 15 June 2016 Marie-Luise Blue (2008 The Advantages of Recycling Paper. http://education.seattlepi.com/advantages-recycling-paper-3440.html. Accessed 15 June 2016 Nina Spitzer (2009 http://www.sheknows.com/home-and-gardening/articles/810025/the-impact-of-disposable-coffee-cups-on-the-environment. Accessed 15 June 2016 Radio New Zealand (2010 Iwi not Giving Up Fight against Tasman Mill Discharges. http://www.radionz.co.nz/news/regional/64521/iwi-not-giving-up-fight-against-tasman-mill-discharges. Accessed 15 July 2016 Rick LeBlanc (2016 Paper Recycling Facts, Figures and Information Sources. https://www.thebalance.com/paper-recycling-facts-figures-and-information-sources-2877868?_ga=1.192832942.544061388.1477446686. Accesed 2 April 2016 Robinson Meyer (2016 Will More Newspapers Go Nonprofit? http://www.theatlantic.com/technology/archive/2016/01/newspapers-philadelphia-inquirer-daily-news-nonprofit-lol-taxes/423960/. Accessed 3 August 2016 School of Engineering at Darthmouth (2010 Forest and Paper Industry. http://engineering.dartmouth.edu/~d30345d/courses/engs171/Paper.pdf. Accessed 2 April 2016 T. Subramani, V. Angappan. (2015. Experimental Investigation of Papercrete Concrete
Directory of Open Access Journals (Sweden)
Zhang TH
2015-07-01
Full Text Available TianHong Zhang,1 HuiJun Li,2,3 Kristen A Woodberry,3 Larry J Seidman,3 Annabelle Chow,4 ZePing Xiao,1 JiJun Wang1 1Shanghai Mental Health Center, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China; 2Department of Psychology, Florida A&M University, Tallahassee, FL, USA; 3Department of Psychiatry, Harvard Medical School, Beth Israel Deaconess Medical Center, Boston, MA, USA; 4Department of Psychological Medicine, Changi General Hospital, Singapore Abstract: Clinical high risk of psychosis is defined as the period in which the first signs of psychotic symptoms begin to appear. During this period, there is an increased probability of developing frank psychosis. It is crucial to investigate the interaction between psychotic symptoms and the individual’s personality and life experiences in order to effectively prevent, or delay the development of psychosis. This paper presents case reports of three Chinese female subjects with attenuated positive symptoms, attending their initial outpatient assessment in a mental health service, and their longitudinal clinical outcomes. Information regarding each subject’s symptoms and life stressors was collected at 2-month intervals over a 6-month period. The assessments indicated that these women were suffering from the recent onset of symptoms in different ways. However, all three hid their symptoms from others in their school or workplace, and experienced a decline in performance related to their social roles and in their daily functioning. They were often excluded from the social groups to which they had previously belonged. A decline in social activities may be a risk factor in the development of psychosis and a mediator of functional sequelae in psychosis. Effective treatment strategies may include those that teach individuals to gain insights related to their symptoms and a service that provides a context in which individuals can discuss their psychotic symptoms
2005-01-01
[figure removed for brevity, see original site] Click on the image for A Whale of a Panorama (QTVR) More than 1.5 years into their exploration of Mars, both of NASA's Mars Exploration Rovers continue to send a cornucopia of images to Earth. The results are so spectacular that Deputy Project Manager John Callas recently described them as 'an embarrassment of riches.' Spirit produced this image mosaic, nicknamed the 'Whale Panorama,' two-thirds of the way to the summit of 'Husband Hill,' where the rover investigated martian rocks. On the right side of the panorama is a tilted layer of rocks dubbed 'Larry's Outcrop,' one of several tilted outcrops that scientists examined in April, 2005. They used spatial information to create geologic maps showing the compass orientation and degree of tilting of rock formations in the vicinity. Such information is key to geologic fieldwork because it helps establish if rock layers have been warped since they formed. In this case, scientists have also been studying the mineral and chemical differences, which show that some rocks have been more highly altered than others. In the foreground, in the middle of the image mosaic, Spirit is shown with the scientific instruments at the end of its robotic arm positioned on a rock target known as 'Ahab.' The rover was busy collecting elemental chemistry and mineralogy data on the rock at the same time that it was taking 50 individual snapshots with its five panoramic camera filters to create this stunning view of the martian scenery. The twin tracks of the rover's all-terrain wheels are clearly visible on the left. This mosaic of images spans about 220 degrees from left to right and is an approximate true-color rendering of the Mars terrain acquired through the panoramic camera's 750-, 530-, and 430-nanometer filters. Spirit collected these images from its 497th martian day, or sol, through its 500th sol (May 27 through May 30, 2005).
Improving diabetes medication adherence: successful, scalable interventions
Directory of Open Access Journals (Sweden)
Zullig LL
2015-01-01
Full Text Available Leah L Zullig,1,2 Walid F Gellad,3,4 Jivan Moaddeb,2,5 Matthew J Crowley,1,2 William Shrank,6 Bradi B Granger,7 Christopher B Granger,8 Troy Trygstad,9 Larry Z Liu,10 Hayden B Bosworth1,2,7,11 1Center for Health Services Research in Primary Care, Durham Veterans Affairs Medical Center, Durham, NC, USA; 2Department of Medicine, Duke University, Durham, NC, USA; 3Center for Health Equity Research and Promotion, Pittsburgh Veterans Affairs Medical Center, Pittsburgh, PA, USA; 4Division of General Internal Medicine, University of Pittsburgh, Pittsburgh, PA, USA; 5Institute for Genome Sciences and Policy, Duke University, Durham, NC, USA; 6CVS Caremark Corporation; 7School of Nursing, Duke University, Durham, NC, USA; 8Department of Medicine, Division of Cardiology, Duke University School of Medicine, Durham, NC, USA; 9North Carolina Community Care Networks, Raleigh, NC, USA; 10Pfizer, Inc., and Weill Medical College of Cornell University, New York, NY, USA; 11Department of Psychiatry and Behavioral Sciences, Duke University School of Medicine, Durham, NC, USA Abstract: Effective medications are a cornerstone of prevention and disease treatment, yet only about half of patients take their medications as prescribed, resulting in a common and costly public health challenge for the US healthcare system. Since poor medication adherence is a complex problem with many contributing causes, there is no one universal solution. This paper describes interventions that were not only effective in improving medication adherence among patients with diabetes, but were also potentially scalable (ie, easy to implement to a large population. We identify key characteristics that make these interventions effective and scalable. This information is intended to inform healthcare systems seeking proven, low resource, cost-effective solutions to improve medication adherence. Keywords: medication adherence, diabetes mellitus, chronic disease, dissemination research
Axial lumbar interbody fusion: a 6-year single-center experience
Directory of Open Access Journals (Sweden)
Zeilstra DJ
2013-08-01
Full Text Available Dick J Zeilstra,1 Larry E Miller,2,3 Jon E Block3 1Bergman Clinics, Naarden and NedSpine, Ede, The Netherlands; 2Miller Scientific Consulting, Inc, Arden, NC, USA; 3The Jon Block Group, San Francisco, CA, USA Introduction: The aim of this study is to report our 6-year single-center experience with L5–S1 axial lumbar interbody fusion (AxiaLIF. Methods: A total of 131 patients with symptomatic degenerative disc disease refractory to nonsurgical treatment were treated with AxiaLIF at L5–S1, and were followed for a minimum of 1 year (mean: 21 months. Main outcomes included back and leg pain severity, Oswestry Disability Index score, working status, analgesic medication use, patient satisfaction, and complications. Computed tomography was used to determine postoperative fusion status. Results: No intraoperative complications, including vascular, neural, urologic, or bowel injuries, were reported. Back and leg pain severity decreased by 51% and 42%, respectively, during the follow-up period (both P < 0.001. Back function scores improved 50% compared to baseline. Clinical success, defined as improvement ≥30%, was 67% for back pain severity, 65% for leg pain severity, and 71% for back function. The employment rate increased from 47% before surgery to 64% at final follow-up (P < 0.001. Less than one in four patients regularly used analgesic medications postsurgery. Patient satisfaction with the AxiaLIF procedure was 83%. The fusion rate was 87.8% at final follow-up. During follow-up, 17 (13.0% patients underwent 18 reoperations on the lumbar spine, including pedicle screw fixation (n = 10, total disc replacement of an uninvolved level (n = 3, facet screw fixation (n = 3, facet screw removal (n = 1, and interbody fusion at L4–L5 (n = 1. Eight (6.1% reoperations were at the index level. Conclusion: Single-level AxiaLIF is a safe and effective means to achieve lumbosacral fusion in patients with symptomatic degenerative disc disease. Keywords: Axia
The Weather Guys - Discussing Science via regular Radio and Newspaper Appearances
Ackerman, S. A.; Martin, J. E.
2013-12-01
The University of Wisconsin has described the value of outreach through its Wisconsin Idea. Simply put it states that the boundaries of the university are the boundaries of the state. In addition to their research, teaching, and administration duties, they have routinely reached out to share their science with various public groups. Since 1998, Profs Jon Martin and Steve Ackerman, have be regular quests on the Larry Meiller show on Wisconsin Public Radio IDEAS Network. The format of the show is a live call-in show. They air as guests the last Monday of every month. The show is also web-cast live (http://www.wpr.org/), enabling questions to be called in on phone or sent via email. Archives can be found at http://www.wpr.org/webcasting/audioarchives_display.cfm?Code=mlr In 2008 they were asked to do a Q&A column for the regional Madison paper: The Wisconsin State Journal (WSJ). This is a weekly column that addresses readers questions in about 250 words. Example columns can be found in the WSJ e-book: http://www.amazon.com/Ask-Weather-Guys-2010-ebook/dp/B00AY4VMZE These two activities have earned them the nickname The Weather Guys, resulting in various speaking invitations including master gardener clubs and a Science Pub sponsored by Nova. Overall, these activities have been beneficial to our careers, earning name recognition across the University and throughout the state. They also provide learning opportunities for us through experiences described by the public. We will discuss our motivation and experiences in doing this live show and the weekly column, presenting personal stories of successful and less-successful communication attempts. A nearly complete archive exists or the live radio show and we will present an analysis of the type of questions asked and the more common, and less common, topics. The Weather Guys, an image developed by and for the Why?Files (http://whyfiles.org
Directory of Open Access Journals (Sweden)
John A D’Elia
2009-11-01
Full Text Available John A D’Elia, Bijan Roshan, Manish Maski, Larry A WeinrauchJoslin Diabetes Center, Renal Unit, Beth Israel Deaconess Medical Center, Department of Medicine, Mount Auburn Hospital, Harvard Medical School, Boston and Cambridge, MassachusettsAbstract: Albuminuria in individuals whose body mass index exceeds 40 kg/m2 is associated with the presence of large glomeruli, thickened basement membrane and epithelial cellular (podocyte distortion. Obstructive sleep apnea magnifies glomerular injury as well, probably through a vasoconstrictive mechanism. Insulin resistance from excess fatty acids is exacerbated by decreased secretion of high molecular weight adiponectin from adipose cells in the obese state. Adiponectin potentiates insulin in its post-receptor signaling resulting in glucose oxidation in mitochondria. Recent studies of podocyte physiology have concentrated on the structural and functional requirements that prevent glomerular albumin leakage. The architecture of the podocyte involves nephrin and podocin, proteins that cooperate to keep slit pores between foot processes competent to retain albumin. Insulin and adiponectin are necessary for high-energy phosphate generation. When fatty acids bind to albumin, the toxicity to proximal renal tubules is magnified. Albumin and fatty acids are elevated in urine of individuals with obesity related nephrotic syndrome. Fatty acid accumulation and resistin inhibit insulin and adiponectin. Study of cytokines produced by adipose tissue (adiponectin and leptin and macrophages (resistin has led to a better understanding of the relationship between weight and hypertension. Leptin, is presumably secreted after food intake to inhibit the midbrain/ hypothalamic appetite centers. Resistance to leptin results in excess signaling to hypothalamic sympathetics leading to hypertension. Demonstration of the existence of a cerebral receptor mutation provide evidence for a role in hypertension of a central nervous
Embedded Real-Time Linux for Instrument Control and Data Logging
Clanton, Sam; Gore, Warren J. (Technical Monitor)
2002-01-01
When I moved to the west. coast to take a job at NASA's Ames Research Center in Mountain View, CA, I was impressed with the variety of equipment and software which scientists at the center use to conduct their research. was happy to find that I was just as likely to see a machine running Lenox as one running Windows in the offices and laboratories of NASA Ames (although many people seem to use Moos around here). I was especially happy to find that the particular group with whom I was going to work, the Atmospheric Physics Branch at Ames, relied almost entirely on Lenox machines for their day-to-day work. So it was no surprise that when it was time to construct a new control system for one of their most important pieces of hardware, a switch from an unpredictable DOS-based platform to an Embedded Linux-based one was a decision easily made. The system I am working on is called the Solar Spectral Flux Radiometer (SSFR), a PC-104 based system custom-built by Dr. Warren Gore at Ames. Dr. Gore, Dr. Peter Pilewskie, Dr. Maura Robberies and Larry Pezzolo use the SSFR in their research. The team working on the controller project consists of Dr. Gore, John Pommier, and myself. The SSFR is used by the ,cities Atmospheric Radiation Group to measure solar spectral irradiance at moderate resolution to determine the radiative effect of clouds, aerosols, and gases on climate, and also to infer the physical properties of aerosols and clouds. Two identical SSFR's have been built and successfully deployed in three field missions: 1) the Department of Energy Atmospheric Radiation Measurement (ARM) Enhanced Shortwave Experiment (ARESE) II in February/March, 2000; 2) the Puerto Rico Dust Experiment (PRIDE) in July, 2000; and 3) the South African Regional Science Initiative (SAFARI) in August/September, 2000. Additionally, the SSFR was used to acquire water vapor spectra using the Ames Diameter base-path multiple-reflection absorption cell in a laboratory experiment.
Fernandes, João S; Gentile, Piergiorgio; Pires, Ricardo A; Reis, Rui L; Hatton, Paul V
2017-09-01
Bioactive glasses (BGs) and related glass-ceramic biomaterials have been used in bone tissue repair for over 30years. Previous work in this field was comprehensively reviewed including by their inventor Larry Hench, and the key features and properties of BGs are well understood. More recently, attention has focused on their modification to further enhance the osteogenic behaviour, or further compositional changes that may introduce additional properties, such as antimicrobial activity. Evidence is emerging that BGs and related glass-ceramics may be modified in such a way as to simultaneously introduce more than one desirable property. The aim of this review is therefore to consider the evidence that these more recent inorganic modifications to glass and glass-ceramic biomaterials are effective, and whether or not these new compositions represent sufficiently versatile systems to underpin the development of a new generation of truly multifunctional biomaterials to address pressing clinical needs in orthopaedic and dental surgery. Indeed, a number of classical glass compositions exhibited antimicrobial activity, however the structural design and the addition of specific ions, i.e. Ag + , Cu + , and Sr 2+ , are able to impart a multifunctional character to these systems, through the combination of, for example, bioactivity with bactericidal activity. In this review we demonstrate the multifunctional potential of bioactive glasses and related glass-ceramics as biomaterials for orthopaedic and craniofacial/dental applications. Therefore, it considers the evidence that the more recent inorganic modifications to glass and glass-ceramic biomaterials are able to impart antimicrobial properties alongside the more classical bone bonding and osteoconduction. These properties are attracting a special attention nowadays that bacterial infections are an increasing challenge in orthopaedics. We also focus the manuscript on the versatility of these systems as a basis to underpin
Krischer, Jeffrey; Cronholm, Peter F; Burroughs, Cristina; McAlear, Carol A; Borchin, Renee; Easley, Ebony; Davis, Trocon; Kullman, Joyce; Carette, Simon; Khalidi, Nader; Koening, Curry; Langford, Carol A; Monach, Paul; Moreland, Larry; Pagnoux, Christian; Specks, Ulrich; Sreih, Antoine G; Ytterberg, Steven; Merkel, Peter A
2017-02-28
The target sample size for clinical trials often necessitates a multicenter (center of excellence, CoE) approach with associated added complexity, cost, and regulatory requirements. Alternative recruitment strategies need to be tested against this standard model. The aim of our study was to test whether a Web-based direct recruitment approach (patient-centric, PC) using social marketing strategies provides a viable option to the CoE recruitment method. PC recruitment and Web-based informed consent was compared with CoE recruitment for a randomized controlled trial (RCT) of continuing versus stopping low-dose prednisone for maintenance of remission of patients with granulomatosis with polyangiitis (GPA). The PC approach was not as successful as the CoE approach. Enrollment of those confirmed eligible by their physician was 10 of 13 (77%) and 49 of 51 (96%) in the PC and CoE arms, respectively (P=.05). The two approaches were not significantly different in terms of eligibility with 34% of potential participants in the CoE found to be ineligible as compared with 22% in the PC arm (P=.11) nor in provider acceptance, 22% versus 26% (P=.78). There was no difference in the understanding of the trial as reflected in the knowledge surveys of individuals in the PC and CoE arms. PC recruitment was substantially less successful than that achieved by the CoE approach. However, the PC approach was good at confirming eligibility and was as acceptable to providers and as understandable to patients as the CoE approach. The PC approach should be evaluated in other clinical settings to get a better sense of its potential. ©Jeffrey Krischer, Peter F Cronholm, Cristina Burroughs, Carol A McAlear, Renee Borchin, Ebony Easley, Trocon Davis, Joyce Kullman, Simon Carette, Nader Khalidi, Curry Koening, Carol A Langford, Paul Monach, Larry Moreland, Christian Pagnoux, Ulrich Specks, Antoine G Sreih, Steven Ytterberg, Peter A Merkel, Vasculitis Clinical Research Consortium. Originally
Fetal alcohol exposure and development of the integument
Directory of Open Access Journals (Sweden)
Longhurst WD
2016-05-01
Full Text Available William D Longhurst,1 Jordan Ernst,2 Larry Burd3 1Center for Emergency Medicine, University Hospitals Case Medical Center, Case Western Reserve University, Cleveland, OH, USA; 2University of North Dakota School of Medicine and Health Sciences, Grand Forks, ND, USA; 3Department of Pediatrics, North Dakota Fetal Alcohol Syndrome Center, University of North Dakota School of Medicine and Health Sciences, Grand Forks, ND, USA Background: The physiology of fetal alcohol exposure changes across gestation. Early in pregnancy placental, fetal, and amniotic fluid concentrations of alcohol exposure are equivalent. Beginning in mid-pregnancy, the maturing fetal epidermis adds keratins which decrease permeability resulting in development of a barrier between fetal circulation and the amniotic fluid. Barrier function development is essential for viability in late pregnancy and in the extra-uterine environment. In this paper we provide a selected review of the effects of barrier function on fetal alcohol exposure. Methods: We utilized a search of PubMed and Google for all years in all languages for MeSH on Demand terms: alcohol drinking, amnion, amniotic fluid, epidermis, ethanol, female, fetal development, fetus, humans, keratins, permeability, and pregnancy. We also reviewed the reference lists of relevant papers and hand-searched reference lists of textbooks for additional references. Results: By 30 gestational weeks, development of barrier function alters the pathophysiology of ethanol dispersion between the fetus and amniotic fluid. Firstly, increases in the effectiveness of barrier function decreases the rate of diffusion of alcohol from fetal circulation across fetal skin into the amniotic fluid. This reduces the volume of alcohol entering the amniotic fluid. Secondly, barrier function increases the duration of fetal exposure by decreasing the rate of alcohol diffusion from amniotic fluid back into fetal circulation. Ethanol is then transported into
Medical Devices Assess, Treat Balance Disorders
2009-01-01
You may have heard the phrase as difficult as walking and chewing gum as a joking way of referring to something that is not difficult at all. Just walking, however, is not all that simple physiologically speaking. Even standing upright is an undertaking requiring the complex cooperation of multiple motor and sensory systems including vision, the inner ear, somatosensation (sensation from the skin), and proprioception (the sense of the body s parts in relation to each other). The compromised performance of any of these elements can lead to a balance disorder, which in some form affects nearly half of Americans at least once in their lifetimes, from the elderly, to those with neurological or vestibular (inner ear) dysfunction, to athletes with musculoskeletal injuries, to astronauts returning from space. Readjusting to Earth s gravity has a significant impact on an astronaut s ability to balance, a result of the brain switching to a different "model" for interpreting sensory input in normal gravity versus weightlessness. While acclimating, astronauts can experience headaches, motion sickness, and problems with perception. To help ease the transition and study the effects of weightlessness on the body, NASA has conducted many investigations into post-flight balance control, realizing this research can help treat patients with balance disorders on Earth as well. In the 1960s, the NASA-sponsored Man Vehicle Laboratory at the Massachusetts Institute of Technology (MIT) studied the effects of prolonged space flight on astronauts. The lab s work intrigued MIT doctoral candidate Lewis Nashner, who began conducting NASA-funded research on human movement and balance under the supervision of Dr. Larry Young in the MIT Department of Aeronautics and Astronautics. In 1982, Nashner s work resulted in a noninvasive clinical technique for assessing the cooperative systems that allow the body to balance, commonly referred to as computerized dynamic posturography (CDP). CDP employs a
2017-05-01
Reports an error in "The New History of Psychology: Some (Different) Answers to Lovett's Five Questions" by Adrian C. Brock ( History of Psychology , Advanced Online Publication, Jun 27, 2016, np). In this article there was an error in the 11th paragraph of the Lovett's Five Questions for the New Historians section. The conference paper "The "new" history of science: Implications for philosophy of science" by Rachel Laudan (1992) was wrongly attributed to her husband, Larry Laudan. All versions of this article have been corrected. (The following abstract of the original article appeared in record 2016-31594-001.) The professionalization of the history of psychology from the 1960s led to significant changes in the way that history was written. Several authors tried to summarize these changes in the 1980s, and Laurel Furumoto's (1989) G. Stanley Hall lecture, "The new history of psychology" is the best-known example of this genre. This journal published a critique of the new history by Benjamin R. Lovett (2006) with the title, "The new history of psychology: A review and critique," and it is still being cited as an authoritative source. The article consists of 3 parts. First, the author attempts to show that the new history is not as different from the old as its proponents claim. He then discusses some problems that he considers to be unique to the new history, and he presents them in the form of 5 questions for the new historians, which he then goes on to answer himself. Finally, he discusses the problematic relationship between critical history and psychology. This article is a reply to Lovett's article. The author argues that the new history is different from the old in every way that Lovett claims that it is not. It critically analyzes Lovett's answers to his own 5 questions and offers some alternative answers to these questions. It also suggests that many psychologist-historians are opposed to new history of psychology, especially in its critical versions, and
Directory of Open Access Journals (Sweden)
Cheng Wei-Cheng
2006-12-01
Full Text Available Abstract Background Anatomical studies of neural circuitry describing the basic wiring diagram of the brain produce intrinsically spatial, highly complex data of great value to the neuroscience community. Published neuroanatomical atlases provide a spatial framework for these studies. We have built an informatics framework based on these atlases for the representation of neuroanatomical knowledge. This framework not only captures current methods of anatomical data acquisition and analysis, it allows these studies to be collated, compared and synthesized within a single system. Results We have developed an atlas-viewing application ('NeuARt II' in the Java language with unique functional properties. These include the ability to use copyrighted atlases as templates within which users may view, save and retrieve data-maps and annotate them with volumetric delineations. NeuARt II also permits users to view multiple levels on multiple atlases at once. Each data-map in this system is simply a stack of vector images with one image per atlas level, so any set of accurate drawings made onto a supported atlas (in vector graphics format could be uploaded into NeuARt II. Presently the database is populated with a corpus of high-quality neuroanatomical data from the laboratory of Dr Larry Swanson (consisting 64 highly-detailed maps of PHAL tract-tracing experiments, made up of 1039 separate drawings that were published in 27 primary research publications over 17 years. Herein we take selective examples from these data to demonstrate the features of NeuArt II. Our informatics tool permits users to browse, query and compare these maps. The NeuARt II tool operates within a bioinformatics knowledge management platform (called 'NeuroScholar' either as a standalone or a plug-in application. Conclusion Anatomical localization is fundamental to neuroscientific work and atlases provide an easily-understood framework that is widely used by neuroanatomists and non
Water Resource Impacts During Unconventional Shale Gas Development: The Pennsylvania Experience
Brantley, S. L.; Yoxtheimer, D.; Arjmand, S.; Grieve, P.; Vidic, R.; Abad, J. D.; Simon, C. A.; Pollak, J.
2013-12-01
The number of unconventional Marcellus shale wells in PA has increased from 8 in 2005 to more than 6000 today. This rapid development has been accompanied by environmental issues. We analyze publicly available data describing this Pennsylvania experience (data from www.shalenetwork.org and PA Department of Environmental Protection, i.e., PA DEP). After removing permitting and reporting violations, the average percent of wells/year with at least one notice of violation (NOV) from PA DEP is 35 %. Most violations are minor. An analysis of NOVs reported for wells drilled before 2013 revealed a rate of casing, cement, or well construction issues of 3.4%. Sixteen wells were given notices specifically related to migration of methane. A similarly low percent of wells were contaminated by brine components. Such contamination could derive from spills, subsurface migration of flowback water or shallow natural brines, or contamination by drill cuttings. Most cases of contamination of drinking water supplies with methane or brine components were reported in the previously glaciated part of the state. Before 2011, flowback and production water was often discharged legally into streams after minimal treatment, possibly increasing dissolved Br concentrations in some rivers. The rate of large spills or releases of gas-related industrial wastes in the state peaked in 2009 but little evidence of spills has been found in publicly available surface water chemistry data. The most likely indicators of spillage or subsurface release of flowback or production waters are the dissolved ions Na, Ca, and Cl. However, the data coverage for any given analyte is generally spatially and temporally sparse. Publicly available water quality data for before and after spills into Larrys Creek and Bobs Creek document the difficulties of detecting such events. An observation from the Pennsylvania experience is that the large number of people who have complained about their water supply (~1000 letters
Directory of Open Access Journals (Sweden)
Miller LE
2016-03-01
Full Text Available Larry E Miller,1 Angela K Zimmermann,1 William G Herbert,1,2 1Miller Scientific Consulting, Inc., Asheville, NC, 2Department of Human Nutrition, Foods, and Exercise, Virginia Tech, Blacksburg, VA, USA Background: Powered exoskeletons are designed to safely facilitate ambulation in patients with spinal cord injury (SCI. We conducted the first meta-analysis of the available published research on the clinical effectiveness and safety of powered exoskeletons in SCI patients. Methods: MEDLINE and EMBASE databases were searched for studies of powered exoskeleton-assisted walking in patients with SCI. Main outcomes were analyzed using fixed and random effects meta-analysis models. Results: A total of 14 studies (eight ReWalk™, three Ekso™, two Indego®, and one unspecified exoskeleton representing 111 patients were included in the analysis. Training programs were typically conducted three times per week, 60–120 minutes per session, for 1–24 weeks. Ten studies utilized flat indoor surfaces for training and four studies incorporated complex training, including walking outdoors, navigating obstacles, climbing and descending stairs, and performing activities of daily living. Following the exoskeleton training program, 76% of patients were able to ambulate with no physical assistance. The weighted mean distance for the 6-minute walk test was 98 m. The physiologic demand of powered exoskeleton-assisted walking was 3.3 metabolic equivalents and rating of perceived exertion was 10 on the Borg 6–20 scale, comparable to self-reported exertion of an able-bodied person walking at 3 miles per hour. Improvements in spasticity and bowel movement regularity were reported in 38% and 61% of patients, respectively. No serious adverse events occurred. The incidence of fall at any time during training was 4.4%, all occurring while tethered using a first-generation exoskeleton and none resulting in injury. The incidence of bone fracture during training was 3
Directory of Open Access Journals (Sweden)
Miller LE
2014-07-01
Full Text Available Larry E Miller,1 Julia Tennilä,2 Arthur C Ouwehand21Miller Scientific Consulting, Inc., Asheville, North Carolina, USA; 2Danisco Sweeteners Oy, Active Nutrition, Kantvik, FinlandBackground: Constipation is a common complaint in adults. Lactitol is an osmotic disaccharide laxative that increases fecal volume and stimulates peristalsis. In this paper, we present the first meta-analysis on the efficacy and tolerance of lactitol for adult constipation.Methods: We searched MEDLINE® and Embase, with no date or language restrictions, for studies of lactitol supplementation on adult constipation. A random-effects meta-analysis was performed on pre- to posttreatment changes in stool frequency and consistency with lactitol among all studies, as well as a comparison of efficacy and tolerance outcomes in randomized controlled trials (RCTs of lactitol versus lactulose.Results: A total of eleven studies representing 663 distinct patients were included in the final analysis, including five single-arm studies, four RCTs comparing lactitol with lactulose, one RCT comparing lactitol with placebo, and one nonrandomized controlled trial comparing lactitol with stimulant laxatives. Weekly stool frequency was significantly increased with lactitol compared with baseline (standardized mean difference [SMD]: 1.56, P<0.001. Stool consistency also improved over the supplementation period with lactitol (SMD: 1.04, P<0.001. Approximately one-third of patients experienced an adverse event; however, symptoms were generally mild and rarely (5% resulted in study withdrawal. In RCTs of lactitol versus lactulose, lactitol was slightly more effective than lactulose in increasing weekly stool frequency (SMD: 0.19, P=0.06. No statistically significant differences between lactitol and lactulose were identified in any other efficacy or tolerance outcome. Lactitol demonstrated favorable efficacy and tolerance in individual studies when compared to stimulant laxatives and placebo
Brooks, Colin; Bourgeau-Chavez, Laura; Endres, Sarah; Battaglia, Michael; Shuchman, Robert
2015-01-01
Primary Goal: Assist with the evaluation and measuring of wetlands hydroperiod at the PlumBrook Station using multi-source remote sensing data as part of a larger effort on projecting climate change-related impacts on the station's wetland ecosystems. MTRI expanded on the multi-source remote sensing capabilities to help estimate and measure hydroperiod and the relative soil moisture of wetlands at NASA's Plum Brook Station. Multi-source remote sensing capabilities are useful in estimating and measuring hydroperiod and relative soil moisture of wetlands. This is important as a changing regional climate has several potential risks for wetland ecosystem function. The year two analysis built on the first year of the project by acquiring and analyzing remote sensing data for additional dates and types of imagery, combined with focused field work. Five deliverables were planned and completed: 1) Show the relative length of hydroperiod using available remote sensing datasets 2) Date linked table of wetlands extent over time for all feasible non-forested wetlands 3) Utilize LIDAR data to measure topographic height above sea level of all wetlands, wetland to catchment area radio, slope of wetlands, and other useful variables 4) A demonstration of how analyzed results from multiple remote sensing data sources can help with wetlands vulnerability assessment 5) A MTRI style report summarizing year 2 results. This report serves as a descriptive summary of our completion of these our deliverables. Additionally, two formal meetings were held with Larry Liou and Amanda Sprinzl to provide project updates and receive direction on outputs. These were held on 2/26/15 and 9/17/15 at the Plum Brook Station. Principal Component Analysis (PCA) is a multivariate statistical technique used to identify dominant spatial and temporal backscatter signatures. PCA reduces the information contained in the temporal dataset to the first few new Principal Component (PC) images. Some advantages of PCA
Directory of Open Access Journals (Sweden)
Savoie III FH
2016-10-01
Full Text Available Felix H Savoie III,1 Mark Zunkiewicz,2 Larry D Field,2 William H Replogle,3 Michael J O’Brien1 1Tulane Institute of Sports Medicine, Tulane University School of Medicine, New Orleans, LA, USA; 2Mississippi Sports Medicine and Orthopaedic Center, Jackson, MS, USA; 3Department of Family Medicine, University of Mississippi Medical Center, Jackson, MS, USA Purpose: This study was designed to compare functional outcomes in patients undergoing revision repair of massive rotator cuff tears (retracted medial to the glenoid with Goutallier Grade 4 atrophy and concomitant release of the suprascapular nerve to a similar group of patients with Grade 3 atrophy undergoing revision rotator cuff repair (RTCR without nerve release. We hypothesized that patients undergoing nerve release would have more favorable functional outcomes as measured by the Modified University of California at Los Angeles shoulder rating scale (UCLA. Patients and methods: Twenty-two patients underwent revision repair of massive rotator cuff tears with release of the suprascapular nerve at the suprascapular notch. We compared total preoperative, postoperative, and change in UCLA score in these patients to a similar group of 22 patients undergoing revision RTCR without suprascapular nerve release. Additionally, UCLA subscores between the two groups were compared preoperatively and at final follow-up. Results: The average preoperative UCLA score in the nerve-release group was 7.91, and final follow-up average was 27.86; average 3.05 grades of strength were recovered. In the comparison group, average preoperative UCLA score was 11.77, and final follow-up average was 29.09; average 1.32 grades of strength were recovered. The average preoperative UCLA score was significantly worse in the nerve-release group (P=0.007. The average postoperative UCLA score was not significantly different (P=0.590 between the groups, indicating a better improvement in the nerve-release group with significantly
Directory of Open Access Journals (Sweden)
Amresh Shrivastava
2010-09-01
Full Text Available Amresh Shrivastava1, Megan E Johnston2, Nilesh Shah3, Marco Innamorati4, Larry Stitt5, Meghana Thakar3, David Lester6, Maurizio Pompili4,71Silver Mind Hospital and Mental Health Foundation of India, Mumbai, India; 2Department of Psychology, University of Toronto, Toronto, ON, Canada; 3Lokmanya Tilak Municipal General Hospital, University of Mumbai, India; 4Department of Neurosciences, Mental Health and Sensory Functions, Suicide Prevention Center, Sant’Andrea Hospital, Sapienza University of Rome, Rome, Italy; 5Department of Biostatistics, The University of Western Ontario, London, ON, Canada; 6The Richard Stockton College of New Jersey, Pomona, NJ, USA; 7McLean Hospital, Harvard Medical School, Boston, MA, USABackground: Suicide is a major problem in schizophrenia, estimated to affect 9%–13% of patients. About 25% of schizophrenic patients make at least one suicide attempt in their lifetime. Current outcome measures do not address this problem, even though it affects quality of life and patient safety. The aim of this study was to assess suicidality in long-term clinically improved schizophrenia patients who were treated in a nongovernmental psychiatric treatment centre in Mumbai, India.Method: Participants were 61 patients out of 200 consecutive hospitalized first-episode patients with schizophrenia diagnosed according to the Diagnostic and Statistical Manual of Mental Disorders who were much improved on the Clinical Global Impression Scale-Improvement (CGI-I scale at the endpoint of a 10-year follow-up. Clinical assessment tools included the Positive and Negative Syndrome Scale for Schizophrenia, CGI-I, Global Assessment of Functioning, and suicidality.Results: Many of the patients, although clinically improved, experienced emerging suicidality during the 10-year follow-up period. All of the patients reported significant suicidality (ie, suicide attempts, suicidal crises, or suicidal ideation at the end of the study, whereas only 83% had
The Society of Brains: How Alan Turing and Marvin Minsky Were Both Right
Struzik, Zbigniew R.
2015-04-01
In his well-known prediction, Alan Turing stated that computer intelligence would surpass human intelligence by the year 2000. Although the Turing Test, as it became known, was devised to be played by one human against one computer, this is not a fair setup. Every human is a part of a social network, and a fairer comparison would be a contest between one human at the console and a network of computers behind the console. Around the year 2000, the number of web pages on the WWW overtook the number of neurons in the human brain. But these websites would be of little use without the ability to search for knowledge. By the year 2000 Google Inc. had become the search engine of choice, and the WWW became an intelligent entity. This was not without good reason. The basis for the search engine was the analysis of the ’network of knowledge’. The PageRank algorithm, linking information on the web according to the hierarchy of ‘link popularity’, continues to provide the basis for all of Google's web search tools. While PageRank was developed by Larry Page and Sergey Brin in 1996 as part of a research project about a new kind of search engine, PageRank is in its essence the key to representing and using static knowledge in an emergent intelligent system. Here I argue that Alan Turing was right, as hybrid human-computer internet machines have already surpassed our individual intelligence - this was done around the year 2000 by the Internet - the socially-minded, human-computer hybrid Homo computabilis-socialis. Ironically, the Internet's intelligence also emerged to a large extent from ‘exploiting’ humans - the key to the emergence of machine intelligence has been discussed by Marvin Minsky in his work on the foundations of intelligence through interacting agents’ knowledge. As a consequence, a decade and a half decade into the 21st century, we appear to be much better equipped to tackle the problem of the social origins of humanity - in particular thanks to the
Origin and Evolution of the Elements
McWilliam, Andrew; Rauch, Michael
2004-09-01
Introduction; List of participants; 1. Mount Wilson Observatory contributions to the study of cosmic abundances of the chemical elements George W. Preston; 2. Synthesis of the elements in stars: B2FH and beyond E. Margaret Burbidge; 3. Stellar nucleosynthesis: a status report 2003 David Arnett; 4. Advances in r-process nucleosynthesis John J. Cowan and Christopher Sneden; 5. Element yields of intermediate-mass stars Richard B. C. Henry; 6. The impact of rotation on chemical abundances in red giant branch stars Corinne Charbonnel; 7. s-processing in AGB stars and the composition of carbon stars Maurizio Busso, Oscar Straniero, Roberto Gallino, and Carlos Abia; 8. Models of chemical evolution Francesca Matteucci; 9. Model atmospheres and stellar abundance analysis Bengt Gustafsson; 10. The light elements: lithium, beryllium, and boron Ann Merchant Boesgaard; 11. Extremely metal-poor stars John E. Norris; 12. Thin and thick galactic disks Poul E. Nissen; 13. Globular clusters and halo field stars Christopher Sneden, Inese I. Ivans and Jon P. Fulbright; 14. Chemical evolution in ω Centauri Verne V. Smith; 15. Chemical composition of the Magellanic Clouds, from young to old stars Vanessa Hill; 16. Detailed composition of stars in dwarf spheroidal galaxies Matthew D. Shetrone; 17. The evolutionary history of Local Group irregular galaxies Eva K. Grebel; 18. Chemical evolution of the old stellar populations of M31 R. Michael Rich; 19. Stellar winds of hot massive stars nearby and beyond the Local Group Fabio Bresolin and Rolf P. Kudritzki; 20. Presolar stardust grains Donald D. Clayton and Larry R. Nittler; 21. Interstellar dust B. T. Draine; 22. Interstellar atomic abundances Edward B. Jenkins; 23. Molecules in the interstellar medium Tommy Wiklind; 24. Metal ejection by galactic winds Crystal L. Martin; 25. Abundances from the integrated light of globular clusters and galaxies Scott C. Trager; 26. Abundances in spiral and irregular galaxies Donald R. Garnett; 27
Directory of Open Access Journals (Sweden)
Str
2015-05-01
Full Text Available Vibeke Strand,1 Louis F McIntyre,2 William R Beach,3 Larry E Miller,4,5 Jon E Block5 1Stanford University School of Medicine, Palo Alto, CA, USA; 2New York University Medical Center, White Plains, NY, USA; 3Tuckahoe Orthopaedics, Richmond, VA, USA; 4Miller Scientific Consulting, Inc., Asheville, NC, USA; 5The Jon Block Group, San Francisco, CA, USA Background: Intra-articular injection of hyaluronic acid is a common, yet controversial, therapeutic option for patients with knee osteoarthritis (OA. The purpose of this research was to determine the safety and efficacy of US-approved viscosupplements for symptomatic knee OA. Methods: We searched MedLine and EMBase for randomized, sham-controlled trials evaluating safety and/or clinical efficacy of US-approved viscosupplements in patients with symptomatic knee OA. Knee pain severity and knee joint function were assessed at 4 to 13 weeks and 14 to 26 weeks. Safety outcomes included serious adverse events, treatment-related serious adverse events, patient withdrawal, and adverse event-related patient withdrawal occurring at any time during follow-up. Results: A total of 29 studies representing 4,866 unique patients (active: 2,673, control: 2,193 were included. All sham-controlled trials used saline injections as a control. Viscosupplementation resulted in very large treatment effects between 4 and 26 weeks for knee pain and function compared to preinjection values, with standardized mean difference values ranging from 1.07 to 1.37 (all P<0.001. Compared to controls, standardized mean difference with viscosupplementation ranged from 0.38 to 0.43 for knee pain and 0.32 to 0.34 for knee function (all P<0.001. There were no statistically significant differences between viscosupplementation and controls for any safety outcome, with absolute risk differences of 0.7% (95% confidence interval [CI]: –0.2 to 1.5% for serious adverse events, 0% (95% CI: –0.4 to 0.4% for treatment-related serious adverse
Mundinano, Inaki-Carril; Chen, Juan; de Souza, Mitchell; Sarossy, Marc G; Joanisse, Marc F; Goodale, Melvyn A; Bourne, James A
2017-11-13
Injury to the primary visual cortex (V1, striate cortex) and the geniculostriate pathway in adults results in cortical blindness, abolishing conscious visual perception. Early studies by Larry Weiskrantz and colleagues demonstrated that some patients with an occipital-lobe injury exhibited a degree of unconscious vision and visually-guided behaviour within the blind field. A more recent focus has been the observed phenomenon whereby early-life injury to V1 often results in the preservation of visual perception in both monkeys and humans. These findings initiated a concerted effort on multiple fronts, including nonhuman primate studies, to uncover the neural substrate/s of the spared conscious vision. In both adult and early-life cases of V1 injury, evidence suggests the involvement of the Middle Temporal area (MT) of the extrastriate visual cortex, which is an integral component area of the dorsal stream and is also associated with visually-guided behaviors. Because of the limited number of early-life V1 injury cases for humans, the outstanding question in the field is what secondary visual pathways are responsible for this extraordinary capacity? Here we report for the first time a case of a child (B.I.) who suffered a bilateral occipital-lobe injury in the first two weeks postnatally due to medium-chain acyl-Co-A dehydrogenase deficiency. At 6 years of age, B.I. underwent a battery of neurophysiological tests, as well as structural and diffusion MRI and ophthalmic examination at 7 years. Despite the extensive bilateral occipital cortical damage, B.I. has extensive conscious visual abilities, is not blind, and can use vision to navigate his environment. Furthermore, unlike blindsight patients, he can readily and consciously identify happy and neutral faces and colors, tasks associated with ventral stream processing. These findings suggest significant re-routing of visual information. To identify the putative visual pathway/s responsible for this ability, MRI
Directory of Open Access Journals (Sweden)
Miller LE
2017-05-01
Full Text Available Larry E Miller,1 Michael J Sloniewsky,2 Thomas E Gibbons,3 Janice G Johnston,4 Kent D Vosler,4 Saad Nasir5 1Miller Scientific Consulting, Inc., Asheville, NC, 2RMG Holding, Inc., Florence, 3Doctors Care, PA, Columbia, SC, 4Arrowhead Health Centers, Glendale, AZ, 5Fidia Pharma USA Inc., Parsippany, NJ, USA Background: Given the poor long-term effectiveness of focused nonsurgical knee osteoarthritis (OA treatments, alternative therapies are needed for patients who have unsuccessfully exhausted nonsurgical options.Methods: A telephone interview was conducted in patients who participated in a single 8-week multimodal knee OA treatment program (mean follow-up: 3.7 years, range: 2.7–4.9 years. The program consisted of five intra-articular knee injections of sodium hyaluronate (Hyalgan®, with each injection given 1 week apart, structured physical therapy, knee bracing, and patient education. Clinical outcomes included knee pain severity, Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC subscores, current medication use, and history of total knee arthroplasty. Base-case, subgroup, and sensitivity analyses were conducted to determine the incremental cost-effectiveness ratio (ICER of the treatment program with comparisons made to historical literature controls undergoing usual care. Results: A total of 218 patients (54% provided long-term follow-up data. Knee pain severity decreased 60% and WOMAC subscores decreased 33%–42% compared to baseline (all p<0.001. Total knee arthroplasty was performed in 22.8% (81/356 of knees during follow-up. The treatment program was highly cost-effective compared to usual care with a base-case ICER of $6,000 per quality-adjusted life year (QALY. Results of subgroup analyses, one-way deterministic sensitivity analyses, and second-order probabilistic sensitivity analyses resulted in ICERs ranging from $3,996 to $10,493 per QALY. The percentage of simulations with an ICER below willingness
Directory of Open Access Journals (Sweden)
Marco daCosta DiBonaventura
2010-11-01
Full Text Available Marco daCosta DiBonaventura1, Jan-Samuel Wagner1, Cynthia J Girman2, Kimberly Brodovicz2, Qiaoyi Zhang3, Ying Qiu3, Sri-Ram Pentakota3, Larry Radican31Health Sciences Practice, Kantar Health, New York; 2Epidemiology, 3Global Health Outcomes, Merck, Whitehouse Station, New Jersey, USABackground: The prevalence of Type 2 diabetes mellitus continues to rise. Although glucagon-like peptide-1 (GLP-1 analog and dipeptidyl peptidase-4 (DPP-4 inhibitor medications are effective, there are differences between these products, including method of administration (injectable versus oral. The objective of this study was to examine patient preferences (and predictors of preferences for two different medication profiles, one similar to a GLP-1 analog (liraglutide and another similar to a DPP-4 inhibitor (sitagliptin.Methods: Internet survey data were collected in two waves (wave 1, n = 2402; wave 2, n = 1340 using patients from the US and Europe. Patients were presented with two hypothetical medication profiles (“drug A” and “drug B”, resembling sitagliptin and liraglutide, respectively and asked to report their preferences.Results: Most patients in wave 1 and wave 2 reported that overall they would prefer a drug with the sitagliptin-like profile (81.9% and 84.4%, respectively over a drug with the liraglutide-like profile (18.1% and 15.6%, respectively, and >80% of patients reported that they would be able to take a drug with the sitagliptin-like profile as directed by their physician for a longer period. The likelihood of preferring the sitagliptin-like profile significantly increased as age (odds ratio [OR] = 1.02 and importance placed on method of administration (OR = 1.32 increased (P < 0.05. Although the sitagliptin-like profile was preferred by the majority of patients in all subgroups, a lower proportion of patients with obesity, with weight gain, with A1C values above target, and who exercised preferred the sitagliptin-like profile compared with
Benthic Community Composition and Seabed Characteristics of a Chukchi Sea Pockmark
MacDonald, I. R.; Bluhm, B.; Iken, K.; Gagaev, S.; Robinson, S.
2005-12-01
Several dozen seafloor features were mapped by Larry Mayer and his colleagues using swath bathymetry during a 2003 cruise with the USCGC HEALY near the eastern edge of the Chukchi Plateau (Chukchi Sea 76.6N, 163.9W). These were sub-circular depressions ranging from approximately 250 to over 1000m in width, with depths of up to 50m below the surrounding seabed, and situated in water depths from 500 to 950m. The origin of these features was undetermined, but one possibility was that they were pockmarks formed as a result of gas or fluid expulsion processes. We report here on benthic sampling undertaken at one of these pockmarks on 18 July 2005, also from USCGC HEALY. This elongated feature had maximum water depth of approximately 940m, was 1200m in maximum width, and was depressed approximately 40m below the surrounding seabed. The ocean in the vicinity of the pockmark was heavily ice-covered, which tightly restricted the ship's mobility during sampling operations. We used an ROV to collect and photograph the benthic epifauna during a 6h transit that crossed from the outside of the pockmark to near the center over a distance of 900m. We used a down-looking digital camera to collect over 800 pictures of the benthos at altitudes of 2 to 3m above the seabed. We also collected three cores with a 25x25cm box corer. Our investigations did not provide any direct evidence for gas or fluid flux through the seabed of this feature. Neither did we see any secondary indications of methane flux such as authigenic carbonates or bacterial mats. The abundance and diversity of benthic epifauna at this station was the highest among 8 stations sampled using similar methods during a 30 day cruise. The ROV observed brittle stars, various types of anemones, shrimps, eel pouts, stalked crinoids, benthic ctenophore (likely new species), burrows and mounts, gooseneck barnacles, mysids. Holothurians (c.f. Peneagone sp.) were the single most abundant group and were often photographed in
Energy Technology Data Exchange (ETDEWEB)
Vent-Schmidt, Thomas
2015-11-30
During this thesis, the matrix-isolation technique in conjuction with quantum-chemical calculations has been employed in order to synthesize and characterize new compounds. The focus of the study were new species of the actinide and lanthanide series, but the photochemistry of XeO{sub 4} and the polyfluorides were also investigated. Based on the experience of laser ablated uranium and thorium atoms with H{sub 2} and F{sub 2} the reaction of these actinide atoms with HF has been investigated. The main products in these experiments are HThF and HUF which contain an actinide metal in the rather scarce +II oxidation state. In addition, the deuterated compounds have also been prepared and the isotopic shifts support the assignment. The higher hydride fluorides of thorium such as HThF{sub 3}, H{sub 2}ThF{sub 2} and H{sub 3}ThF have also been observed, whereas there is only little evidence for higher uranium hydride fluorides. The different behavior of the two metals under similar reaction conditions has been investigated theoretically. Besides the hydride fluorides, the reaction of the actinide atoms with HF gives also rise to the low valent fluorides and hydrides such as AnH and AnF (An = U, Th). These compounds have already been identified in experiments using fluorine or hydrogen as reagent, but a more reliable assignment can be made in these experiments due to the lower concentration of H or F. In addition, ThF{sub 2} has been observed in these experiments and there is evidence for the unknown difluoride of uranium, which will be addressed in a future paper. Experiments with laser ablated uranium and thorium atoms were extended to the reaction of these metals with H{sub 2}Se. Previous experiments using H{sub 2}O and H{sub 2}S instead of H{sub 2}Se yielded H{sub 2}AnX (An = U, Th; X = O, S) compounds which show evidence for an actinide-chalcogenide multiple bond. The new synthesized species H{sub 2}ThSe and H{sub 2}USe are characterized by their symmetric and
Morphometric analysis of the Marmara Sea river basins, Turkey
Elbaşı, Emre; Ozdemir, Hasan
2014-05-01
(GIS). This study shows that morphometric analysis of the basins in regional level are very important to understand general morphological characteristics of the basins. In this case, tectonic and lithological conditions of the basins have greatly affected the morphometric characteristics of the north and south basins of the Marmara Sea. References Abrahams, AD. 1984. Channel Networks: A Geomorphological Perspective. Water Resources Research, Volume 20, Issue 2, pages 161-188. Horton, R.E. 1932. Drainage basin characteristics. Trans Am Geophys Union 13:350-361. Keller, E.A., Pinter, N. 2002. Active Tectonics Earthquakes, Uplift, and Landscape, Second Edition, Prentice Hall, New Jersey. Ozdemir H., Bird D. 2009. Evaluation of morphometric parameters of drainage networks derived from topographic maps and DEM in point of floods, Environmental Geology, vol.56, pp.1405-1415. Schumm, S.A. 1956. Evolution of drainage systems and slopes in badlands at Perth Amboy, New Jersey. Geol Soc Am Bull 67:597-646. Strahler, A.N. 1957. Quantitative geomorphology of drainage and channel networks. In: Chow YT (ed) Handbook of appliecl hydrology. Me Graw Hill Book Company, New York. Verstappen, H.Th. 1983. Applied geomorphology. ITC, Enschede.
Directory of Open Access Journals (Sweden)
R.A. Römer
1963-10-01
. Keesing, The ethnohistory of Northern Luzon. Stanford University Press, Stanford, California, 1962; 362 pp., 10 krtn. - P. van Emst, Andrew Sharp, The discovery of Australia, Clarendon Press: Oxford University Press. Oxford 1963. 338 pp. - R.A. Römer, H. Hoetink, De gespleten samenleving in het Caraïbisch Gebied. Van Gorcum & Comp., Assen 1962. - H.Th. Fischer, S. van der Kwast, Incest, een oriënterend onderzoek. J.A. Boom & Zn., Meppel, 1963. 224 blz. - H. Th. Fischer, Peter of Greece and Denmark, A study of polyandry. Mouton & Co., The Hague, 1963. 601 pp., 47 plates. - J. van Baal, F. Sierksma, De roof van het vrouwengeheim. Uitgeverij Mouton & Co, ‘s-Gravenhage 1962. 199 pp. - A. Teeuw, Amir Hamzah, Amir Hamzah Radja Penjair Pudjangga Baru. Tulisan tersebar dikumpulkan dan dengan Kata Pengantar H.B. Jassin. Gunung Agung - Djakarta 1962. 223 pp.
Especially for High School Teachers
Howell, J. Emory
1999-02-01
Secondary School Feature Articles * Building the Interest of High School Students for Science-A PACT Ambassador Program To Investigate Soap Manufacturing and Industrial Chemistry, by Matthew Lynch, Nicholas Geary, Karen Hagaman, Ann Munson, and Mark Sabo, p 191. * Promoting Chemistry at the Elementary Level, by Larry L. Louters and Richard D. Huisman, p 196. * Is It Real Gold? by Harold H. Harris, p 198. * The "Big Dog-Puppy Dog" Analogy for Resonance, by Todd P. Silverstein, p 206. * The Fizz Keeper, a Case Study in Chemical Education, Equilibrium, and Kinetics, by Reed A. Howald, p 208. Staying on Top: Curricular Projects, Relativistic Effects, and Standard-State Pressure You may wonder why some articles are identified with the Secondary School Chemistry logo (*) this month even though at first glance they appear to be of greater interest to college faculty.1 The three articles discussed below are representative of three broad categories: (i) the interrelatedness of science teaching and learning, K-16+; (ii) new understandings of chemical phenomena; and (iii) information about the use of SI units. For each article I have highlighted the major point(s) and the reasons it may be of interest to high school teachers. First, the article "The NSF 'Systemic' Projects- A New Tradition" (G. M. Barrow, p 158) is a commentary on changes in post-secondary introductory chemistry courses in which a distinction is drawn between information management and individual understanding. The author is of the opinion that most students expect the former and that the NSF-funded systemic projects "will thrive only if they are consistent with their information-management mission". Three individuals provided responses to the commentary from their perspective. Has a student asked you why mercury is a liquid, or why gold is the most electronegative metal? "Gold Chemistry: The Aurophilic Attraction" by J. Bardají and A. Laguna (p 201) and "Why Gold and Copper Are Colored but Silver Is Not" by
Utengen, Audun; Rouholiman, Dara; Gamble, Jamison G; Grajales, Francisco Jose; Pradhan, Nisha; Staley, Alicia C; Bernstein, Liza; Young, Sean D; Clauson, Kevin A; Chu, Larry F
2017-08-17
conferences compared to physicians, they represent only 1.4% of the stakeholder mix of the top 100 influencers in the conversation. Health care conferences that fail to engage patients in their proceedings may risk limiting their engagement with the public, disseminating scientific information to a narrow community and slowing flow of information across social media channels. ©Audun Utengen, Dara Rouholiman, Jamison G. Gamble, Francisco Jose Grajales III, Nisha Pradhan, Alicia C Staley, Liza Bernstein, Sean D Young, Kevin A Clauson, Larry F Chu. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 17.08.2017.
Directory of Open Access Journals (Sweden)
Redactie KITLV
2008-12-01
Full Text Available Frederick H. Smith; Caribbean Rum: A Social and Economic History (Franklin W. Knight Stephan Palmié; Wizards and Scientists: Explorations in Afro-Cuban Modernity and Tradition (Julie Skurski Miguel A. De la Torre; The Quest for the Cuban Christ: A Historical Search (Fernando Picó L. Antonio Curet, Shannon Lee Dawdy & Gabino La Rosa Corzo (eds.; Dialogues in Cuban Archaeology (David M. Pendergast Jill Lane; Blackface Cuba, 1840-1895 (Arthur Knight Hal Klepak; Cuba’s Military 1990-2005: Revolutionary Soldiers during Counter-Revolutionary Times (Antoni Kapcia Lydia Chávez (ed.; Capitalism, God, and a Good Cigar: Cuba Enters the Twenty-First Century (Ann Marie Stock Diane Accaria-Zavala & Rodolfo Popelnik (eds.; Prospero’s Isles: The Presence of the Caribbean in the American Imaginary (Sean X. Goudie Alexandra Isfahani-Hammond (ed.; The Masters and the Slaves: Plantation Relations and Mestizaje in American Imaginaries (Danielle D. Smith David J. Weber; Bárbaros: Spaniards and Their Savages in the Age of Enlightenment (Neil L. Whitehead Larry Gragg; Englishmen Transplanted: The English Colonization of Barbados, 1627-1660 (Richard S. Dunn Jon F. Sensbach; Rebecca’s Revival: Creating Black Christianity in the Atlantic World (Aaron Spencer Fogleman Jennifer L. Morgan; Laboring Women: Reproduction and Gender in New World Slavery (Verene A. Shepherd Jorge Luis Chinea; Race and Labor in the Hispanic Caribbean: The West Indian Immigrant Worker Experience in Nineteenth-Century Puerto Rico, 1800-1850 (Juan José Baldrich Constance R. Sutton (ed.; Revisiting Caribbean Labour: Essays in Honour of O. Nigel Bolland (Mary Chamberlain Gert Oostindie; Paradise Overseas: The Dutch Caribbean: Colonialism and its Transatlantic Legacies (Bridget Brereton Allan Pred; The Past Is Not Dead: Facts, Fictions, and Enduring Racial Stereotypes (Karen Fog Olwig James C. Riley; Poverty and Life Expectancy: The Jamaica
Capture and Geological Storage of CO2
International Nuclear Information System (INIS)
Kerr, T.; Brockett, S.; Hegan, L.; Barbucci, P.; Tullius, K.; Scott, J.; Otter, N.; Cook, P.; Hill, G.; Dino, R.; Aimard, N.; Giese, R.; Christensen, N.P.; Munier, G.; Paelinck, Ph.; Rayna, L.; Stromberg, L.; Birat, J.P.; Audigane, P.; Loizzo, M.; Arts, R.; Fabriol, H.; Radgen, P.; Hartwell, J.; Wartmann, S.; Drosin, E.; Willnow, K.; Moisan, F.
2009-01-01
To build on the growing success of the first two international symposia on emission reduction and CO 2 capture and geological storage, held in Paris in 2005 and again in 2007, IFP, ADEME and BRGM organised a third event on the same topic the 5-6 November 2009. This time, the focus was on the urgency of industrial deployment. Indeed, the IPCC 4. assessment report indicates that the world must achieve a 50 to 85% reduction in CO 2 emissions by 2050 compared to 2000, in order to limit the global temperature increase to around 2 deg. C. Moreover, IPCC stresses that a 'business as usual' scenario could lead to a temperature increase of between 4 deg. C to 7 deg. C across the planet. The symposium was organized in 4 sessions: Session I - Regulatory framework and strategies for enabling CCS deployment: - CCS: international status of political, regulatory and financing issues (Tom Kerr, IEA); - EC regulatory framework (Scott Brockett, European Commission, DG ENV); - Canada's investments towards implementation of CCS in Canada (Larry Hegan, Office of Energy Research and Development - Government of Canada); - A power company perspective (Pietro Barbucci, ENEL); - EC CCS demonstration network (Kai Tullius, European Commission, DG TREN); - Strategies and policies for accelerating global CCS deployment (Jesse Scott, E3G); - The global CCS Institute, a major initiative to facilitate the rapid deployment of CCS (Nick Otter, GCCSI); Session II - From pilot to demonstration projects: - Otway project, Australia (David Hilditch, CO2 CRC); - US regional partnerships (Gerald Hill, Southeast Regional Carbon Sequestration Partnership - SECARB); - CCS activities in Brazil (Rodolfo Dino, Petrobras); - Lessons learnt from Ketzin CO2Sink project in Germany (Ruediger Giese, GFZ); - CO 2 storage - from laboratory to reality (Niels-Peter Christensen, Vattenfall); - Valuation and storage of CO 2 : A global project for carbon management in South-East France (Gilles Munier, Geogreen); Session III
Jan-e~Alam; Subhasis~Chattopadhyay; Tapan~Nayak
2008-10-01
Quark Matter 2008—the 20th International Conference on Ultra-Relativistic Nucleus-Nucleus Collisions was held in Jaipur, the Pink City of India, from 4-10 February, 2008. Organizing Quark Matter 2008 in India itself indicates the international recognition of the Indian contribution to the field of heavy-ion physics, which was initiated and nurtured by Bikash Sinha, Chair of the conference. The conference was inaugurated by the Honourable Chief Minister of Rajasthan, Smt. Vasundhara Raje followed by the key note address by Professor Carlo Rubbia. The scientific programme started with the theoretical overview, `SPS to RHIC and onwards to LHC' by Larry McLerran followed by several theoretical and experimental overview talks on the ongoing experiments at SPS and RHIC. The future experiments at the LHC, FAIR and J-PARC, along with the theoretical predictions, were discussed in great depth. Lattice QCD predictions on the nature of the phase transition and critical point were vigorously debated during several plenary and parallel session presentations. The conference was enriched by the presence of an unprecedented number of participants; about 600 participants representing 31 countries across the globe. This issue contains papers based on plenary talks and oral presentations presented at the conference. Besides invited and contributed talks, there were also a large number of poster presentations. Members of the International Advisory Committee played a pivotal role in the selection of speakers, both for plenary and parallel session talks. The contributions of the Organizing Committee in all aspects, from helping to prepare the academic programme down to arranging local hospitality, were much appreciated. We thank the members of both the committees for making Quark Matter 2008 a very effective and interesting platform for scientific deliberations. Quark Matter 2008 was financially supported by: Air Liquide (New Delhi) Board of Research Nuclear Sciences (Mumbai) Bose
Rouholiman, Dara; Gamble, Jamison G; Dobrota, Sylvie D; Encisco, Ellen M; Shah, Ashish G; Grajales Iii, Francisco J; Chu, Larry F
2018-03-26
studies have demonstrated decreased health-related quality of life in patients with an ostomy bag. We aim to examine the extent to which the Ostom-i alert sensor affects the health-related quality of life of its users. The Ostom-i alert sensor has the potential to improve quality of life of users by giving them the freedom and confidence to partake in daily activities with the knowledge that they can check how full their ostomy bag is in a private, discrete manner. ClinicalTrials.gov NCT02319434; https://clinicaltrials.gov/ct2/show/NCT02319434 (Archived at WebCite at http://www.webcitation.org/6xhFDThmq). ©Dara Rouholiman, Jamison G Gamble, Sylvie D Dobrota, Ellen M Encisco, Ashish G Shah, Francisco J Grajales III, Larry F Chu. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 26.03.2018.
What a medical school chair wants from the dean
Directory of Open Access Journals (Sweden)
Hromas R
2018-05-01
Full Text Available Robert Hromas,1 Robert Leverence,1 Lazarus K Mramba,2 J Larry Jameson,3 Caryn Lerman,3 Thomas L Schwenk,4 Ellen M Zimmermann,2 Michael L Good51The Office of the Dean, Department of Medicine, University of Texas Health Science Center San Antonio, San Antonio, TX, USA; 2Department of Medicine, College of Medicine, University of Florida Health, Gainesville, FL, USA; 3Department of Medicine, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, USA; 4Department of Family Medicine, School of Medicine, University of Nevada Reno, Reno, NV, USA; 5Department of Anesthesiology, College of Medicine, University of Florida Health, Gainesville, FL, USAAbstract: Economic pressure has led the evolution of the role of the medical school dean from a clinician educator to a health care system executive. In addition, other dynamic requirements also have likely led to changes in their leadership characteristics. The most important relationship a dean has is with the chairs, yet in the context of the dean’s changing role, little attention has been paid to this relationship. To frame this discussion, we asked medical school chairs what characteristics of a dean’s leadership were most beneficial. We distributed a 26-question survey to 885 clinical and basic science chairs at 41 medical schools. These chairs were confidentially surveyed on their views of six leadership areas: evaluation, barriers to productivity, communication, accountability, crisis management, and organizational values. Of the 491 chairs who responded (response rate =55%, 88% thought that their dean was effective at leading the organization, and 89% enjoyed working with their dean. Chairs indicated that the most important area of expertise of a dean is to define a strategic vision, and the most important value for a dean is integrity between words and deeds. Explaining the reasons behind decisions, providing good feedback, admitting errors, open discussion of complex or
Directory of Open Access Journals (Sweden)
Chen C
2014-02-01
Full Text Available Chuang Chen,1 Jing-Ping Yuan,2,3 Wen Wei,1 Yi Tu,1 Feng Yao,1 Xue-Qin Yang,4 Jin-Zhong Sun,1 Sheng-Rong Sun,1 Yan Li2 1Department of Breast and Thyroid Surgery, Wuhan University, Renmin Hospital, Wuhan, 2Department of Oncology, Zhongnan Hospital of Wuhan University and Hubei Key Laboratory of Tumor Biological Behaviors and Hubei Cancer Clinical Study Center, Wuhan, 3Department of Pathology, The Central Hospital of Wuhan, Wuhan, 4Medical School of Jingchu University of Technology, Jingmen, People’s Republic of China Background: Hormone receptors, including the estrogen receptor and progesterone receptor, human epidermal growth factor receptor 2 (HER2, and other biomarkers like Ki67, epidermal growth factor receptor (EGFR, also known as HER1, the androgen receptor, and p53, are key molecules in breast cancer. This study evaluated the relationship between HER2 and hormone receptors and explored the additional prognostic value of Ki67, EGFR, the androgen receptor, and p53. Methods: Quantitative determination of HER2 and EGFR was performed in 240 invasive breast cancer tissue microarray specimens using quantum dot (QD-based nanotechnology. We identified two subtypes of HER2, ie, high total HER2 load (HTH2 and low total HER2 load (LTH2, and three subtypes of hormone receptor, ie, high hormone receptor (HHR, low hormone receptor (LHR, and no hormone receptor (NHR. Therefore, breast cancer patients could be divided into five subtypes according to HER2 and hormone receptor status. Ki67, p53, and the androgen receptor were determined by traditional immunohistochemistry techniques. The relationship between hormone receptors and HER2 was investigated and the additional value of Ki67, EGFR, the androgen receptor, and p53 for prediction of 5-year disease-free survival was assessed. Results: In all patients, quantitative determination showed a statistically significant (P<0.001 negative correlation between HER2 and the hormone receptors and a significant
Directory of Open Access Journals (Sweden)
J. van Baal
1965-01-01
Full Text Available - R.J. Mohr, Bernard J. Siegel, Biennial Review of Anthropology 1963. Stanford University Press. Stanford, California, 1963. 306 pp. - P.E. de Josselin de Jong, Jean Poirier, Guide d’enquête monographique appliquée aux sociétés malgaches. Faculté des lettres et sciences humaines de Madagascar, Tananarive 1962. - P.E. de Josselin de Jong, Jean Poirier, L’inventaire ethno-topographique. Departement des sciences humaines, Faculté des lettres et sciences humaines, Université de Madagascar, Tananarive 1963. - H.Th. Fischer, P. van Emst, Panorama der Volken, I (Volken van Amerika en Oceanië, onder redactie van P. van Emst. Romen en zonen, Roermond 1964. 515 blz., vele ills. - C. Nooteboom, W. Frölich, Völkerkundliche Forschungen, Martin Heydrich zum 70. Geburtstag überreicht von Freunden und Schülern, herausgegeben von W. Frölich (Ethnologica, Neue Folge, Band 2, Köln, 1960. 557 S., 46 Tafeln, 116 Abb. - J. van Baal, Claude Levi-Strauss, Totemism. Translated from the French by Rodney Needham. Beacon Press, Boston, 1963. 116 pp. - J.J. Fahrenfort, Luc de Heusch, Le Pouvoir et le Sacré. Annales de Centre d’ Etude des Religions I. Université de Bruxelles. Institut de Sociologie (Solvay 1962. 228 pp. - H.J.M. Claessen, Montserrat Palau Marti, Le Roi-Dieu au Bénin, Sud Togo, Dahomey, Nigeria Occidentale. Collection Mondes d’Outre-mer, Série: Nations. Berger Levrault, Paris 1964. - P.E. de Josselin de Jong, F. Sierksma, Profiel van een incarnatie. G.A. van Oorschot, Amsterdam 1964. 244 blz. - B.A.L. Cranstone, Carl A. Schmitz, Wantoat: Art and religion of the Northeast New Guinea Papuans. Translated from the German by Mrs. G.E. van Baaren-Pape. Mouton (the Hague, Paris, 1963. 159 pp. 47 plates. - A.A. Gerbrands, William Fagg, Nigerian images. Lund Humphries, London, 1963. 47 pages, 144 plates by Herbert List. - A.A. Gerbrands, Marcelle Urbain-Faublée, L’art malgache. Presses Universitaires de France, Paris, 1963. 141 pag. 100
Whiteley, Laura; Brown, Larry; Lally, Michelle; Heck, Nicholas; van den Berg, Jacob J
2018-04-23
; and increasing personal relevance of HIV care. Behavioral skills themes centered on self-efficacy and strategies for medical adherence and self-care. On the client service questionnaire, 10 out of the 11 participants indicated they were "satisfied with the game activities," and 9 out of 11 "would recommend it to a friend." On the session evaluation form, 9 out of 11 agreed that they "learned a lot from the game." We utilized youth feedback, social learning theory (information-motivation-behavioral skills), and agile software development to create a multilevel, immersive, action-oriented iPhone gaming intervention to measure and improve treatment adherence for adolescents and young adults living with HIV. There is a dearth of gaming interventions for this population, and this study is a significant step in working toward the development and testing of an iPhone gaming app intervention to promote adherence to antiretroviral treatment. ClinicalTrials.gov NCT01887210; http://clinicaltrials.gov/ct2/show/NCT01887210 (Archived by WebCite at http://www.webcitation.org/6xHMW0NI1). ©Laura Whiteley, Larry Brown, Michelle Lally, Nicholas Heck, Jacob J van den Berg. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 23.04.2018.
Marsolo, Keith; Shuman, William; Nix, Jeremy; Morrison, Caroline F; Mullins, Larry L; Pai, Ahna Lh
2017-06-26
participants in the RCT document the study data. Integration with the NCI databases was straightforward; however, accessing the EHR Web services posed a challenge, though the roadblocks were not technical in nature. The lack of a formal, end-to-end institutional process for requesting Web service access and a mechanism to shepherd the request through all stages of implementation proved to be the biggest barrier. We successfully deployed a mobile app with a custom user interface that can integrate with the EHR to retrieve laboratory results and appointment information using vendor-provided Web services. Developers should expect to face hurdles when integrating with the EHR, but many of them can be addressed with frequent communication and thorough documentation. Executive sponsorship is also a key factor for success. ClinicalTrials.gov NCT02505165; https://clinicaltrials.gov/ct2/show/NCT02505165 (Archived by WebCite at http://www.Webcitation.org/6r9ZSUgoT). ©Keith Marsolo, William Shuman, Jeremy Nix, Caroline F Morrison, Larry L Mullins, Ahna LH Pai. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 26.06.2017.
Directory of Open Access Journals (Sweden)
Redactie KITLV
2008-12-01
Full Text Available Michele Stephen; Desire, divine and demonic; Balinese mysticism in the paintings of I Ketut Budiana and I Gusti Nyoman Mirdiana (Andrea Acri John Lynch (ed.; Issues in Austronesian historical phonology (Alexander Adelaar Alfred W. McCoy; The politics of heroin; CIA complicity in the global drug trade (Greg Bankoff Anthony Reid; An Indonesian frontier; Acehnese and other histories of Sumatra (Timothy P. Barnard John G. Butcher; The closing of the frontier; A history of the maritime fisheries of Southeast Asia c. 1850-2000 (Peter Boomgaard Francis Loh Kok Wah, Joakim Öjendal (eds; Southeast Asian responses to globalization; Restructuring governance and deepening democracy (Alexander Claver I Wayan Arka; Balinese morpho-syntax: a lexical-functional approach (Adrian Clynes Zaharani Ahmad; The phonology-morphology interface in Malay; An optimality theoretic account (Abigail C. Cohn Michael C. Ewing; Grammar and inference in conversation; Identifying clause structure in spoken Javanese (Aone van Engelenhoven Helen Creese; Women of the kakawin world; Marriage and sexuality in the Indic courts of Java and Bali (Amrit Gomperts Ming Govaars; Dutch colonial education; The Chinese experience in Indonesia, 1900-1942 (Kees Groeneboer Ernst van Veen, Leonard Blussé (eds; Rivalry and conflict; European traders and Asian trading networks in the 16th and 17th centuries (Hans Hägerdal Holger Jebens; Pathways to heaven; Contesting mainline and fundamentalist Christianity in Papua New Guinea (Menno Hekker Ota Atsushi; Changes of regime and social dynamics in West Java; Society, state and the outer world of Banten, 1750-1830 (Mason C. Hoadley Richard McMillan; The British occupation of Indonesia 1945-1946; Britain, the Netherlands and the Indonesian Revolution (Russell Jones H.Th. Bussemaker; Bersiap! Opstand in het paradijs; De Bersiapperiode op Java en Sumatra 1945-1946 (Russell Jones Michael Heppell; Limbang anak
Nayegandhi, Amar; Bonisteel, Jamie M.; Wright, C. Wayne; Sallenger, A.H.; Brock, John C.; Yates, Xan
2010-01-01
processed using the Airborne Lidar Processing System (ALPS), a custom-built processing system developed in a NASA-USGS collaboration. ALPS supports the exploration and processing of lidar data in an interactive or batch mode. Modules for presurvey flight-line definition, flight-path plotting, lidar raster and waveform investigation, and digital camera image playback have been developed. Processing algorithms have been developed to extract the range to the first and last significant return within each waveform. ALPS is used routinely to create maps that represent submerged or sub-aerial topography. Specialized filtering algorithms have been implemented to determine the 'bare earth' under vegetation. For more information about similar projects, please visit the Decision Support for Coastal Science and Management website. Selected References Brock, J.C., Wright, C.W., Sallenger, A.H., Krabill, W.B., and Swift, R.N., 2002, Basis and methods of NASA airborne topographic mapper Lidar surveys for coastal studies: Journal of Coastal Research, v. 18, no. 1, p. 1-13. Crane, Michael, Clayton, Tonya, Raabe, Ellen, Stoker, Jason, Handley, Larry, Bawden, Gerald, Morgan, Karen, and Queija, Vivian, 2004, Report of the U.S. Geological Survey Lidar workshop sponsored by the Land Remote Sensing Program and held in St. Petersburg, FL, November 2002: U.S. Geological Survey Open-File Report 2004-1456, 72 p. Nayegandhi, Amar, Brock, J.C., and Wright, C.W., 2009, Small-footprint, waveform-resolving Lidar estimation of submerged and sub-canopy topography in coastal environments: International Journal of Remote Sensing, v. 30, no. 4, p. 861-878. Sallenger, A.H., Wright, C.W., and Lillycrop, Jeff, 2005, Coastal impacts of the 2004 hurricanes measured with airborne Lidar; initial results: Shore and Beach, v. 73, nos. 2-3, p. 10-14. Resources Included Readme.txt File
Chandra Finds Ghosts Of Eruption In Galaxy Cluster
2002-01-01
gas. "Ghost cavities may be the vessels that transport magnetic fields generated in a disk surrounding a giant black hole to the cluster gas that is spread over a region a billion times larger," said McNamara. If dozens of these cavities were created over the life of the cluster, they could explain the surprisingly strong magnetic field of the multimillion-degree gas that pervades the cluster. Galaxy clusters are the largest known gravitationally bound structures in the universe. Hundreds of galaxies swarm in giant reservoirs of multimillion-degree gas that radiates most of its energy in X-rays. Over the course of billions of years some of the gas should cool and sink toward a galaxy in the center of the cluster where it could trigger an outburst in the vicinity of the central massive black hole. Chandra observed Abell 2597 on July 28, 2000,for 40,000 seconds with the Advanced CCD Imaging Spectrometer (ACIS) instrument. Pennsylvania State University, University Park, and MIT developed the instrument for NASA. In addition to a group of astronomers from the Space Telescope Science Institute, Baltimore, and the University of Virginia, Charlottesville, the team included: Paul Nulsen, University of Wollagong, Australia; Larry David, Harvard-Smithsonian Center for Astrophysics, Cambridge, Mass.; Chris Carilli, National Radio Astronomy Observatory, Socorro, N.M.; and Craig Sarazin, University of Virginia. NASA's Marshall Space Flight Center in Huntsville, Ala., manages the Chandra program, and TRW, Inc., Redondo Beach, Calif., is the prime contractor for the spacecraft. The Smithsonian's Chandra X-ray Center controls science and flight operations from Cambridge, Mass.
Chapter 4. Economic Considerations: Cost-Effective and Efficient Climate Policies
Directory of Open Access Journals (Sweden)
Maximilian Auffhammer
2016-12-01
of incentive-based instruments, quantity-based mandates such as the federal Renewable Fuel Standard, California’s Low Carbon Fuel Standard, renewable portfolio standards, and the Clean Power Plan should be combined with a cost containment mechanism. The findings of Lade, Lin Lawell and Smith [5] suggest that pure quantity-based mechanisms leave policies susceptible to large increases in compliance costs, particularly in the presence of capacity or production constraints that are inherent in energy markets. Given the experiences with the federal RFS2 in 2013, anticipating and designing climate policies in a way that can contain compliance costs is imperative. Our fifth recommendation is that for international leverage, we should develop a climate club backed by border tax adjustments to non-participants. University of California at Berkeley Professor Larry S. Karp has been proposing an agreement between the top 10 emitters as an alternative to the UN framework [6]. Without international leverage or cooperation, unilateral climate policies, such as California’s AB 32 or the American Clean Energy and Security Act, are not only unlikely to fully combat climate change, but can also have other detrimental effects such as the reduction of economic competitiveness and the possible displacement of jobs from the U.S. to countries without carbon pricing [7]. Our final, and main, recommendation is that, as University of California at Berkeley Professor Severin Borenstein points out, California should focus on solving the problem of 'global' climate change. The primary goal of California climate policy should be to invent and develop the technologies that can replace fossil fuels, allowing the poorer nations of the world – where most of the world’s population lives – to achieve low-carbon economic growth [8].
CINP 2005 Regional Meeting, 20-22 April 2005
Directory of Open Access Journals (Sweden)
Anissa Abi-Dargham
2005-04-01
Full Text Available List of abstract titles and authors: 1. Antipsychotics across the spectrum: An overview of their mechanisms of action Anissa Abi-Dargham 2. Recent advances in the treatment of common anxiety disorders Christer Allgulander 3. Psychiatry in Africa: The myths, the realities and the exotic O Gureje 4. Mental Health policy developmet in Kenya and Tanznia - A DFID funded project Rachel Jenkins, David Kima, Joseph Mbatia, Frank Njenga 5. Vascular factors in Alzheimer's disease R N Kalaria 6. Depression as an immunologically based Neurodegenerative disorder Brian Leonard 7. Eight years of progress in Arican Psychiatry F Njenga 8. Treatment of Depression: Present and future Dr R.M. Pinder 9. Imaging the Serotinergic system in impulsive aggressive personality disorder patients Larry J Siever, Antonia S. New, Mari Goodman, Monte Buchsbaum, Erin Hazlett, Karen O'Flynn, Anissa Abi-argham, Marc Lauelle 10. Mode of action of Atypical antipsychotic rugs: Focus on A2 Adrnoceptors T.H. Svensson Neuroscience: Selected Abstracts 11. Chemical odulato of Fronto-execuitive functions: Neropsychiatric implications Trevor W Robbins 12. Neural mechanisms of recognition memory and of social atacnt Prof. G Horn 13. Estrogen signling after estrogen receptor ß (ERß Jan-Ake Gustafsson 14. Getting Lost: Hippocampal contributions to agerelated memory dysfunction Carol Barnes Metals and the brain: Selected abstracts 15. Modeling the contributin of iron mismanagement to Neurological disorders Prof. J R C Connor 16. Aluminium-triggered fibrillogenesis of B-Amyloids Prof. PZ Zatta, Dr D Drago, Mr G Tognon, Dr F Ricchelli Psychiatry in Africa: 17. Psychosocal aspects of Khat use among the youth of Nairobi Ms T M Khamis 18. PTSD among motor vehicle accident survivors, Kenya Dr F A Ongecha 19. Psychiatric relities within African context - The Kenyan case Study Prof. D M N Ndetei 20. Adolescent-parenta interactions from infancy, Nairobi Kenya Dr L K Ksakhala, Prof. D M N Ndetei 21
Spichtinger, Peter; Cziczo, Daniel J.
2008-04-01
of water which have not yet been fully defined, for example cubic ice, are considered. The impact of natural aerosols on clouds, for example mineral dust, is also discussed, as well as other natural but highly sensitive effects such as the Wegener Bergeron Findeisen process. It is our belief that this focus issue represents a leap forward not only in reducing the uncertainty associated with the interaction of aerosols and clouds but also a new link between groups that must work together to continue progress in this important area of climate science. Focus on Aerosol Cloud Interactions Contents The articles below represent the first accepted contributions and further additions will appear in the near future. The global influence of dust mineralogical composition on heterogeneous ice nucleation in mixed-phase clouds C Hoose, U Lohmann, R Erdin and I Tegen Ice formation via deposition nucleation on mineral dust and organics: dependence of onset relative humidity on total particulate surface area Zamin A Kanji, Octavian Florea and Jonathan P D Abbatt The Explicit-Cloud Parameterized-Pollutant hybrid approach for aerosol cloud interactions in multiscale modeling framework models: tracer transport results William I Gustafson Jr, Larry K Berg, Richard C Easter and Steven J Ghan Cloud effects from boreal forest fire smoke: evidence for ice nucleation from polarization lidar data and cloud model simulations Kenneth Sassen and Vitaly I Khvorostyanov The effect of organic coating on the heterogeneous ice nucleation efficiency of mineral dust aerosols O Möhler, S Benz, H Saathoff, M Schnaiter, R Wagner, J Schneider, S Walter, V Ebert and S Wagner Enhanced formation of cubic ice in aqueous organic acid droplets Benjamin J Murray Quantification of water uptake by soot particles O B Popovicheva, N M Persiantseva, V Tishkova, N K Shonija and N A Zubareva Meridional gradients of light absorbing carbon over northern Europe D Baumgardner, G Kok, M Krämer and F Weidle