WorldWideScience

Sample records for l2-orthogonal stc cpm

  1. Capacity-achieving CPM schemes

    OpenAIRE

    Perotti, Alberto; Tarable, Alberto; Benedetto, Sergio; Montorsi, Guido

    2008-01-01

    The pragmatic approach to coded continuous-phase modulation (CPM) is proposed as a capacity-achieving low-complexity alternative to the serially-concatenated CPM (SC-CPM) coding scheme. In this paper, we first perform a selection of the best spectrally-efficient CPM modulations to be embedded into SC-CPM schemes. Then, we consider the pragmatic capacity (a.k.a. BICM capacity) of CPM modulations and optimize it through a careful design of the mapping between input bits and CPM waveforms. The s...

  2. Automating CPM-GOMS

    Science.gov (United States)

    John, Bonnie; Vera, Alonso; Matessa, Michael; Freed, Michael; Remington, Roger

    2002-01-01

    CPM-GOMS is a modeling method that combines the task decomposition of a GOMS analysis with a model of human resource usage at the level of cognitive, perceptual, and motor operations. CPM-GOMS models have made accurate predictions about skilled user behavior in routine tasks, but developing such models is tedious and error-prone. We describe a process for automatically generating CPM-GOMS models from a hierarchical task decomposition expressed in a cognitive modeling tool called Apex. Resource scheduling in Apex automates the difficult task of interleaving the cognitive, perceptual, and motor resources underlying common task operators (e.g. mouse move-and-click). Apex's UI automatically generates PERT charts, which allow modelers to visualize a model's complex parallel behavior. Because interleaving and visualization is now automated, it is feasible to construct arbitrarily long sequences of behavior. To demonstrate the process, we present a model of automated teller interactions in Apex and discuss implications for user modeling. available to model human users, the Goals, Operators, Methods, and Selection (GOMS) method [6, 21] has been the most widely used, providing accurate, often zero-parameter, predictions of the routine performance of skilled users in a wide range of procedural tasks [6, 13, 15, 27, 28]. GOMS is meant to model routine behavior. The user is assumed to have methods that apply sequences of operators and to achieve a goal. Selection rules are applied when there is more than one method to achieve a goal. Many routine tasks lend themselves well to such decomposition. Decomposition produces a representation of the task as a set of nested goal states that include an initial state and a final state. The iterative decomposition into goals and nested subgoals can terminate in primitives of any desired granularity, the choice of level of detail dependent on the predictions required. Although GOMS has proven useful in HCI, tools to support the

  3. MDEP STC self assessment report

    International Nuclear Information System (INIS)

    2013-01-01

    definition of convergence to be used for MDEP activities, in the form of a revision to the Terms of Reference; - Modify the MDEP Terms of Reference to remove the objective of improving public understanding and acceptance of safety goals; - Develop a communication plan that identifies stakeholders and specific communication products; - Open at least a part of the MDEP library to non-MDEP representatives and invite non-MDEP organisations to attend issue-specific working group meetings as appropriate; - Enhance interactions with its IAEA counterparts to identify areas in which MDEP can provide useful input to IAEA safety standards under development; - Identify completion strategies (including final products, recommendations to SDOs or other organisations for follow-up activity) in the issue-specific working group Program Plans; - Continue the activities of the design-specific working groups at least through the construction oversight phase; - Address advanced reactor issues, through an STC Subcommittee or Working Group that would explore the issues of most interest to the MDEP member countries; - Act quickly to approve the formation of new design-specific working groups (consistent with the existing Rule of Three for forming design specific working groups); - Support increasing MDEP membership consistent with the existing guidance, and encourage participation in MDEP by any national regulators who are considering designs under MDEP review

  4. Corporate Performance Management – why CPM matters for organizations and aspects of CPM discipline

    OpenAIRE

    Milos Maryska; Pavel Sladek

    2015-01-01

    This paper is devoted to the topic of Corporate Performance Management (CPM). We discuss the role and need for CPM in enterprise environment and benefits that are bound to CPM practice. We propose structured approach when deciding and describing CPM discipline in enterprise environment. We define basic structure of CPM and major topics in each area. We also provide implementation approach based on integration of well-known CPM resources that can be used for CPM implementation project verifica...

  5. CPM and PERT in Library Management.

    Science.gov (United States)

    Main, Linda

    1989-01-01

    Discusses two techniques of systems analysis--Critical Path Method (CPM) and Program Evaluation Review Techniques (PERT)--and their place in library management. An overview of CPM and PERT charting procedures is provided. (11 references) (Author/MES)

  6. 49 CFR 195.134 - CPM leak detection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...

  7. Application of CPM procedures in mine ventilation

    International Nuclear Information System (INIS)

    Wang, Y.J.; Mutmansky, J.M.

    1982-01-01

    Mine ventilation analysis is an engineering discipline that can be considered a branch of the body of science known as network analysis. Likewise, the group of engineering procedures known as the critical path method (CPM) is considered a branch of network analysis. It is therefore not surprising that mine ventilation network analysis and CPM have many similarities. These similarities are useful in analyzing several types of mine ventilation problems and will be utilized in this paper. The analogy between the free split in a ventilation circuit and the critical path in a scheduling network has been recognized by Owili-Eger (1973). While this was recognized as a property of a general ventilation network, many important applications to controlled-splitting problems also exist. The mathematical procedures necessary to apply CPM and network methods have previously been presented (Wang, 1981; Wang, 1982). This paper will illustrate the implementation of these methods by application to mine ventilation networks

  8. 49 CFR 195.444 - CPM leak detection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.444 Section 195.444... PIPELINE Operation and Maintenance § 195.444 CPM leak detection. Each computational pipeline monitoring (CPM) leak detection system installed on a hazardous liquid pipeline transporting liquid in single...

  9. Indoor calibration for stereoscopic camera STC: a new method

    Science.gov (United States)

    Simioni, E.; Re, C.; Da Deppo, V.; Naletto, G.; Borrelli, D.; Dami, M.; Ficai Veltroni, I.; Cremonese, G.

    2017-11-01

    In the framework of the ESA-JAXA BepiColombo mission to Mercury, the global mapping of the planet will be performed by the on-board Stereo Camera (STC), part of the SIMBIO-SYS suite [1]. In this paper we propose a new technique for the validation of the 3D reconstruction of planetary surface from images acquired with a stereo camera. STC will provide a three-dimensional reconstruction of Mercury surface. The generation of a DTM of the observed features is based on the processing of the acquired images and on the knowledge of the intrinsic and extrinsic parameters of the optical system. The new stereo concept developed for STC needs a pre-flight verification of the actual capabilities to obtain elevation information from stereo couples: for this, a stereo validation setup to get an indoor reproduction of the flight observing condition of the instrument would give a much greater confidence to the developed instrument design. STC is the first stereo satellite camera with two optical channels converging in a unique sensor. Its optical model is based on a brand new concept to minimize mass and volume and to allow push-frame imaging. This model imposed to define a new calibration pipeline to test the reconstruction method in a controlled ambient. An ad-hoc indoor set-up has been realized for validating the instrument designed to operate in deep space, i.e. in-flight STC will have to deal with source/target essentially placed at infinity. This auxiliary indoor setup permits on one side to rescale the stereo reconstruction problem from the operative distance in-flight of 400 km to almost 1 meter in lab; on the other side it allows to replicate different viewing angles for the considered targets. Neglecting for sake of simplicity the Mercury curvature, the STC observing geometry of the same portion of the planet surface at periherm corresponds to a rotation of the spacecraft (SC) around the observed target by twice the 20° separation of each channel with respect to nadir

  10. NODAL interpreter for CP/M

    International Nuclear Information System (INIS)

    Oide, Katsunobu.

    1982-11-01

    A NODAL interpreter which works under CP/M operating system is made for microcomputers. This interpreter language named NODAL-80 has a similar structure to the NODAL of SPS, but its commands, variables, and expressions are modified to increase the flexibility of programming. NODAL-80 also uses a simple intermediate code to make the execution speed fast without imposing any restriction on the dynamic feature of NODAL language. (author)

  11. Maximum-Likelihood Detection Of Noncoherent CPM

    Science.gov (United States)

    Divsalar, Dariush; Simon, Marvin K.

    1993-01-01

    Simplified detectors proposed for use in maximum-likelihood-sequence detection of symbols in alphabet of size M transmitted by uncoded, full-response continuous phase modulation over radio channel with additive white Gaussian noise. Structures of receivers derived from particular interpretation of maximum-likelihood metrics. Receivers include front ends, structures of which depends only on M, analogous to those in receivers of coherent CPM. Parts of receivers following front ends have structures, complexity of which would depend on N.

  12. Dynamic Analysis and Test Results for an STC Stirling Generator

    Science.gov (United States)

    Qiu, Songgang; Peterson, Allen A.

    2004-02-01

    Long-life, high-efficiency generators based on free-piston Stirling machines are a future energy-conversion solution for both space and commercial applications. To aid in design and system integration efforts, Stirling Technology Company (STC) has developed dynamic simulation models for the internal moving subassemblies and for complete Stirling convertor assemblies. These dynamic models have been validated using test data from operating prototypes. Simplified versions of these models are presented to help explain the operating characteristics of the Stirling convertor. Power spectrum analysis is presented for the test data for casing acceleration, piston motion, displacer motion, and controller current/voltage during full power operation. The harmonics of a Stirling convertor and its moving components are identified for the STC zener-diode control scheme. The dynamic behavior of each moving component and its contribution to the system dynamics and resultant vibration forces are discussed. Additionally, the effects of a passive balancer and external suspension are predicted by another simplified system model.

  13. CPM (Critical Path Method) as a Curriculum Tool.

    Science.gov (United States)

    Mongerson, M. Duane

    This document discusses and illustrates the use of the Critical Path Method (CPM) as a tool for developing curriculum. In so doing a brief review of the evolution of CPM as a management tool developed by E. I. duPont de Nemours Company is presented. It is also noted that CPM is only a method of sequencing learning activities and not an end unto…

  14. CPM Pairs from LSPM so far not WDS Listed

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2017-04-01

    The LSPM catalog (Lepine and Shara 2005) is a rich source for CPM pairs we thought already exhausted - but as we found during research for our report “A new concept for counter-checking of assumed CPM pairs” (Knapp and Nanson 2016) there are still many potential CPM pairs indicated in LSPM which as of the beginning of 2016 are not listed in the WDS catalog. A first part of about 40 such objects is presented here.

  15. STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.

    Science.gov (United States)

    Terra, Silvia R; Cardoso, João Carlos R; Félix, Rute C; Martins, Leo Anderson M; Souza, Diogo Onofre G; Guma, Fatima C R; Canário, Adelino Vicente M; Schein, Vanessa

    2015-03-05

    Stanniocalcin 1 (STC1) and calcitonin gene-related peptide (CGRP) are involved in bone formation/remodeling. Here we investigate the effects of STC1 on functional heterodimer complex CALCRL/RAMP1, expression and activity during osteoblastogenesis. STC1 did not modify CALCRL and ramp1 gene expression during osteoblastogenesis when compared to controls. However, plasma membrane spatial distribution of CALCRL/RAMP1 was modified in 7-day pre-osteoblasts exposed to either CGRP or STC1, and both peptides induced CALCRL and RAMP1 assembly. CGRP, but not STC1 stimulated cAMP accumulation in 7-day osteoblasts and in CALCRL/RAMP1 transfected HEK293 cells. Furthermore, STC1 inhibited forskolin stimulated cAMP accumulation of HEK293 cells, but not in CALCRL/RAMP1 transfected HEK293 cells. However, STC1 inhibited cAMP accumulation in calcitonin receptor (CTR) HEK293 transfected cells stimulated by calcitonin. In conclusion, STC1 signals through inhibitory G-protein modulates CGRP receptor spatial localization during osteoblastogenesis and may function as a regulatory factor interacting with calcitonin peptide members during bone formation. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  16. Optimized iterative decoding method for TPC coded CPM

    Science.gov (United States)

    Ma, Yanmin; Lai, Penghui; Wang, Shilian; Xie, Shunqin; Zhang, Wei

    2018-05-01

    Turbo Product Code (TPC) coded Continuous Phase Modulation (CPM) system (TPC-CPM) has been widely used in aeronautical telemetry and satellite communication. This paper mainly investigates the improvement and optimization on the TPC-CPM system. We first add the interleaver and deinterleaver to the TPC-CPM system, and then establish an iterative system to iteratively decode. However, the improved system has a poor convergence ability. To overcome this issue, we use the Extrinsic Information Transfer (EXIT) analysis to find the optimal factors for the system. The experiments show our method is efficient to improve the convergence performance.

  17. ROLAIDS-CPM: A code for accurate resonance absorption calculations

    International Nuclear Information System (INIS)

    Kruijf, W.J.M. de.

    1993-08-01

    ROLAIDS is used to calculate group-averaged cross sections for specific zones in a one-dimensional geometry. This report describes ROLAIDS-CPM which is an extended version of ROLAIDS. The main extension in ROLAIDS-CPM is the possibility to use the collision probability method for a slab- or cylinder-geometry instead of the less accurate interface-currents method. In this way accurate resonance absorption calculations can be performed with ROLAIDS-CPM. ROLAIDS-CPM has been developed at ECN. (orig.)

  18. Recommendations on practice of conditioned pain modulation (CPM) testing.

    Science.gov (United States)

    Yarnitsky, D; Bouhassira, D; Drewes, A M; Fillingim, R B; Granot, M; Hansson, P; Landau, R; Marchand, S; Matre, D; Nilsen, K B; Stubhaug, A; Treede, R D; Wilder-Smith, O H G

    2015-07-01

    Protocols for testing conditioned pain modulation (CPM) vary between different labs/clinics. In order to promote research and clinical application of this tool, we summarize the recommendations of interested researchers consensus meeting regarding the practice of CPM and report of its results. © 2014 European Pain Federation - EFIC®

  19. STC synthesis of research results for water quality management at construction sites : research project capsule.

    Science.gov (United States)

    2012-07-01

    The RAC Region II has initiated a collaborative research program consortium through the : Transportation Pooled Fund (TPF) Program. The research program is called the Southeast : Transportation Consortium (STC) and is intended to encourage coordinati...

  20. Development of a CPM Machine for Injured Fingers.

    Science.gov (United States)

    Fu, Yili; Zhang, Fuxiang; Ma, Xin; Meng, Qinggang

    2005-01-01

    Human fingers are easy to be injured. A CPM machine is a mechanism based on the rehabilitation theory of continuous passive motion (CPM). To develop a CPM machine for the clinic application in the rehabilitation of injured fingers is a significant task. Therefore, based on the theories of evidence based medicine (EBM) and CPM, we've developed a set of biomimetic mechanism after modeling the motions of fingers and analyzing its kinematics and dynamics analysis. We also design an embedded operating system based on ARM (a kind of 32-bit RISC microprocessor). The equipment can achieve the precise control of moving scope of fingers, finger's force and speed. It can serves as a rational checking method and a way of assessment for functional rehabilitation of human hands. Now, the first prototype has been finished and will start the clinical testing in Harbin Medical University shortly.

  1. Long Term Success of Endo-DCR with Silicone Tube Catheter (STC versus Endo-DCR without STC: A Comparative Study

    Directory of Open Access Journals (Sweden)

    Bidhan Ray

    2016-08-01

    Full Text Available Introduction   Epiphora  caused by  mechanical block at puncta, canaliculi, lacrimal sac and nasolacrimal duct need surgical correction. EndoDCR  is gaining  popularity over conventional surgery. This study aims at evaluating the role of Silicone Tube Catheter (STC to improve the long term outcome of endoDCR .               Materials and Method   This retrospective study was conducted on 58 consecutive endoDCR surgeries between 2012 and 2014. 22 subjects had endoDCR without STC, 36 subjects had endoDCR with STC, of whom in 20 cases STC was removed in  3 weeks and in 16 cases in  12 weeks. Clinical and endoscopic data collected post-operatively after 3 weeks,12 weeks and at 1 year. Analysis was done on intention to get suggestion for better result from endoDCR operations.                                           Results   Complications were identified as early and late. Complications like granulations, synaechia, echymosis, eyelid haematoma and surgical emphysema were searched for in every follow up. Development of obliterating scar was the main cause of failure. Epistaxis was negligible. No retrobulbar haematoma or rectus injury was noted. Minor synaechia between middle turbinate and nasal wall noted in 13.6 to 20%  of cases in all groups. Granulations were more in cases had STC for 12 weeks but managed with conservative measures. Obliterating scar was slightly less in this group in comparison to other groups.                                         Discussion    The present study emphasises the use of indwelling STC in endoDCR for a longer period .

  2. High-sensitivity HLA typing by Saturated Tiling Capture Sequencing (STC-Seq).

    Science.gov (United States)

    Jiao, Yang; Li, Ran; Wu, Chao; Ding, Yibin; Liu, Yanning; Jia, Danmei; Wang, Lifeng; Xu, Xiang; Zhu, Jing; Zheng, Min; Jia, Junling

    2018-01-15

    Highly polymorphic human leukocyte antigen (HLA) genes are responsible for fine-tuning the adaptive immune system. High-resolution HLA typing is important for the treatment of autoimmune and infectious diseases. Additionally, it is routinely performed for identifying matched donors in transplantation medicine. Although many HLA typing approaches have been developed, the complexity, low-efficiency and high-cost of current HLA-typing assays limit their application in population-based high-throughput HLA typing for donors, which is required for creating large-scale databases for transplantation and precision medicine. Here, we present a cost-efficient Saturated Tiling Capture Sequencing (STC-Seq) approach to capturing 14 HLA class I and II genes. The highly efficient capture (an approximately 23,000-fold enrichment) of these genes allows for simplified allele calling. Tests on five genes (HLA-A/B/C/DRB1/DQB1) from 31 human samples and 351 datasets using STC-Seq showed results that were 98% consistent with the known two sets of digitals (field1 and field2) genotypes. Additionally, STC can capture genomic DNA fragments longer than 3 kb from HLA loci, making the library compatible with the third-generation sequencing. STC-Seq is a highly accurate and cost-efficient method for HLA typing which can be used to facilitate the establishment of population-based HLA databases for the precision and transplantation medicine.

  3. Measurements of 42 Wide CPM Pairs with a CCD

    Science.gov (United States)

    Harshaw, Richard

    2015-11-01

    This paper addresses the use of a Skyris 618C color CCD camera as a means of obtaining data for analysis in the measurement of wide common proper motion stars. The equipment setup is described and data collection procedure outlined. Results of the measures of 42 CPM stars are presented, showing the Skyris is a reliable device for the measurement of double stars.

  4. PERT and CPM: A Comparison with Implications for Education.

    Science.gov (United States)

    Ragan, Stephen W.

    Two systematic ways of analyzing and planning the components of a program or project, both used extensively by industry and government, are discussed in this paper. The methods are Program Evaluation and Review Technique (PERT) Networks and Critical Path Method (CPM) Arrow Diagrams. The purposes of this paper are (1) to explore the need for…

  5. Using Apex To Construct CPM-GOMS Models

    Science.gov (United States)

    John, Bonnie; Vera, Alonso; Matessa, Michael; Freed, Michael; Remington, Roger

    2006-01-01

    process for automatically generating computational models of human/computer interactions as well as graphical and textual representations of the models has been built on the conceptual foundation of a method known in the art as CPM-GOMS. This method is so named because it combines (1) the task decomposition of analysis according to an underlying method known in the art as the goals, operators, methods, and selection (GOMS) method with (2) a model of human resource usage at the level of cognitive, perceptual, and motor (CPM) operations. CPM-GOMS models have made accurate predictions about behaviors of skilled computer users in routine tasks, but heretofore, such models have been generated in a tedious, error-prone manual process. In the present process, CPM-GOMS models are generated automatically from a hierarchical task decomposition expressed by use of a computer program, known as Apex, designed previously to be used to model human behavior in complex, dynamic tasks. An inherent capability of Apex for scheduling of resources automates the difficult task of interleaving the cognitive, perceptual, and motor resources that underlie common task operators (e.g., move and click mouse). The user interface of Apex automatically generates Program Evaluation Review Technique (PERT) charts, which enable modelers to visualize the complex parallel behavior represented by a model. Because interleaving and the generation of displays to aid visualization are automated, it is now feasible to construct arbitrarily long sequences of behaviors. The process was tested by using Apex to create a CPM-GOMS model of a relatively simple human/computer-interaction task and comparing the time predictions of the model and measurements of the times taken by human users in performing the various steps of the task. The task was to withdraw $80 in cash from an automated teller machine (ATM). For the test, a Visual Basic mockup of an ATM was created, with a provision for input from (and measurement

  6. Characterization of 3D-stc detectors fabricated at ITC-irst

    International Nuclear Information System (INIS)

    Boscardin, Maurizio; Bosisio, Luciano; Bruzzi, Mara; Dalla Betta, Gian-Franco; Piemonte, Claudio; Pozza, Alberto; Ronchin, Sabina; Tosi, Carlo; Zorzi, Nicola

    2007-01-01

    3D silicon radiation detectors offer many advantages over planar detectors, including improved radiation tolerance and faster charge collection time. We proposed a new 3D architecture (referred to as 3D-stc), which features columnar electrodes of one doping type only, thus, allowing a considerable simplification of the manufacturing process. In this paper, we report selected results from the electrical characterization of 3D diodes fabricated with this technology, along with preliminary results on the charge collection efficiency of these devices

  7. CMOS detectors: lessons learned during the STC stereo channel preflight calibration

    Science.gov (United States)

    Simioni, E.; De Sio, A.; Da Deppo, V.; Naletto, G.; Cremonese, G.

    2017-09-01

    The Stereo Camera (STC), mounted on-board the BepiColombo spacecraft, will acquire in push frame stereo mode the entire surface of Mercury. STC will provide the images for the global three-dimensional reconstruction of the surface of the innermost planet of the Solar System. The launch of BepiColombo is foreseen in 2018. STC has an innovative optical system configuration, which allows good optical performances with a mass and volume reduction of a factor two with respect to classical stereo camera approach. In such a telescope, two different optical paths inclined of +/-20°, with respect to the nadir direction, are merged together in a unique off axis path and focused on a single detector. The focal plane is equipped with a 2k x 2k hybrid Si-PIN detector, based on CMOS technology, combining low read-out noise, high radiation hardness, compactness, lack of parasitic light, capability of snapshot image acquisition and short exposure times (less than 1 ms) and small pixel size (10 μm). During the preflight calibration campaign of STC, some detector spurious effects have been noticed. Analyzing the images taken during the calibration phase, two different signals affecting the background level have been measured. These signals can reduce the detector dynamics down to a factor of 1/4th and they are not due to dark current, stray light or similar effects. In this work we will describe all the features of these unwilled effects, and the calibration procedures we developed to analyze them.

  8. Variation in SPC/STC Ratio as an Indicator of Age: A Computer-aided Forensic Odontology

    Directory of Open Access Journals (Sweden)

    Priyanka Debta

    2010-01-01

    Results: Pearson correlation between SPC/STC ratio with different age group was found to be statistically significant. So, measurement of amount of secondary dentin seems to be reliable and rapid method in forensic odontology.

  9. Sex differences in the stability of conditioned pain modulation (CPM) among patients with chronic pain.

    Science.gov (United States)

    Martel, Marc O; Wasan, Ajay D; Edwards, Robert R

    2013-11-01

    To examine the temporal stability of conditioned pain modulation (CPM), formerly termed diffuse noxious inhibitory controls, among a sample of patients with chronic pain. The study also examined the factors that might be responsible for the stability of CPM. In this test-retest study, patients underwent a series of standardized psychophysical pain-testing procedures designed to assess CPM on two separate occasions (i.e., baseline and follow up). Patients also completed self-report measures of catastrophizing (Pain Catastrophizing Scale [PCS] and negative affect [NA]). Overall, results provided evidence for the stability of CPM among patients with chronic pain. Results, however, revealed considerable sex differences in the stability of CPM. For women, results revealed a significant test-retest correlation between baseline and follow-up CPM scores. For men, however, the test-retest correlation between baseline and follow-up CPM scores was not significant. Results of a Fisher's Z-test revealed that the stability of CPM was significantly greater for women than for men. Follow-up analyses revealed that the difference between men and women in the stability of CPM could not be accounted for by any demographic (e.g., age) and/or psychological factors (PCS and NA). Our findings suggest that CPM paradigms possess sufficient reliability to be incorporated into bedside clinical evaluation of patients with chronic pain, but only among women. The lack of CPM reproducibility/stability observed among men places limits on the potential use of CPM paradigms in clinical settings for the assessment of men's endogenous pain-inhibitory function. Wiley Periodicals, Inc.

  10. CPM Pairs from LSPM so Far Not WDS Listed – Part IV

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2018-04-01

    The LSPM catalog (Lepine and Shara 2005) is a rich source for CPM pairs we thought already exhausted – but as we found during research for our report "A New Concept for Counter-Checking of Assumed CPM Pairs" (Knapp and Nanson 2017), there are still many potential CPM pairs indicated in LSPM not listed in the WDS catalog. After our first three reports on about 100 such objects (Knapp and Nanson 2017 - CPM pairs from LSPM so far not WDS listed – Part I/II/III), this report with 30 additional potential common proper motion pairs is presented here.

  11. Image findings in central pontine myelinolysis (CPM) and extrapontine myelinolysis (EPM); Bildgebung bei zentraler pontiner Myelinolyse (CPM) und extrapontiner Myelinolyse (EPM)

    Energy Technology Data Exchange (ETDEWEB)

    Oergel, Anja; Hauser, Till-Karsten; Naegele, T.; Horger, Marius [Univ. Hospital Tuebingen (Germany). Dept. of Radiology

    2017-02-15

    CT and NMR Image findings in central pontine myelinolysis (CPM) and extrapontine myelinolysis were compared with histological results. The clinical appearance and diagnosis using CT and NMR imaging are related to therapy decisions and outcome.

  12. Satisfaction rates with the current Special Type Consultation (STC) reimbursement scheme among General Practitioners – A Mixed Methods Study.

    LENUS (Irish Health Repository)

    Kiely, A

    2017-03-01

    The Special Type Consultation (STC) scheme is a fee-for-service reimbursement scheme for General Practitioners (GPs) in Ireland. Introduced in 1989, the scheme includes specified patient services involving the application of a learned skill, e.g. suturing. This study aims to establish the extent to which GPs believe this scheme is appropriate for current General Practice. This is an embedded mixed-methods study combining quantitative data on GPs working experience of and qualitative data on GPs attitudes towards the scheme. Data were collected by means of an anonymous postal questionnaire. The response rate was 60.4% (n=159.) Twenty-nine percent (n=46) disagreed and 65% (n=104) strongly disagreed that the current list of special items is satisfactory. Two overriding themes were identified: economics and advancement of the STC process. This study demonstrates an overwhelming consensus among GPs that the current STC scheme is outdated and in urgent need of revision to reflect modern General Practice.

  13. Purification and characterization of a serine protease (CPM-2) with fibrinolytic activity from the dung beetles.

    Science.gov (United States)

    Ahn, Mi Young; Hahn, Bum-Soo; Ryu, Kang Sun; Hwang, Jae Sam; Kim, Yeong Shik

    2005-07-01

    Catharsius protease-2 (CPM-2) was isolated from the body of dung beetles, Catharsius molossus, using a three step purification process (ammonium sulfate fractionation, gel filtration on Bio-Gel P-60, and affinity chromatography on DEAE Affi-Gel blue). The purified CPM-2, having a molecular weight of 24 kDa, was assessed homogeneously by SDS-polyacrylamide gel electrophoresis. The N-terminal amino acid sequence of CPM-2 was composed of X Val Gln Asp Phe Val Glu Glu Ile Leu. CPM-2 was inactivated by Cu2+ and Zn2+ and strongly inhibited by typical serine proteinase inhibitors such as TLCK, soybean trypsin inhibitor, aprotinin, benzamidine, and alpha1-antitrypsin. However, EDTA, EGTA, cysteine, beta-mercaptoethanol, E64, and elastatinal had little effect on enzyme activity. In addition, antiplasmin and antithrombin III were not sensitive to CPM-2. Based on the results of a fibrinolytic activity test, CPM-2 readily cleaved Aalpha- and Bbeta-chains of fibrinogen and fibrin, and gamma-chain of fibrinogen more slowly. The nonspecific action of the enzyme resulted in extensive hydrolysis, releasing a variety of fibrinopeptides of fibrinogen and fibrin. Polyclonal antibodies of CPM-2 were reactive to the native form of antigen. The ELISA was applied to detect quantities, in nanograms, of the antigen in CPM-2 protein.

  14. Information System Design Methodology Based on PERT/CPM Networking and Optimization Techniques.

    Science.gov (United States)

    Bose, Anindya

    The dissertation attempts to demonstrate that the program evaluation and review technique (PERT)/Critical Path Method (CPM) or some modified version thereof can be developed into an information system design methodology. The methodology utilizes PERT/CPM which isolates the basic functional units of a system and sets them in a dynamic time/cost…

  15. Central pontine myelinolysis (CPM) associated with tacrolimus (FK506) after liver transplantation.

    Science.gov (United States)

    Fukazawa, Kyota; Nishida, Seigo; Aguina, Luz; Pretto, Ernesto

    2011-01-01

    Central pontine myelinolysis (CPM) is the most detrimental neurologic complication after liver transplantation. The incidence of CPM after liver transplantation ascends to 17%. Although the precise etiology and pathogenesis of CPM is largely unknown, a growing literature implicates a possible role of immunosuppressive agents, such as Cyclosporine (incidence 30%) on its development. Other immunosuppressive agents also can cause CPM but the frequency of these cases is less compared to Cyclosporine. There is only one case report for Tacrolimus (FK506)-associated speech disorder, which might be an atypical presentation of CPM, and no case reports for Rapamycin. We present a case of Tacrolimus induced CPM. A 62-year-old woman who underwent liver transplantation developed clinical symptoms with radiologic evidence consistent with CPM 7 days after liver transplant. Since the electrolytes in this patient remained normal from her admission, the hypothesis of inmunossupressor neurotoxicity was established and the therapy was switched, resulting in an evident clinical and radiological improvement of her condition in the following days. Five months later, the patient's only neurological deficit was slight dysarthria and a follow-up MRI showed no abnormalities. This case provides evidence of Tacrolimus-associated CPM after transplantation, which presented with a classic "lock-in syndrome" with radiographic confirmation.

  16. A New Concept for Counter-Checking of Assumed CPM Pairs

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2017-01-01

    The inflation of “newly discovered” CPM pairs makes it necessary to develop an approach for a solid concept for counter-checking assumed CPM pairs with the target to identify false positives. Such a concept is presented in this report.

  17. Conditioned pain modulation (CPM) in children and adolescents: Effects of sex and age

    Science.gov (United States)

    Tsao, Jennie C. I.; Seidman, Laura C.; Evans, Subhadra; Lung, Kirsten C.; Zeltzer, Lonnie K.; Naliboff, Bruce D.

    2013-01-01

    Conditioned pain modulation (CPM) refers to the diminution of perceived pain intensity for a test stimulus following application of a conditioning stimulus to a remote area of the body, and is thought to reflect the descending inhibition of nociceptive signals. Studying CPM in children may inform interventions to enhance central pain inhibition within a developmental framework. We assessed CPM in 133 healthy children (mean age = 13 years; 52.6% girls) and tested the effects of sex and age. Participants were exposed to four trials of a pressure test stimulus before, during, and after the application of a cold water conditioning stimulus. CPM was documented by a reduction in pressure pain ratings during cold water administration. Older children (12–17 years) exhibited greater CPM than younger (8–11 years) children. No sex differences in CPM were found. Lower heart rate variability (HRV) at baseline and after pain induction was associated with less CPM controlling for child age. The findings of greater CPM in the older age cohort suggest a developmental improvement in central pain inhibitory mechanisms. The results highlight the need to examine developmental and contributory factors in central pain inhibitory mechanisms in children to guide effective, age appropriate, pain interventions. PMID:23541066

  18. Conceptualization of an exoskeleton Continuous Passive Motion(CPM) device using a link structure.

    Science.gov (United States)

    Kim, Kyu-Jung; Kang, Min-Sung; Choi, Youn-Sung; Han, Jungsoo; Han, Changsoo

    2011-01-01

    This study is about developing an exoskeleton Continuous Passive Motion (CPM) with the same Range of Motion (ROM) and instant center of rotation as the human knee. The key feature in constructing a CPM is an accurate alignment with the human knee joint enabling it to deliver the same movements as the actual body on the CPM. In this research, we proposed an exoskeleton knee joint through kinematic interpretation, measured the knee joint torque generated while using a CPM and applied it to the device. Thus, this new exoskeleton type CPM will allow precise alignment with the human knee joint, and follow the same ROM as the human knee in any position. © 2011 IEEE

  19. Research of digital controlled DC/DC converter based on STC12C5410AD

    Science.gov (United States)

    Chen, Dan-Jiang; Jin, Xin; Xiao, Zhi-Hong

    2010-02-01

    In order to study application of digital control technology on DC/DC converter, principle of increment mode PID control algorithm was analyzed in the paper. Then, a SCM named STC12C5410AD was introduced with its internal resources and characteristics. The PID control algorithm can be implemented easily based on it. The output of PID control was used to change the value of a variable that is 255 times than duty cycle, and this reduced the error of calculation. The valid of the presented algorithm was verified by an experiment for a BUCK DC/DC converter. The experimental results indicated that output voltage of the BUCK converter is stable with low ripple.

  20. RETRACTED ARTICLE: Clinical effectiveness of continuous passive motion (CPM) following femoroacetabular impingement surgery in adolescents.

    Science.gov (United States)

    Hosalkar, Harish; Bomar, James D

    2012-08-01

    This study hypothesizes that the use of continuous passive motion (CPM) following open femoroacetabular impingement (FAI) surgery in the adolescent population improves clinical outcomes in terms of the modified Harris hip score (mHHS). Twenty-nine symptomatic adolescent FAI patients were postoperatively divided into one of three groups; no CPM, two days of inpatient CPM, and two weeks of CPM. mHHS was used preoperatively and postoperatively at six weeks, three months, six months, and nine months in all cases. Kruskal-Wallis (KW) analysis was performed to determine statistical differences in mHHS. mHHS was then re-evaluated using the Mann-Whitney test. There were no statistically significant differences in hip scores between the three groups preoperatively (p = 0.158). There were statistically significant differences (p CPM had the best outcome scores. The results of this study suggest that postoperative CPM use following open hip preservation surgery for symptomatic FAI in adolescents improves clinical outcomes. These benefits seem to be related to the duration of CPM. Retrospective comparative study, Level III. Patients treated one way compared with patients treated another way at the same institution.

  1. CPM Pairs from LSPM so far not WDS Listed – Part III

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2017-10-01

    The LSPM catalog (Lepine and Shara 2005) is a rich source for CPM pairs we thought already exhausted – but as we found during research for our report “A new concept for counter-checking of assumed CPM pairs” (Knapp and Nanson 2017) there are still many poten-tial CPM pairs indicated in LSPM which as of the end of 2016 are not listed in the WDS cata-log. After our first two reports on in total about 70 such objects (Knapp and Nanson 2017) the next paper with about 25 additional potential common proper motion pairs is presented here.

  2. CPM Pairs from LSPM so far not WDS Listed – Part II

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2017-10-01

    The LSPM catalog (Lepine and Shara 2005) is a rich source for CPM pairs we thought already exhausted – but as we found during research for our report “A new concept for counter-checking of assumed CPM pairs” (Knapp and Nanson 2017) there are still many poten-tial CPM pairs indicated in LSPM which as of the end of 2016 are not listed in the WDS cata-log. After our first part on about 40 such objects (Knapp and Nanson 2017) the next report with about 30 additional common proper motion pairs is presented here.

  3. Trellis coding with Continuous Phase Modulation (CPM) for satellite-based land-mobile communications

    Science.gov (United States)

    1989-01-01

    This volume of the final report summarizes the results of our studies on the satellite-based mobile communications project. It includes: a detailed analysis, design, and simulations of trellis coded, full/partial response CPM signals with/without interleaving over various Rician fading channels; analysis and simulation of computational cutoff rates for coherent, noncoherent, and differential detection of CPM signals; optimization of the complete transmission system; analysis and simulation of power spectrum of the CPM signals; design and development of a class of Doppler frequency shift estimators; design and development of a symbol timing recovery circuit; and breadboard implementation of the transmission system. Studies prove the suitability of the CPM system for mobile communications.

  4. Image findings in central pontine myelinolysis (CPM) and extrapontine myelinolysis (EPM)

    International Nuclear Information System (INIS)

    Oergel, Anja; Hauser, Till-Karsten; Naegele, T.; Horger, Marius

    2017-01-01

    CT and NMR Image findings in central pontine myelinolysis (CPM) and extrapontine myelinolysis were compared with histological results. The clinical appearance and diagnosis using CT and NMR imaging are related to therapy decisions and outcome.

  5. Lack of predictive power of trait fear and anxiety for conditioned pain modulation (CPM).

    Science.gov (United States)

    Horn-Hofmann, Claudia; Priebe, Janosch A; Schaller, Jörg; Görlitz, Rüdiger; Lautenbacher, Stefan

    2016-12-01

    In recent years the association of conditioned pain modulation (CPM) with trait fear and anxiety has become a hot topic in pain research due to the assumption that such variables may explain the low CPM efficiency in some individuals. However, empirical evidence concerning this association is still equivocal. Our study is the first to investigate the predictive power of fear and anxiety for CPM by using a well-established psycho-physiological measure of trait fear, i.e. startle potentiation, in addition to two self-report measures of pain-related trait anxiety. Forty healthy, pain-free participants (female: N = 20; age: M = 23.62 years) underwent two experimental blocks in counter-balanced order: (1) a startle paradigm with affective picture presentation and (2) a CPM procedure with hot water as conditioning stimulus (CS) and contact heat as test stimulus (TS). At the end of the experimental session, pain catastrophizing (PCS) and pain anxiety (PASS) were assessed. PCS score, PASS score and startle potentiation to threatening pictures were entered as predictors in a linear regression model with CPM magnitude as criterion. We were able to show an inhibitory CPM effect in our sample: pain ratings of the heat stimuli were significantly reduced during hot water immersion. However, CPM was neither predicted by self-report of pain-related anxiety nor by startle potentiation as psycho-physiological measure of trait fear. These results corroborate previous negative findings concerning the association between trait fear/anxiety and CPM efficiency and suggest that shifting the focus from trait to state measures might be promising.

  6. Central pontine myelinolysis (CPM and extrapontine myelinolysis (EPM following concurrent chemoradiotherapy for nasopharyngeal carcinoma

    Directory of Open Access Journals (Sweden)

    Chen-Hui Chong

    2016-06-01

    Full Text Available Central pontine myelinolysis (CPM is a disease that may present with coma, quadriplegia, or no symptoms at all. It is an iatrogenic demyelinating disease caused most frequently by overzealous correction of chronic hyponatremia and excessive swings in serum osmolality. Lesions can also occur outside the pons as extrapontine myelinolysis (EPM. Herein we have reported a case of CPM and EPM in a patient after chemoradiotherapy for recurrent nasopharyngeal carcinoma.

  7. Gerenciamento de Projeto Otimista (GPO): Um Método que Integra PERT/CPM à CCPM

    OpenAIRE

    Novais, Igor Fontes; Jorge, Eduardo Manoel de Freitas; Junior, Carlos Pereira Costa; Souza, Daniele Tavares

    2011-01-01

    The time factor for project managers is one of the most worrisome because of difficulties in keeping projects on time, making interesting use of traditional techniques such as PERT/CPM. Another interesting technique that supports the management of time is the Critical Chain (CCPM) based on the Theory of Constraints (TOC). This article presents the method Optimistic Project Management (GPO) that is based on PERT/CPM and CCPM. The method GPO brings as differential a new way of assembling a sche...

  8. CPM s prepojením na aplikácie BI

    OpenAIRE

    Klimko, Jozef

    2008-01-01

    The bachelor thesis is devoted to the issue of Corporate Performance Management (CPM) as a comprehensive approach to managing performance of the company including processes, metrics, methodologies and technologies. The main aim of the bachelor thesis is to bring out a comprehensive view to the questions of Corporate Performance Management, analyse the market and neccessery parts of CPM. The thesis is based on available literature and internet sources dealing with this topic. The thesis is com...

  9. Use of inpatient continuous passive motion versus no CPM in computer-assisted total knee arthroplasty.

    Science.gov (United States)

    Alkire, Martha R; Swank, Michael L

    2010-01-01

    Continuous passive motion (CPM) has shown positive effects on tissue healing, edema, hemarthrosis, and joint function (L. Brosseau et al., 2004). CPM has also been shown to increase short-term early flexion and decrease length of stay (LOS) ( L. Brosseau et al., 2004; C. M. Chiarello, C. M. S. Gundersen, & T. O'Halloran, 2004). The benefits of CPM for the population of patients undergoing computer-assisted total knee arthroplasty (TKA) have not been examined. The primary objective of this study was to determine whether the use of CPM following computer-assisted TKA resulted in differences in range of motion, edema/drainage, functional ability, and pain. This was an experimental, prospective, randomized study of patients undergoing unilateral, computer-assisted TKA. The experimental group received CPM thrice daily and physical therapy (PT) twice daily during their hospitalization. The control group received PT twice daily and no CPM during the hospital stay. Both groups received PT after discharge. Measurement included Knee Society scores, Western Ontario McMaster Osteoarthritis Index values, range of motion, knee circumference, and HemoVac drainage. Data were collected at various intervals from preoperatively through 3 months. Although the control group was found to be higher functioning preoperatively, there was no statistically significant difference in flexion, edema or drainage, function, or pain between groups through the 3-month study period.

  10. [Efficiency of a postoperative treatment after rotator cuff repair with a continuous passive motion device (CPM)].

    Science.gov (United States)

    Michael, J W-P; König, D P; Imhoff, A B; Martinek, V; Braun, S; Hübscher, M; Koch, C; Dreithaler, B; Bernholt, J; Preis, S; Loew, M; Rickert, M; Speck, M; Bös, L; Bidner, A; Eysel, P

    2005-01-01

    The main objective of this study was to prove that a postoperative combined continuous passive motion (CPM) and physiotherapy treatment protocol (CPM group) can achieve 90 degrees active abduction in the shoulder joint earlier than physiotherapy alone (PT group). The indication was a complete tear of the rotator cuff. The study was conducted under in-patient and out-patient conditions. 55 patients were included in this study. The prospective, randomized multicenter study design complies with DIN EN 540. The primary endpoint was the time span until 90 degrees active abduction was achieved by the patients. Patients in the CPM group reached the primary endpoint on average 12 days earlier than the control group. This difference was statistically significant (p = 0.0292). Analyzing the secondary endpoints, e. g., pain and disablement, the results in the CPM group showed again advantages of the combined treatment protocol (CPM + physiotherapy). The postoperative treatment of a total tear of the rotator cuff with a combined continuous passive motion and physiotherapy protocol provided a significantly earlier range of motion in the shoulder joint than physiotherapy alone. There was no report of CPM-related adverse effects.

  11. Cysteine residue is not essential for CPM protein thermal-stability assay.

    Science.gov (United States)

    Wang, Zhaoshuai; Ye, Cui; Zhang, Xinyi; Wei, Yinan

    2015-05-01

    A popular thermal-stability assay developed especially for the study of membrane proteins uses a thiol-specific probe, 7-diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin (CPM). The fluorescence emission of CPM surges when it forms a covalent bond with the side chain of a free Cys, which becomes more readily accessible upon protein thermal denaturation. Interestingly, the melting temperatures of membrane proteins determined using the CPM assay in literature are closely clustered in the temperature range 45-55 °C. A thorough understanding of the mechanism behind the observed signal change is critical for the accurate interpretation of the protein unfolding. Here we used two α-helical membrane proteins, AqpZ and AcrB, as model systems to investigate the nature of the fluorescence surge in the CPM assay. We found that the transition temperatures measured using circular-dichroism (CD) spectroscopy and the CPM assay were significantly different. To eliminate potential artifact that might arise from the presence of detergent, we monitored the unfolding of two soluble proteins. We found that, contrary to current understanding, the presence of a sulfhydryl group was not a prerequisite for the CPM thermal-stability assay. The observed fluorescence increase is probably caused by binding of the fluorophore to hydrophobic patches exposed upon protein unfolding.

  12. Integral transport computation of gamma detector response with the CPM2 code

    International Nuclear Information System (INIS)

    Jones, D.B.

    1989-12-01

    CPM-2 Version 3 is an enhanced version of the CPM-2 lattice physics computer code which supports the capabilities to (1) perform a two-dimensional gamma flux calculation and (2) perform Restart/Data file maintenance operations. The Gamma Calculation Module implemented in CPM-2 was first developed for EPRI in the CASMO-1 computer code by Studsvik Energiteknik under EPRI Agreement RP2352-01. The gamma transport calculation uses the CPM-HET code module to calculate the transport of gamma rays in two dimensions in a mixed cylindrical-rectangular geometry, where the basic fuel assembly and component regions are maintained in a rectangular geometry, but the fuel pins are represented as cylinders within a square pin cell mesh. Such a capability is needed to represent gamma transport in an essentially transparent medium containing spatially distributed ''black'' cylindrical pins. Under a subcontract to RP2352-01, RPI developed the gamma production and gamma interaction library used for gamma calculation. The CPM-2 gamma calculation was verified against reference results generated by Studsvik using the CASMO-1 program. The CPM-2 Restart/Data file maintenance capabilities provide the user with options to copy files between Restart/Data tapes and to purge files from the Restart/Data tapes

  13. Contralateral prophylactic mastectomy (CPM): A systematic review of patient reported factors and psychological predictors influencing choice and satisfaction.

    Science.gov (United States)

    Ager, Brittany; Butow, Phyllis; Jansen, Jesse; Phillips, Kelly-Anne; Porter, David

    2016-08-01

    Conduct a systematic review of quantitative and qualitative studies exploring patient reported factors and psychological variables influencing the decision to have contralateral prophylactic mastectomy (CPM), and satisfaction with CPM, in women with early stage breast cancer. Studies were identified via databases: Medline, CINAHL, Embase and PsycINFO. Data were extracted by one author and crosschecked by two additional authors for accuracy. The quality of included articles was assessed using standardised criteria by three authors. Of the 1346 unique citations identified, 17 were studies that met the inclusion criteria. Studies included were primarily cross-sectional and retrospective. No study utilised a theoretical framework to guide research and few studies considered psychological predictors of CPM. Fear of breast cancer was the most commonly cited reason for CPM, followed by cosmetic reasons such as desire for symmetry. Overall, women appeared satisfied with CPM, however, adverse/diminished body image, poor cosmetic result, complications, diminished sense of sexuality, emotional issues and perceived lack of education regarding alternative surveillance/CPM efficacy were cited as reasons for dissatisfaction. Current literature has begun to identify patient-reported reasons for CPM; however, the relative importance of different factors and how these factors relate to the process underlying the decision to have CPM are unknown. Of women who considered CPM, limited information is available regarding differences between those who proceed with or ultimately decline CPM. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Thermal analysis on NAC-STC spent fuel transport cask under different transport conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Yumei [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Yang, Jian, E-mail: zdhjkz@zju.edu.cn [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Xu, Chao; Wang, Weiping [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Ma, Zhijun [Department of Material Engineering, South China University of Technology, Guangzhou (China)

    2013-12-15

    Highlights: • Spent fuel cask was investigated as a whole instead of fuel assembly alone. • The cask was successfully modeled and meshed after several simplifications. • Equivalence method was used to calculate the properties of parts. • Both the integral thermal field and peak values are captured to verify safety. • The temperature variations of key parts were also plotted. - Abstract: Transport casks used for conveying spent nuclear fuel are inseparably related to the safety of the whole reprocessing system for spent nuclear fuel. Thus they must be designed according to rigorous safety standards including thermal analysis. In this paper, for NAC-STC cask, a finite element model is established based on some proper simplifications on configurations and the heat transfer mechanisms. Considering the complex components and gaps, the equivalence method is presented to define their material properties. Then an equivalent convection coefficient is introduced to define boundary conditions. Finally, the temperature field is captured and analyzed under both normal and accident transport conditions by using ANSYS software. The validity of numerical calculation is given by comparing its results with theoretical calculation. Obtaining the integral distribution laws of temperature and peak temperature values of all vital components, the security of the cask can be evaluated and verified.

  15. Short p-type silicon microstrip detectors in 3D-stc technology

    Energy Technology Data Exchange (ETDEWEB)

    Eckert, S. [Physikalisches Institut, Albert-Ludwigs-Universitaet Freiburg, Hermann-Herder Strasse 3b, D-79104 Freiburg i. Br. (Germany)], E-mail: simon.eckert@physik.uni-freiburg.de; Jakobs, K.; Kuehn, S.; Parzefall, U. [Physikalisches Institut, Albert-Ludwigs-Universitaet Freiburg, Hermann-Herder Strasse 3b, D-79104 Freiburg i. Br. (Germany); Dalla-Betta, G.-F.; Zoboli, A. [Dipartimento di Ingegneria e Scienza dell' Informazione, Universita degli Studi di Trento, via Sommarive 14, I-38050 Povo di Trento (Italy); Pozza, A.; Zorzi, N. [FBK-irst Trento, Microsystems Division, via Sommarive 18, I-38050 Povo di Trento (Italy)

    2008-10-21

    The luminosity upgrade of the Large Hadron Collider (LHC), the sLHC, will constitute an extremely challenging radiation environment for tracking detectors. Significant improvements in radiation hardness are needed to cope with the increased radiation dose, requiring new tracking detectors. In the upgraded ATLAS detector the region from 20 to 50 cm distance to the beam will be covered by silicon strip detectors (SSD) with short strips. These will have to withstand a 1 MeV neutron equivalent fluence of about 1x10{sup 15}n{sub eq}/cm{sup 2}, hence extreme radiation resistance is necessary. For the short strips, we propose to use SSD realised in the radiation tolerant 3D technology, where rows of columns-etched into the silicon bulk-are joined together to form strips. To demonstrate the feasibility of 3D SSD for the sLHC, we have built prototype modules using 3D-single-type-column (stc) SSD with short strips and front-end electronics from the present ATLAS SCT. The modules were read out with the SCT Data Acquisition system and tested with an IR-laser. We report on the performance of these 3D modules, in particular the noise at 40 MHz which constitutes a measurement of the effective detector capacitance. Conclusions about options for using 3D SSD detectors for tracking at the sLHC are drawn.

  16. CPM Test-Retest Reliability: "Standard" vs "Single Test-Stimulus" Protocols.

    Science.gov (United States)

    Granovsky, Yelena; Miller-Barmak, Adi; Goldstein, Oren; Sprecher, Elliot; Yarnitsky, David

    2016-03-01

    Assessment of pain inhibitory mechanisms using conditioned pain modulation (CPM) is relevant clinically in prediction of pain and analgesic efficacy. Our objective is to provide necessary estimates of intersession CPM reliability, to enable transformation of the CPM paradigm into a clinical tool. Two cohorts of young healthy subjects (N = 65) participated in two dual-session studies. In Study I, a Bath-Thermode CPM protocol was used, with hot water immersion and contact heat as conditioning- and test-stimuli, respectively, in a classical parallel CPM design introducing test-stimulus first, and then the conditioning- and repeated test-stimuli in parallel. Study II consisted of two CPM protocols: 1) Two-Thermodes, one for each of the stimuli, in the same parallel design as above, and 2) single test-stimulus (STS) protocol with a single administration of a contact heat test-stimulus, partially overlapped in time by a remote shorter contact heat as conditioning stimulus. Test-retest reliability was assessed within 3-7 days. The STS-CPM had superior reliability intraclass correlation (ICC 2 ,: 1  = 0.59) over Bath-Thermode (ICC 2 ,: 1  = 0.34) or Two-Thermodes (ICC 2 ,: 1  = 0.21) protocols. The hand immersion conditioning pain had higher reliability than thermode pain (ICC 2 ,: 1  = 0.76 vs ICC 2 ,: 1  = 0.16). Conditioned test-stimulus pain scores were of good (ICC 2 ,: 1  = 0.62) or fair (ICC 2 ,: 1  = 0.43) reliability for the Bath-Thermode and the STS, respectively, but not for the Two-Thermodes protocol (ICC 2 ,: 1  = 0.20). The newly developed STS-CPM paradigm was more reliable than other CPM protocols tested here, and should be further investigated for its clinical relevance. It appears that large contact size of the conditioning-stimulus and use of single rather than dual test-stimulus pain contribute to augmentation of CPM reliability. © 2015 American Academy of Pain Medicine. All rights reserved. For permissions, please e

  17. Theoretical study on the gas adsorption capacity and selectivity of CPM-200-In/Mg and CPM-200-In/Mg-X (-X = -NH2, -OH, -N, -F).

    Science.gov (United States)

    Liu, Xiao-le; Chen, Guang-Hui; Wang, Xiu-Jun; Li, Peng; Song, Yi-Bing; Li, Rui-Yan

    2017-11-15

    The adsorption capacities of a heterometallic metal-organic framework (CPM-200-In/Mg) to VOCs (HCHO, C 2 H 4 , CH 4 , C 2 H 2 , C 3 H 8 , C 2 H 6 , C 2 H 3 Cl, C 2 H 2 Cl 2 , CH 2 Cl 2 and CHCl 3 ) and some inorganic gas molecules (HCN, SO 2 , NO, CO 2 , CO, H 2 S and NH 3 ), as well as its selectivity in ternary mixture systems of natural gas and post-combustion flue gas are theoretically explored at the grand canonical Monte Carlo (GCMC) and density functional theory (DFT) levels. It is shown that CPM-200-In/Mg is suitable for the adsorption of VOCs, particularly for HCHO (up to 0.39 g g -1 at 298 K and 1 bar), and the adsorption capacities of some inorganic gas molecules such as SO 2 , H 2 S and CO 2 match well with the sequence of their polarizability (SO 2 > H 2 S > CO 2 ). The large adsorption capacities of HCN and HCHO in the framework result from the strong interaction between adsorbates and metal centers, based on analyzing the radial distribution functions (RDF). Comparing C 2 H 4 and CH 4 molecules interacting with CPM-200-In/Mg by VDW interaction, we speculate that the high adsorption capacities of their chlorine derivatives in the framework could be due to the existence of halogen bonding or strong electrostatic and VDW interactions. It is found that the basic groups, including -NH 2 , -N and -OH, can effectively improve both the adsorption capacities and selectivity of CPM-200-In/Mg for harmful gases. Note that the adsorption capacity of CPM-200-In/Mg-NH 2 (site 2) (245 cm 3 g -1 ) for CO 2 exceeded that of MOF-74-Mg (228 cm 3 g -1 ) at 273 K and 1 bar and that for HCHO can reach 0.41 g g -1 , which is almost twice that of 438-MOF and nearly 45 times of that in active carbon. Moreover, for natural gas mixtures, the decarburization and desulfurization abilities of CPM-200-In/Mg-NH 2 (site 2) have exceeded those of the MOF-74 series, while for post-combustion flue gas mixtures, the desulfurization ability of CPM-200-In/Mg-NH 2 (site 2) is still

  18. Global restructuring of the CPM-2 transport algorithm for vector and parallel processing

    International Nuclear Information System (INIS)

    Vujic, J.L.; Martin, W.R.

    1989-01-01

    The CPM-2 code is an assembly transport code based on the collision probability (CP) method. It can in principle be applied to global reactor problems, but its excessive computational demands prevent this application. Therefore, a new transport algorithm for CPM-2 has been developed for vector-parallel architectures, which has resulted in an overall factor of 20 speedup (wall clock) on the IBM 3090-600E. This paper presents the detailed results of this effort as well as a brief description of ongoing effort to remove some of the modeling limitations in CPM-2 that inhibit its use for global applications, such as the use of the pure CP treatment and the assumption of isotropic scattering

  19. ROLAIDS-CPM, 1-D Slowing-Down by Collision Problems Method

    International Nuclear Information System (INIS)

    De Kruijf, W.J.M.

    2002-01-01

    1 - Description of program or function: ROLAIDS-CPM is based on the AMPX-module ROLAIDS (PSR-315). CPM stands for Collision Probability Method. ROLAIDS is a one-dimensional slowing-down code which uses the interface currents method. ROLAIDS-CPM does not need the assumption of cosine currents at the interface of the zones. Extensions: collision probability method for slab and cylinder geometry; different temperatures for a nuclide can be used; flat lethargy source can be modelled. 2 - Method of solution: Collision probabilities in cylindrical geometry are calculated according to the Carlvik Method. This means that a Gauss integration is used. 3 - Restrictions on the complexity of the problem: The maximum number of zones is 30 for the collision probability method

  20. Evaluation of the constant pressure panel method (CPM) for unsteady air loads prediction

    Science.gov (United States)

    Appa, Kari; Smith, Michael J. C.

    1988-01-01

    This paper evaluates the capability of the constant pressure panel method (CPM) code to predict unsteady aerodynamic pressures, lift and moment distributions, and generalized forces for general wing-body configurations in supersonic flow. Stability derivatives are computed and correlated for the X-29 and an Oblique Wing Research Aircraft, and a flutter analysis is carried out for a wing wind tunnel test example. Most results are shown to correlate well with test or published data. Although the emphasis of this paper is on evaluation, an improvement in the CPM code's handling of intersecting lifting surfaces is briefly discussed. An attractive feature of the CPM code is that it shares the basic data requirements and computational arrangements of the doublet lattice method. A unified code to predict unsteady subsonic or supersonic airloads is therefore possible.

  1. Hyaluron Filler Containing Lidocaine on a CPM Basis for Lip Augmentation: Reports from Practical Experience.

    Science.gov (United States)

    Fischer, Tanja C; Sattler, Gerhard; Gauglitz, Gerd G

    2016-06-01

    Lip augmentation with hyaluronic acid fillers is established. As monophasic polydensified hyaluronic acid products with variable density, CPM-HAL1 (Belotero Balance Lidocaine, Merz Aesthetics, Raleigh, NC) and CPM-HAL2 (Belotero Intense Lidocaine, Merz Aesthetics, Raleigh, NC) are qualified for beautification and particularly natural-looking rejuvenation, respectively. The aim of this article was to assess the handling and outcome of lip augmentation using the lidocaine-containing hyaluronic acid fillers, CPM-HAL1 and CPM-HAL2. Data were documented from patients who received lip augmentation by means of beautification and/or rejuvenation using CPM-HAL1 and/or CPM-HAL2. Observation period was 4 months, with assessment of natural outcome, evenness, distribution, fluidity, handling, malleability, tolerability, as well as patient satisfaction and pain. A total of 146 patients from 21 German centers participated. Physicians rated natural outcome and evenness as good or very good for more than 95% of patients. Distribution, fluidity, handling, and malleability were assessed for both fillers as good or very good in more than 91% of patients. At every evaluation point, more than 93% of patients were very or very much satisfied with the product. A total of 125 patients (85.6%) experienced transient injection-related side effects. Pain intensity during the procedure was mild (2.72 ± 1.72 on the 0-10 pain assessment scale) and abated markedly within 30 minutes (0.42 ± 0.57). Lip augmentation with hyaluronic acid fillers produced a long-term cosmetic result. Due to the lidocaine content, procedural pain was low and transient. Accordingly, a high degree of patient satisfaction was achieved that was maintained throughout the observation period. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  2. Perencanaan dan Pengendalian Proyek dengan Metode Pert - CPM Studi Kasus : Fly Over Ahmad Yani – Karawang

    Directory of Open Access Journals (Sweden)

    Anggara Hayun A

    2005-09-01

    Full Text Available The efficiency and effectivity is not a new guide in this global era. As a professional and innovative company, like consultant construction company that always makes customer satisfy, has a good achievement and reputation. There fore, efficiency and affectivity are necessary needed in a company. Article gives some inputs how to manage time become more effective and efficient in finishing project with CPM method. With using CPM method in “fly over project Ahmad Yani-Karawang”, is figured out the optimal time to finish this project which is 184 days.Keywords: 

  3. Sustainability of the Catalytic Activity of a Silica-Titania Composite (STC) for Long-Term Indoor Air Quality Control

    Science.gov (United States)

    Coutts, Janelle L.; Levine, Lanfang H.; Richards, Jeffrey T.

    2011-01-01

    TiO2-assisted photocatalytic oxidation (PCO) is an emerging technology for indoor air quality control and is also being evaluated as an alternative trace contaminant control technology for crew habitats in space exploration. Though there exists a vast range of literature on the development of photocatalysts and associated reactor systems, including catalyst performance and performance-influencing factors, the critical question of whether photocatalysts can sustain their initial catalytic activity over an extended period of operation has not been adequately addressed. For a catalyst to effectively serve as an air quality control product, it must be rugged enough to withstand exposure to a multitude of low concentration volatile organic compounds (VOCs) over long periods of time with minimal loss of activity. The objective of this study was to determine the functional lifetime of a promising photocatalyst - the silica-titania composite (STC) from Sol Gel Solutions, LLC in a real-world scenario. A bench-scale STC-packed annular reactor under continuous irradiation by a UV-A fluorescent black-light blue lamp ((lambda)max = 365 nm) was exposed to laboratory air continuously at an apparent contact time of 0.27 sand challenged with a known concentration of ethanol periodically to assess any changes in catalytic activity. Laboratory air was also episodically spiked with halocarbons (e.g., octafluoropropane), organosulfur compounds (e.g., sulfur hexafluoride), and organosilicons (e.g., siloxanes) to simulate accidental releases or leaks of such VOCs. Total organic carbon (TOC) loading and contaminant profiles of the laboratory air were also monitored. Changes in STC photocatalytic performance were evaluated using the ethanol mineralization rate, mineralization efficiency, and oxidation intermediate (acetaldehyde) formation. Results provide insights to any potential catalyst poisoning by trace halocarbons and organosulfur compounds.

  4. Nicotine-Induced Effects on Nicotinic Acetylcholine Receptors (nAChRs), Ca2+ and Brain-Derived Neurotrophic Factor (BDNF) in STC-1 Cells.

    Science.gov (United States)

    Qian, Jie; Mummalaneni, Shobha K; Alkahtani, Reem M; Mahavadi, Sunila; Murthy, Karnam S; Grider, John R; Lyall, Vijay

    2016-01-01

    In addition to the T2R bitter taste receptors, neuronal nicotinic acetylcholine receptors (nAChRs) have recently been shown to be involved in the bitter taste transduction of nicotine, acetylcholine and ethanol. However, at present it is not clear if nAChRs are expressed in enteroendocrine cells other than beta cells of the pancreas and enterochromaffin cells, and if they play a role in the synthesis and release of neurohumoral peptides. Accordingly, we investigated the expression and functional role of nAChRs in enteroendocrine STC-1 cells. Our studies using RT-PCR, qRT-PCR, immunohistochemical and Western blotting techniques demonstrate that STC-1 cells express several α and β nAChR subunits. Exposing STC-1 cells to nicotine acutely (24h) or chronically (4 days) induced a differential increase in the expression of nAChR subunit mRNA and protein in a dose- and time-dependent fashion. Mecamylamine, a non-selective antagonist of nAChRs, inhibited the nicotine-induced increase in mRNA expression of nAChRs. Exposing STC-1 cells to nicotine increased intracellular Ca2+ in a dose-dependent manner that was inhibited in the presence of mecamylamine or dihydro-β-erythroidine, a α4β2 nAChR antagonist. Brain-derived neurotrophic factor (BDNF) mRNA and protein were detected in STC-1 cells using RT-PCR, specific BDNF antibody, and enzyme-linked immunosorbent assay. Acute nicotine exposure (30 min) decreased the cellular content of BDNF in STC-1 cells. The nicotine-induced decrease in BDNF was inhibited in the presence of mecamylamine. We also detected α3 and β4 mRNA in intestinal mucosal cells and α3 protein expression in intestinal enteroendocrine cells. We conclude that STC-1 cells and intestinal enteroendocrine cells express nAChRs. In STC-1 cells nAChR expression is modulated by exposure to nicotine in a dose- and time-dependent manner. Nicotine interacts with nAChRs and inhibits BDNF expression in STC-1 cells.

  5. Analysis of the Raven CPM Subtest Scores for a Sample of Gifted Children.

    Science.gov (United States)

    Kluever, Raymond C.; Green, Kathy E.

    The inter-subject/intra-subject subtest patterns (profiles) of the same sample of gifted children were examined based on factors found in a previous study of the Raven Coloured Progressive Matrices Test (CPM) that investigated structural properties with specific application to a sample of gifted children. The sample consisted of 166 children (78…

  6. Effectiveness of Music Listening in Patients With Total Knee Replacement During CPM Rehabilitation.

    Science.gov (United States)

    Hsu, Chih-Chung; Chen, Wei-Ming; Chen, Su-Ru; Tseng, Yen-Ting; Lin, Pi-Chu

    2016-01-01

    This study investigated the effects of music listening on the anxiety, heart rate variability (HRV), and joint range of motion (ROM) of patients undergoing continuous passive motion (CPM) after total knee replacement surgery. An experimental design was used. Participants in the experimental group (n = 49) listened to music from 10 min before receiving CPM until the end of the session (25 min in total) on the first and second day following surgery, whereas participants in the control group (n = 42) did not listen to music but rested quietly in bed starting 10 min before and throughout CPM. Compared with the control group, the experimental group exhibited significantly lower anxiety levels (p CPM angles (p < .05) during treatment and increased active flexion ROM (p < .05) upon discharge. The low-frequency (LF)/high-frequency (HF) power ratio, normalized LF HRV, and normalized HF HRV of the two groups differed significantly, indicating that the patients in the experimental group had greater parasympathetic activity compared with those in the control group. Music listening can effectively reduce patient anxiety and enhance the ROM of their joints during postoperative rehabilitation. Health-care practitioners should consider including music listening as a routine practice for postoperative rehabilitation following orthopedic surgery. © The Author(s) 2015.

  7. Combined electric and pressure cuff pain stimuli for assessing conditioning pain modulation (CPM).

    Science.gov (United States)

    Tsukamoto, M; Petersen, K K; Mørch, C D; Arendt-Nielsen, L

    2017-12-29

    Aims Traditionally, conditioning pain modulation (CPM) can be assessed by applying a test stimulus (TS) before and after application of a conditioning stimulus (CS), which is normally applied extra-segmental. Currently, no studies have attempted to apply the TS and CS to the same site using different stimuli modalities. The aim of this study was to evaluate electrical TS and cuff pressure CS applied to the same experimental site for studying CPM. Methods 20 male volunteers participated in this study, which consisted of stimulations applied by a cuff-algometer (NociTech and Aalborg University, Denmark) and current stimulator (Digitimer DS5, UK), through two Ag/AgCl electrodes (Ambu® Neuroline 700, Denmark). The cuff was wrapped around the lower leg and stimulation electrodes were placed under the cuff and to the same location on the contralateral leg. Electrical TS were applied to the non-dominant leg with or without cuff pressure CS on the dominant (CS1) or the same (non-dominant) leg (CS2, electrode under cuff). The subjects were instructed to rate the electrical evoked pain intensity on a 10-cm continuous visual analog scale (VAS, "0" represented "no pain", and "10" represented "maximal pain"). The pain detection threshold (PDT) was defined as "1" on the VAS scale. Results There was no significant deference in PDT for neither CS1 nor CS2. A median split subanalysis on CPM-responders versus CPM-nonresponders to the TS + CS1 combination. Using this grouping, there was significant increase in PDT when comparing TS to TS + CS1 or TS + CS2 (4.0 mA vs 5.6 mA; P CPM can be evoked in a subgroup of subjects by applying the electrical test stimulus and cuff pressure conditioning stimuli to the same experimental site.

  8. Temporal changes in cortical activation during conditioned pain modulation (CPM), a LORETA study.

    Science.gov (United States)

    Moont, Ruth; Crispel, Yonatan; Lev, Rina; Pud, Dorit; Yarnitsky, David

    2011-07-01

    For most healthy subjects, both subjective pain ratings and pain-evoked potentials are attenuated under conditioned pain modulation (CPM; formerly termed diffuse noxious inhibitory controls, or DNIC). Although essentially spinal-bulbar, this inhibition is under cortical control. This is the first study to observe temporal as well as spatial changes in cortical activations under CPM. Specifically, we aimed to investigate the interplay of areas involved in the perception and processing of pain and those involved in controlling descending inhibition. We examined brief consecutive poststimulus time windows of 50 ms using a method of source-localization from pain evoked potentials, sLORETA. This enabled determination of dynamic changes in localized cortical generators evoked by phasic noxious heat stimuli to the left volar forearm in healthy young males, with and without conditioning hot-water pain to the right hand. We found a CPM effect characterized by an initial increased activation in the orbitofrontal cortex (OFC) and amygdala at 250-300 ms poststimulus, which was correlated with the extent of psychophysical pain reduction. This was followed by reduced activations in the primary and secondary somatosensory cortices, supplementary motor area, posterior insula, and anterior cingulate cortex from 400 ms poststimulus. Our findings show that the prefrontal pain-controlling areas of OFC and amygdala increase their activity in parallel with subjective pain reduction under CPM, and that this increased activity occurs prior to reductions in activations of the pain sensory areas. In conclusion, achieving pain inhibition by the CPM process seems to be under control of the OFC and the amygdala. Copyright © 2011 International Association for the Study of Pain. Published by Elsevier B.V. All rights reserved.

  9. Histological and histomorphometrical evaluation of furcation perforations filled with MTA, CPM and ZOE.

    Science.gov (United States)

    da Silva, G F; Guerreiro-Tanomaru, J M; Sasso-Cerri, E; Tanomaru-Filho, M; Cerri, P S

    2011-02-01

    To evaluate the biological response of the periodontium adjacent to furcation perforations in rat molars filled with Endo-CPM-Sealer (CPM), MTA-Angelus (MTA) or zinc oxide-eugenol cement (ZOE). The pulp chamber floors of maxillary right first molar teeth were perforated and sealed with CPM, mineral trioxide aggregate (MTA) or ZOE; the left first molars, without any treatment, were used as controls (CG). After 7, 15, 30 and 60 days, fragments of maxilla were fixed, decalcified and embedded in paraffin. Sections were stained with H&E, Masson's trichrome and submitted to tartrate-resistant acid phosphatase (TRAP) reaction, used as an osteoclast marker. The width of the periodontal space, the numerical density of inflammatory cells and the number of TRAP-positive osteoclasts in the bone surface were measured, and statistical analyses were performed using analysis of variance and Tukey test (P ≤ 0.05). In all experimental groups, the greatest number of inflammatory cells was observed at 7 days, especially in the ZOE group. In this group, the intense inflammatory process was related to a significant increase (P ≤ 0.05) in the number of osteoclasts and, thereby, in an increase in the width of the periodontal space. At 60 days, no significant differences in osteoclast numbers amongst CPM, MTA and CG groups occurred; the periodontal space was also significantly reduced in the experimental groups in comparison with the initial periods. However, in the ZOE group, the periodontal space was significantly larger (P ≤ 0.05) in comparison with MTA-based materials. The periodontium adjacent to perforations filled with MTA and CPM exhibited clear evidence of re-establishment and thus better biocompatibility than ZOE. © 2010 International Endodontic Journal.

  10. Investigation of confined placental mosaicism (CPM) at multiple sites in post-delivery placentas derived through intracytoplasmic sperm injection (ICSI).

    Science.gov (United States)

    Minor, Agata; Harmer, Karynn; Peters, Nicole; Yuen, Basil Ho; Ma, Sai

    2006-01-01

    Although earlier studies on pregnancies derived through intracytoplasmic sperm injection (ICSI) reported increased non-mosaic aneuploidy among ICSI children, undetected mosaicism, such as confined placental mosaicism (CPM) has not been evaluated. We investigated the incidence of CPM in post-delivery placentas derived from ICSI, evaluated whether CPM was increased and whether it was a contributing factor to negative pregnancy outcome. [Fifty-one post-delivery placentas were collected from patients who underwent ICSI with a normal or negative pregnancy outcome]. Trophoblast and chorionic stroma from three sites were analyzed by comparative genomic hybridization (CGH) and flow cytometry. Detected abnormalities were confirmed by fluorescence in situ hybridization (FISH). The incidence of CPM in the ICSI population was compared to the general population from published data. We detected three cases of CPM in our study. One abnormality was found by CGH analysis; partial trisomy 7q and a partial monosomy Xp limited to the trophoblast at two sites. The abnormality was associated with a child affected by spina bifida. Two cases of mosaic tetraploidy were observed by flow cytometry in pregnancies with a normal outcome. All three abnormalities were confirmed by FISH analysis. The incidence of CPM in the ICSI study population was 5.88% (3/51), which was not statistically different from published reports in the general population (5.88% (42/714), Chi square, P > 0.05). The post-ICSI population was not at risk for CPM in this study. (c) 2005 Wiley-Liss, Inc.

  11. Gerenciamento de Projeto Otimista (GPO: Um Método que Integra PERT/CPM à CCPM

    Directory of Open Access Journals (Sweden)

    Igor Fontes Novais

    2011-12-01

    Full Text Available O fator tempo para os gerentes de projetos é um dos pontos mais preocupantes em razão das dificuldades em manter os projetos no prazo previsto, tornando interessante o uso de técnicas tradicionais como PERT/CPM. Outra técnica interessante que apóia a gestão de tempo é a Corrente Crítica (CCPM baseada na Teoria das Restrições (TOC. Este artigo apresenta o método Gerenciamento de Projeto Otimista (GPO que é baseado na PERT/CPM e na CCPM. O método GPO traz como diferencial uma nova forma de montagem de um cronograma, visando obter durações de atividades e buffers mais precisas.DOI:10.5585/gep.v2i2.25

  12. Kinematic Analysis of Cpm Machine Supporting to Rehabilitation Process after Surgical Knee Arthroscopy and Arthroplasty

    Science.gov (United States)

    Trochimczuk, R.; Kuźmierowski, T.

    2014-11-01

    Existing commercial solutions of the CPM (Continuous Passive Motion) machines are described in the paper. Based on the analysis of existing solutions we present our conceptual solution to support the process of rehabilitation of the knee joint which is necessary after arthroscopic surgery. For a given novel structure we analyze and present proprietary algorithms and the computer application to simulate the operation of our PCM device. In addition, we suggest directions for further research.

  13. OPTIMIZATION OF TIMES AND COSTS OF PROJECT OF HORIZONTAL LAMINATOR PRODUCTION USING PERT/CPM TECHNICAL

    Directory of Open Access Journals (Sweden)

    Fernando Henrique Lermen

    2016-09-01

    Full Text Available The PERT/CPM is a technique widely used in both the scheduling and in the project feasibility in terms of cost control and time.  In order to optimize time and costs involved in production, the work presented here aims to apply the PERT/CPM technique in the production project of the Horizontal Laminator, a machine used to cut polyurethane foam blocks in the mattresses industries. For the application of PERT/CPM technique in the project of Horizontal Laminator production were identified the activities that compose the project, the dependence between them, the normal and accelerated durations and the normal and accelerated costs. In this study, deterministic estimates for the duration of the activities were considered. The results show that the project can be completed in 520 hours at a total cost of R$7,042.50, when all activities are performed in their normal durations.  When all the activities that compose the critical path are accelerated, the project can be completed in 333.3 hours at a total cost of R$9,263.01. If the activities slacks have been exploited, it can obtain a final total cost of R$6,157.8, without changing the new duration of the project. It is noteworthy that the final total cost of the project if the slacks are used, will be lower than the initial cost. Regarding the initial cost of the project, after the application of the PERT/CPM technique, it presents a decrease of 12.56% of the total project cost.

  14. Optimising the Design Process of the Injection Camshaft by Critical Path Method (CPM

    Directory of Open Access Journals (Sweden)

    Olga-Ioana Amariei

    2016-10-01

    Full Text Available In the present paper a series of advantages of the CPM method are presented, focusing on the optimization of design duration of an injection camshaft, by cost criteria. The minimum duration of finalizing the design of the injection camshaft will be determined, as well as the total cost associated to this project, normally, and then under crash regime. At the end, two types of sensitivity analysis will be performed: Meeting the desire completation time and Meeting the desired budget cost

  15. Sealing ability of MTA, CPM, and MBPc as root-end filling materials: a bacterial leakage study.

    Science.gov (United States)

    Medeiros, Paulo Leal; Bernardineli, Norberti; Cavenago, Bruno Cavalini; Torres, Sérgio Aparecido; Duarte, Marco Antonio Hungaro; Bramante, Clovis Monteiro; Marciano, Marina Angélica

    2016-04-01

    Objectives To evaluate the sealing ability of three root-end filling materials (white MTA, CPM, and MBPc) using an Enterococcus faecalis leakage model. Material and Methods Seventy single-root extracted human teeth were instrumented and root-ends were resected to prepare 3 mm depth cavities. Root-end preparations were filled with white MTA, CPM, and MBPc cements. Enterococcus faecalis was coronally introduced and the apical portion was immersed in BHI culture medium with phenol red indicator. The bacterial leakage was monitored every 24 h for 4 weeks. The statistical analysis was performed using the Wilcoxon-Gehan test (pCPM and the other groups. Conclusions The epoxy resin-based cement MBPc had lower bacterial leakage compared with the calcium silicate-based cements MTA and CPM.

  16. Interaction of angiotensin-converting enzyme (ACE) with membrane-bound carboxypeptidase M (CPM) - a new function of ACE.

    Science.gov (United States)

    Sun, Xiaoou; Wiesner, Burkhard; Lorenz, Dorothea; Papsdorf, Gisela; Pankow, Kristin; Wang, Po; Dietrich, Nils; Siems, Wolf-Eberhard; Maul, Björn

    2008-12-01

    Angiotensin-converting enzyme (ACE) demonstrates, besides its typical dipeptidyl-carboxypeptidase activity, several unusual functions. Here, we demonstrate with molecular, biochemical, and cellular techniques that the somatic wild-type murine ACE (mACE), stably transfected in Chinese Hamster Ovary (CHO) or Madin-Darby Canine Kidney (MDCK) cells, interacts with endogenous membranal co-localized carboxypeptidase M (CPM). CPM belongs to the group of glycosylphosphatidylinositol (GPI)-anchored proteins. Here we report that ACE, completely independent of its known dipeptidase activities, has GPI-targeted properties. Our results indicate that the spatial proximity between mACE and the endogenous CPM enables an ACE-evoked release of CPM. These results are discussed with respect to the recently proposed GPI-ase activity and function of sperm-bound ACE.

  17. Design of Multiple Trellis-Coded Multi-h CPM Based on Super Trellis

    Directory of Open Access Journals (Sweden)

    X. Liu. A. Liu

    2012-12-01

    Full Text Available It has been shown that the multiple trellis code can perform better than the conventional trellis code over AWGN channels, at the cost of additional computations per trellis branch. Multiple trellis coded multi-h CPM schemes have been shown in the literature to have attractive power-bandwidth performance at the expense of increased receiver complexity. In this method, the multi-h format is made to be associated with the specific pattern and repeated rather than cyclically changed in time for successive symbol intervals, resulting in a longer effective length of the error event with better performance. It is well known that the rate (n-1/n multiple trellis codes combined with 2^n-level CPM have good power-bandwidth performance. In this paper, a scheme combining rate 1/2 and 2/3 multiple trellis codes with 4- and 8-level multi-h CPM is shown to have better power-bandwidth performance over the upper bound than the scheme with single-h.

  18. Study of CPM Device used for Rehabilitation and Effective Pain Management Following Knee Alloplasty

    Science.gov (United States)

    Trochimczuk, R.; Kuźmierowski, T.; Anchimiuk, P.

    2017-02-01

    This paper defines the design assumptions for the construction of an original demonstration of a CPM device, based on which a solid virtual model will be created in a CAD software environment. The overall dimensions and other input parameters for the design were determined for the entire patient population according to an anatomical atlas of human measures. The medical and physiotherapeutic community were also consulted with respect to the proposed engineering solutions. The virtual model of the CPM device that will be created will be used for computer simulations of changes in motion parameters as a function of time, accounting for loads and static states. The results obtained from computer simulation will be used to confirm the correctness of the design adopted assumptions and of the accepted structure of the CPM mechanism, and potentially to introduce necessary corrections. They will also provide a basis for the development of a control strategy for the laboratory prototype and for the selection of the strategy of the patient's rehabilitation in the future. This paper will be supplemented with identification of directions of further research.

  19. Mathematical modeling and experimental breakthrough curves of carbon dioxide adsorption on metal organic framework CPM-5.

    Science.gov (United States)

    Sabouni, Rana; Kazemian, Hossein; Rohani, Sohrab

    2013-08-20

    It is essential to capture carbon dioxide from flue gas because it is considered one of the main causes of global warming. Several materials and different methods have been reported for CO2 capturing including adsorption onto zeolites and porous membranes, as well as absorption in amine solutions. All such methods require high energy input and high cost. A new class of porous materials called Metal Organic Frameworks (MOFs) exhibited excellent performance in extracting carbon dioxide from a gas mixture. In this study, the breakthrough curves for the adsorption of carbon dioxide on CPM-5 (crystalline porous materials) were obtained experimentally and theoretically using a laboratory-scale fixed-bed column at different experimental conditions such as feed flow rate, adsorption temperature, and feed concentration. It was found that the CPM-5 has a dynamic CO2 adsorption capacity of 11.9 wt % (2.7 mmol/g) (corresponding to 8 mL/min, 298 K, and 25% v/v CO2). The tested CPM-5 showed an outstanding adsorption equilibrium capacity (e.g., 2.3 mmol/g (10.2 wt %) at 298 K) compared to other adsorbents, which can be considered as an attractive adsorbent for separation of CO2 from flue gas.

  20. Motorized CPM/CAM physiotherapy device with sliding-mode Fuzzy Neural Network control loop.

    Science.gov (United States)

    Ho, Hung-Jung; Chen, Tien-Chi

    2009-11-01

    Continuous passive motion (CPM) and controllable active motion (CAM) physiotherapy devices promote rehabilitation of damaged joints. This paper presents a computerized CPM/CAM system that obviates the need for mechanical resistance devices such as springs. The system is controlled by a computer which performs sliding-mode Fuzzy Neural Network (FNN) calculations online. CAM-type resistance force is generated by the active performance of an electric motor which is controlled so as to oppose the motion of the patient's leg. A force sensor under the patient's foot on the device pedal provides data for feedback in a sliding-mode FNN control loop built around the motor. Via an active impedance control feedback system, the controller drives the motor to behave similarly to a damped spring by generating and controlling the amplitude and direction of the pedal force in relation to the patient's leg. Experiments demonstrate the high sensitivity and speed of the device. The PC-based feedback nature of the control loop means that sophisticated auto-adaptable CPM/CAM custom-designed physiotherapy becomes possible. The computer base also allows extensive data recording, data analysis and network-connected remote patient monitoring.

  1. CPM Signals for Satellite Navigation in the S and C Bands.

    Science.gov (United States)

    Xue, Rui; Sun, Yanbo; Zhao, Danfeng

    2015-06-05

    Frequency allocations in the L band suitable for global navigation satellite system (GNSS) services are getting crowded and system providers face an ever tougher job when they try to bring in new signals and services while maintaining radio frequency compatibility. With the successive opening of the S and C bands to GNSS service, the multi-band combined navigation is predicted to become a key technology for future high-precision positioning navigation systems, and a single modulation scheme satisfying the requirements in each band is a promising solution for reducing user terminal complexity. A universal modulation scheme based on the continuous phase modulation (CPM) family suitable for the above bands' demands is proposed. Moreover, this paper has put forward two specific CPM signals for the S and C bands, respectively. Then the proposed modulation schemes, together with existing candidates, are comprehensively evaluated. Simulation results show that the proposed CPM signals can not only satisfy the constraint condition of compatibility in different bands well and reduce user terminal complexity, but also provide superior performance in terms of tracking accuracy, multi-path mitigation and anti-jamming compared to other candidate modulation schemes.

  2. External validation of the Cairns Prediction Model (CPM) to predict conversion from laparoscopic to open cholecystectomy.

    Science.gov (United States)

    Hu, Alan Shiun Yew; Donohue, Peter O'; Gunnarsson, Ronny K; de Costa, Alan

    2018-03-14

    Valid and user-friendly prediction models for conversion to open cholecystectomy allow for proper planning prior to surgery. The Cairns Prediction Model (CPM) has been in use clinically in the original study site for the past three years, but has not been tested at other sites. A retrospective, single-centred study collected ultrasonic measurements and clinical variables alongside with conversion status from consecutive patients who underwent laparoscopic cholecystectomy from 2013 to 2016 in The Townsville Hospital, North Queensland, Australia. An area under the curve (AUC) was calculated to externally validate of the CPM. Conversion was necessary in 43 (4.2%) out of 1035 patients. External validation showed an area under the curve of 0.87 (95% CI 0.82-0.93, p = 1.1 × 10 -14 ). In comparison with most previously published models, which have an AUC of approximately 0.80 or less, the CPM has the highest AUC of all published prediction models both for internal and external validation. Crown Copyright © 2018. Published by Elsevier Inc. All rights reserved.

  3. Clinical outcomes in pediatric hemodialysis patients in the USA: lessons from CMS' ESRD CPM Project.

    Science.gov (United States)

    Neu, Alicia M; Frankenfield, Diane L

    2009-07-01

    Although prospective randomized trials have provided important information and allowed the development of evidence-based guidelines in adult hemodialysis (HD) patients, with approximately 800 prevalent pediatric HD patients in the United States, such studies are difficult to perform in this population. Observational data obtained through the Center for Medicare & Medicaid Services' (CMS') End Stage Renal Disease (ESRD) Clinical Performance Measures (CPM) Project have allowed description of the clinical care provided to pediatric HD patients as well as identification of risk factors for failure to reach adult targets for clinical parameters such as hemoglobin, single-pool Kt/V (spKt/V) and serum albumin. In addition, studies linking data from the ESRD CPM Project and the United States Renal Data System have allowed evaluation of associations between achievement of those targets and the outcomes of hospitalization and death. The results of those studies, while unable to prove cause and effect, suggest that the adult ESRD CPM targets may assist in identifying pediatric HD patients at risk for poor outcomes.

  4. Alteration and Implementation of the CP/M-86 Operating System for a Multi-User Environment.

    Science.gov (United States)

    1982-12-01

    THE CP/M-86 OPERATING SYSTEM FOR A MULTI-USER ENVIRONMENT by Thomas V. Almquist and David S. Stevens C-, December 1982 ,LU Thesis Advisor : U. R. Kodres...tool$ 044, robo O0eA 6^900091 Approved for public release; distribution unlimited Alteration and Implementation of the CP/M-86 Operating System for a...SCIENCE IN COMPUTER SCIENCE from the NAVAL POSTGRADUATE SCHOOL December 1982 Authors: Approved by: ..... .. . . . . . . . . Thesis Advisor Second

  5. Administración de proyectos con Excel usando PERT/CPM

    Directory of Open Access Journals (Sweden)

    Carlos Azofeifa Zamora

    2016-03-01

    Full Text Available Se presenta la técnica PERT/CPM de la ciencia administrativa, que ayuda a comprobar y controlar aquellos proyectos que involucran muchas tareas interrelacionadas, mediante la resolución de un problema de la administración de proyectos con la ayuda de la hoja electrónica Excel, además, se realiza un análisis de sus beneficios. También se aplica la técnica PERT/Costos en el control de los costos del proyecto, Nassir Sapag Chain (2001 es una guía especial en este tema.

  6. Measurements of WDS Objects Found in Images Taken for Detecting CPM Pairs in the LSPM Catalog

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2017-10-01

    During our research for CPM objects in the LSPM catalog so far not included in the WDS catalog part II (Knapp and Nanson 2017) we found by chance a surprisingly large number of WDS objects in the field of view of several images taken for this project. To use the existing image material in the best possible way we decided to take measurements of these objects and to look at other existing catalog data allowing a check for potential common proper motion. This report presents the findings of this research.

  7. CPm gene diversity in field isolates of Citrus tristeza virus from Colombia.

    Science.gov (United States)

    Oliveros-Garay, Oscar Arturo; Martinez-Salazar, Natalhie; Torres-Ruiz, Yanneth; Acosta, Orlando

    2009-01-01

    The nucleotide sequence diversity of the CPm gene from 28 field isolates of Citrus tristeza virus (CTV) was assessed by SSCP and sequence analyses. These isolates showed two major shared haplotypes, which differed in distribution: A1 was the major haplotype in 23 isolates from different geographic regions, whereas R1 was found in isolates from a discrete region. Phylogenetic reconstruction clustered A1 within an independent group, while R1 was grouped with mild isolates T30 from Florida and T385 from Spain. Some isolates contained several minor haplotypes, which were very similar to, and associated with, the major haplotype.

  8. Effectiveness of prolonged use of continuous passive motion (CPM, as an adjunct to physiotherapy, after total knee arthroplasty

    Directory of Open Access Journals (Sweden)

    Geesink Ruud JT

    2008-04-01

    Full Text Available Abstract Background Adequate and intensive rehabilitation is an important requirement for successful total knee arthroplasty. Although research suggests that Continuous Passive Motion (CPM should be implemented in the first rehabilitation phase after surgery, there is substantial debate about the duration of each session and the total period of CPM application. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. Methods In a randomised controlled trial we investigated the effectiveness of prolonged CPM use in the home situation as an adjunct to standardised PT. Efficacy was assessed in terms of faster improvements in range of motion (RoM and functional recovery, measured at the end of the active treatment period, 17 days after surgery. Sixty patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment were randomised over two treatment groups. The experimental group received CPM + PT for 17 consecutive days after surgery, whereas the usual care group received the same treatment during the in-hospital phase (i.e. about four days, followed by PT alone (usual care in the first two weeks after hospital discharge. From 18 days to three months after surgery, both groups received standardised PT. The primary focus of rehabilitation was functional recovery (e.g. ambulation and regaining RoM in the knee. Results Prolonged use of CPM slightly improved short-term RoM in patients with limited RoM at the time of discharge after total knee arthroplasty when added to a semi-standard PT programme. Assessment at 6 weeks and three months after surgery found no long-term effects of this intervention Neither did we detect functional benefits of the improved RoM at any of the outcome assessments. Conclusion Although results

  9. Effectiveness of prolonged use of continuous passive motion (CPM), as an adjunct to physiotherapy, after total knee arthroplasty

    Science.gov (United States)

    Lenssen, Ton AF; van Steyn, Mike JA; Crijns, Yvonne HF; Waltjé, Eddie MH; Roox, George M; Geesink, Ruud JT; Brandt, Piet A van den; De Bie, Rob A

    2008-01-01

    Background Adequate and intensive rehabilitation is an important requirement for successful total knee arthroplasty. Although research suggests that Continuous Passive Motion (CPM) should be implemented in the first rehabilitation phase after surgery, there is substantial debate about the duration of each session and the total period of CPM application. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. Methods In a randomised controlled trial we investigated the effectiveness of prolonged CPM use in the home situation as an adjunct to standardised PT. Efficacy was assessed in terms of faster improvements in range of motion (RoM) and functional recovery, measured at the end of the active treatment period, 17 days after surgery. Sixty patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment were randomised over two treatment groups. The experimental group received CPM + PT for 17 consecutive days after surgery, whereas the usual care group received the same treatment during the in-hospital phase (i.e. about four days), followed by PT alone (usual care) in the first two weeks after hospital discharge. From 18 days to three months after surgery, both groups received standardised PT. The primary focus of rehabilitation was functional recovery (e.g. ambulation) and regaining RoM in the knee. Results Prolonged use of CPM slightly improved short-term RoM in patients with limited RoM at the time of discharge after total knee arthroplasty when added to a semi-standard PT programme. Assessment at 6 weeks and three months after surgery found no long-term effects of this intervention Neither did we detect functional benefits of the improved RoM at any of the outcome assessments. Conclusion Although results indicate that prolonged CPM use

  10. Effectiveness of prolonged use of continuous passive motion (CPM), as an adjunct to physiotherapy, after total knee arthroplasty.

    Science.gov (United States)

    Lenssen, Ton A F; van Steyn, Mike J A; Crijns, Yvonne H F; Waltjé, Eddie M H; Roox, George M; Geesink, Ruud J T; van den Brandt, Piet A; De Bie, Rob A

    2008-04-29

    Adequate and intensive rehabilitation is an important requirement for successful total knee arthroplasty. Although research suggests that Continuous Passive Motion (CPM) should be implemented in the first rehabilitation phase after surgery, there is substantial debate about the duration of each session and the total period of CPM application. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. In a randomised controlled trial we investigated the effectiveness of prolonged CPM use in the home situation as an adjunct to standardised PT. Efficacy was assessed in terms of faster improvements in range of motion (RoM) and functional recovery, measured at the end of the active treatment period, 17 days after surgery. Sixty patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment were randomised over two treatment groups. The experimental group received CPM + PT for 17 consecutive days after surgery, whereas the usual care group received the same treatment during the in-hospital phase (i.e. about four days), followed by PT alone (usual care) in the first two weeks after hospital discharge. From 18 days to three months after surgery, both groups received standardised PT. The primary focus of rehabilitation was functional recovery (e.g. ambulation) and regaining RoM in the knee. Prolonged use of CPM slightly improved short-term RoM in patients with limited RoM at the time of discharge after total knee arthroplasty when added to a semi-standard PT programme. Assessment at 6 weeks and three months after surgery found no long-term effects of this intervention Neither did we detect functional benefits of the improved RoM at any of the outcome assessments. Although results indicate that prolonged CPM use might have a small short-term effect

  11. Design and Implementation of Mobile Car with Wireless Video Monitoring System Based on STC89C52

    Directory of Open Access Journals (Sweden)

    Yang Hong

    2014-05-01

    Full Text Available With the rapid development of wireless networks and image acquisition technology, wireless video transmission technology has been widely applied in various communication systems. The traditional video monitoring technology is restricted by some conditions such as layout, environmental, the relatively large volume, cost, and so on. In view of this problem, this paper proposes a method that the mobile car can be equipped with wireless video monitoring system. The mobile car which has some functions such as detection, video acquisition and wireless data transmission is developed based on STC89C52 Micro Control Unit (MCU and WiFi router. Firstly, information such as image, temperature and humidity is processed by the MCU and communicated with the router, and then returned by the WiFi router to the host computer phone. Secondly, control information issued by the host computer phone is received by WiFi router and sent to the MCU, and then the MCU sends relevant instructions. Lastly, the wireless transmission of video images and the remote control of the car are realized. The results prove that the system has some features such as simple operation, high stability, fast response, low cost, strong flexibility, widely application, and so on. The system has certain practical value and popularization value.

  12. La educación en casa o homeschooling: la STC de 2 de diciembre de 2010

    Directory of Open Access Journals (Sweden)

    María Monzón Julve

    2011-09-01

    Full Text Available El artículo analiza los conflictos que surgen entre el derecho a la educación de los menores y la libertad de enseñanza reconocida a los padres o tutores, todo ello según el complejo art. 27 CE, concretamente, y con ocasión de la reciente STC de 2 de diciembre de 2010, en relación a la posibilidad de impartir la enseñanza básica no a través de la escolarización obligatoria sino mediante la educación en el propio hogar familiar (homeschooling.This article analyses raising conflicts between children´ education´s right and freedom of education belonging to parents and tutors, according to the complex article 27 of Spanish Constitution, especially after the recent sentence of Constitucional Court dated from 2nd December 2010, all of this in relation with the possiblility of giving basic education not through compulsory education but homeschooling.

  13. Detailed characterisation of STC-1 cells and the pGIP/Neo sub-clone suggests the incretin hormones are translationally regulated.

    Science.gov (United States)

    Gillespie, Anna L; Pan, Xiaobei; Marco-Ramell, Anna; Meharg, Caroline; Green, Brian D

    2017-10-01

    STC-1 is a heterogeneous plurihormonal cell line producing several prominent gut peptide hormones. pGIP/Neo is a genetically selected sub-clone of STC-1 with augmented levels of glucose-dependent insulinotropic peptide (GIP). Morphometric parameters, hormone concentrations, mRNA transcripts, hormone immunocytochemistry and nutrient utilisation/production of these two cell lines were compared. Proglucagon-derived peptides (Glucagon-like peptide-1 (GLP-1) and - 2(GLP-2)) were lower in sub-clone cells than progenitor cells. High Content Analysis found altered intracellular GLP-1, GIP, cholecystokinin (CCK) and peptide YY (PYY) levels and differing hormone co-localisation. The proportion pGIP/Neo cells containing GIP immunoreactivity (82%) was greater than STC-1 (65%), as were the proportion with 'GIP only', 'GLP-1+GIP' or 'GIP+PYY' immunoreactivity. Most surprisingly mRNA transcripts of the proglucagon and GIP genes were inversely correlated to the levels of their translated peptides. This strongly suggests that proglucagon and GIP are encoded on 'translationally regulated genes' - a characteristic possessed by other endocrine hormones. Metabolomic profiling revealed differences in cellular nutrient utilisation/production and that under normal culture conditions both cell lines exhibit signs of overflow metabolism. These studies provide an insight into the metabolism and properties of these valuable cells, suggesting for the first time that incretin hormone genes are translationally regulated. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Clinical Prediction Models for Cardiovascular Disease: The Tufts PACE CPM Database

    Science.gov (United States)

    Wessler, Benjamin S.; Lana Lai, YH; Kramer, Whitney; Cangelosi, Michael; Raman, Gowri; Lutz, Jennifer S.; Kent, David M.

    2015-01-01

    Background Clinical prediction models (CPMs) estimate the probability of clinical outcomes and hold the potential to improve decision making and individualize care. For patients with cardiovascular disease (CVD) there are numerous CPMs available though the extent of this literature is not well described. Methods and Results We conducted a systematic review for articles containing CPMs for CVD published between January 1990 through May 2012. CVD includes coronary heart disease (CHD), heart failure (HF), arrhythmias, stroke, venous thromboembolism (VTE) and peripheral vascular disease (PVD). We created a novel database and characterized CPMs based on the stage of development, population under study, performance, covariates, and predicted outcomes. There are 796 models included in this database. The number of CPMs published each year is increasing steadily over time. 717 (90%) are de novo CPMs, 21 (3%) are CPM recalibrations, and 58 (7%) are CPM adaptations. This database contains CPMs for 31 index conditions including 215 CPMs for patients with CAD, 168 CPMs for population samples, and 79 models for patients with HF. There are 77 distinct index/ outcome (I/O) pairings. Of the de novo models in this database 450 (63%) report a c-statistic and 259 (36%) report some information on calibration. Conclusions There is an abundance of CPMs available for a wide assortment of CVD conditions, with substantial redundancy in the literature. The comparative performance of these models, the consistency of effects and risk estimates across models and the actual and potential clinical impact of this body of literature is poorly understood. PMID:26152680

  15. Photoluminescent BaMoO4 nanopowders prepared by complex polymerization method (CPM)

    International Nuclear Information System (INIS)

    Azevedo Marques, Ana Paula de; Melo, Dulce M.A. de; Paskocimas, Carlos A.; Pizani, Paulo S.; Joya, Miryam R.; Leite, Edson R.; Longo, Elson

    2006-01-01

    The BaMoO 4 nanopowders were prepared by the Complex Polymerization Method (CPM). The structure properties of the BaMoO 4 powders were characterized by FTIR transmittance spectra, X-ray diffraction (XRD), Raman spectra, photoluminescence spectra (PL) and high-resolution scanning electron microscopy (HR-SEM). The XRD, FTIR and Raman data showed that BaMoO 4 at 300 deg. C was disordered. At 400 deg. C and higher temperature, BaMoO 4 crystalline scheelite-type phases could be identified, without the presence of additional phases, according to the XRD, FTIR and Raman data. The calculated average crystallite sizes, calculated by XRD, around 40 nm, showed the tendency to increase with the temperature. The crystallite sizes, obtained by HR-SEM, were around of 40-50 nm. The sample that presented the highest intensity of the red emission band was the one heat treated at 400 deg. C for 2 h, and the sample that displayed the highest intensity of the green emission band was the one heat treated at 700 deg. C for 2 h. The CPM was shown to be a low cost route for the production of BaMoO 4 nanopowders, with the advantages of lower temperature, smaller time and reduced cost. The optical properties observed for BaMoO 4 nanopowders suggested that this material is a highly promising candidate for photoluminescent applications

  16. The 4-parameter Compressible Packing Model (CPM) including a critical cavity size ratio

    Science.gov (United States)

    Roquier, Gerard

    2017-06-01

    The 4-parameter Compressible Packing Model (CPM) has been developed to predict the packing density of mixtures constituted by bidisperse spherical particles. The four parameters are: the wall effect and the loosening effect coefficients, the compaction index and a critical cavity size ratio. The two geometrical interactions have been studied theoretically on the basis of a spherical cell centered on a secondary class bead. For the loosening effect, a critical cavity size ratio, below which a fine particle can be inserted into a small cavity created by touching coarser particles, is introduced. This is the only parameter which requires adaptation to extend the model to other types of particles. The 4-parameter CPM demonstrates its efficiency on frictionless glass beads (300 values), spherical particles numerically simulated (20 values), round natural particles (125 values) and crushed particles (335 values) with correlation coefficients equal to respectively 99.0%, 98.7%, 97.8%, 96.4% and mean deviations equal to respectively 0.007, 0.006, 0.007, 0.010.

  17. Improving Overall Equipment Effectiveness Using CPM and MOST: A Case Study of an Indonesian Pharmaceutical Company

    Science.gov (United States)

    Omega, Dousmaris; Andika, Aditya

    2017-12-01

    This paper discusses the results of a research conducted on the production process of an Indonesian pharmaceutical company. The company is experiencing low performance in the Overall Equipment Effectiveness (OEE) metric. The OEE of the company machines are below world class standard. The machine that has the lowest OEE is the filler machine. Through observation and analysis, it is found that the cleaning process of the filler machine consumes significant amount of time. The long duration of the cleaning process happens because there is no structured division of jobs between cleaning operators, differences in operators’ ability, and operators’ inability in utilizing available cleaning equipment. The company needs to improve the cleaning process. Therefore, Critical Path Method (CPM) analysis is conducted to find out what activities are critical in order to shorten and simplify the cleaning process in the division of tasks. Afterwards, The Maynard Operation and Sequence Technique (MOST) method is used to reduce ineffective movement and specify the cleaning process standard time. From CPM and MOST, it is obtained the shortest time of the cleaning process is 1 hour 28 minutes and the standard time is 1 hour 38.826 minutes.

  18. Effects of structural modifications of N-CPM-normorphine derivatives on agonist and antagonist activities in isolated organs.

    Science.gov (United States)

    Riba, P; Tóth, Z; Hosztafi, S; Friedmann, T; Fürst, S

    2003-01-01

    The agonistic and antagonistic properties of N-cyclopropylmethyl (N-CPM) morphine derivatives were observed in mouse vas deferens (MVD), longitudinal muscle of guinea pig ileum (GPI) and rabbit vas deferens (LVD). In MVD the K(e) values of the titled compounds (N-CPM-morphine, N-CPM-isomorphine, N-CPM-dihydromorphine, N-CPM-dihydroisomorpPhine, N-CPM-dihydromorphone and naltrexone) were measured for mu-, kappa- and delta-receptors using normorphine, ethylketocyclazocine (EKC) and D-Pen2-D-Pen5-enkephaline (DPDPE) as selective agonists on the receptors, respectively. For mu-receptors of MVD the tested compounds showed similar affinity. For kappa-receptors the non-iso-6-OH derivatives possessed much less affinity than the iso-derivatives. Similar difference could be observed for delta-receptors. The agonistic activities of these compounds in MVD were observed to be between 0-20% of the inhibition of muscle contractions. In GPI the compounds except naltrexone possessed strong agonistic activities effectively antagonized by nor-binaltorphimine (nor-BNI) (K(e) of nor-BNI was 0.23 nM) suggesting that they were strong kappa-receptor agonists. We investigated these agents in LVD too, which contains kappa-receptors, but they did not produce any agonist potencies. It raises the possibility that the kappa-receptor subtypes of LVD and MVD are different from the kappa-receptor subtype of GPI or the vasa deferentia contain much fewer kappa-receptors than GPI and the intrinsic activities of these compounds are too small to reach the 50% inhibition of the contractions.

  19. Fast Missile Boat Project Planning using CPM and What If Analysis Method

    Science.gov (United States)

    Silvianita; Firmansyah, R.; Rosyid, D. M.; Suntoyo; Chamelia, D. M.

    2018-03-01

    This paper discusses analysis of fast ship missile project planning with CPM and What If analysis.The poor performance can cause project delay and cost overruns, these two things often occur in a project management. Scheduling has an important role to control the project. Good scheduling is required because it will affect the product quality. Scheduling is useful to manage the activities so that the project completion time can be as short as possible and it is used to determine the costs of the project are in optimum condition. The alternatives that can be used to overcome the delay project namely increasing labor and equipment.Project planning can be done to determine whether the project is already in an optimum condition. Alternatives that can be used to overcome the delay in the project is to increase labor and equipment, the next is to look for the optimum solution taking into account the duration and gain of each alternative.

  20. Sealing ability of grar MTA AngelusTM, CPM TM and MBPc used as apical plugs.

    Science.gov (United States)

    Orosco, Fernando Accorsi; Bramante, Clovis Monteiro; Garcia, Roberto Brandão; Bernadineli, Norberti; Moraes, Ivaldo Gomes de

    2008-01-01

    This study evaluated the sealing ability of apical plugs fabricated with gray MTA Angelus sealer, CPM TM sealer and MBPc sealer. The root canals of 98 extracted single-rooted human teeth were instrumented with #5 to #1 Gates Glidden drills according to the crown-down technique until the #1 drill could pass through the apical foramen. The specimens were then prepared with K-files, starting with an ISO 50 until an ISO 90 could be visualized 1 mm beyond the apex. After root canal preparation, the external surface of each root was rendered impermeable and roots were assigned to 3 experimental groups (n = 30), which received a 5-mm thick apical plug of gray MTA Angelus, CPM and MBPc, and two control groups (n=4). The remaining portion of the canal in the experimental groups was filled by the lateral condensation technique. The teeth of each group, properly identified, were fixed on utility wax by their crowns and were placed in plastic flasks, leaving the apex free and facing upward. The flasks were filled with 0.2% Rhodamine B solution, pH 7.0, so as to completely cover the root apex of all teeth. The sealing ability was analyzed by measuring 0.2% Rhodamine B leakage after all groups had been maintained in this solution for 48 hours. Data were analyzed statistically by Kruskal-Wallis test and Dunn test with a=5%. The results showed that, among the tested materials used for fabrication of apical plugs, MBPc sealer had the least amount of leakage with statistically significant difference (p<0.05).

  1. Sealing ability of grar MTA AngelusTM, CPM TM and MBPc used as apical plugs

    Directory of Open Access Journals (Sweden)

    Fernando Accorsi Orosco

    2008-02-01

    Full Text Available This study evaluated the sealing ability of apical plugs fabricated with gray MTA AngelusTM sealer, CPM TM sealer and MBPc sealer. The root canals of 98 extracted single-rooted human teeth were instrumented with #5 to #1 Gates Glidden drills according to the crown-down technique until the #1 drill could pass through the apical foramen. The specimens were then prepared with K-files, starting with an ISO 50 until an ISO 90 could be visualized 1 mm beyond the apex. After root canal preparation, the external surface of each root was rendered impermeable and roots were assigned to 3 experimental groups (n = 30, which received a 5-mm thick apical plug of gray MTA AngelusTM, CPM TM and MBPc, and two control groups (n=4. The remaining portion of the canal in the experimental groups was filled by the lateral condensation technique. The teeth of each group, properly identified, were fixed on utility wax by their crowns and were placed in plastic flasks, leaving the apex free and facing upward. The flasks were filled with 0.2% Rhodamine B solution, pH 7.0, so as to completely cover the root apex of all teeth. The sealing ability was analyzed by measuring 0.2% Rhodamine B leakage after all groups had been maintained in this solution for 48 hours. Data were analyzed statistically by Kruskal-Wallis test and Dunn test with a=5%. The results showed that, among the tested materials used for fabrication of apical plugs, MBPc sealer had the least amount of leakage with statistically significant difference (p<0.05.

  2. Overcoming STC2 mediated drug resistance through drug and gene co-delivery by PHB-PDMAEMA cationic polyester in liver cancer cells.

    Science.gov (United States)

    Cheng, Hongwei; Wu, Zhixian; Wu, Caisheng; Wang, Xiaoyuan; Liow, Sing Shy; Li, Zibiao; Wu, Yun-Long

    2018-02-01

    Stanniocalcin 2 (STC2) overexpression in hepatocellular carcinoma (HCC) could lead to poor prognosis, which might be due to its induced P-glycoprotein and Bcl-2 protein expression level increase. P-glycoprotein or membrane pump induced drug efflux and altered prosurvival Bcl-2 expression are key mechanisms for drug resistance leading to failure of chemotherapy in HCC. However, current strategy to overcome both P-glycoprotein and Bcl-2 protein induced drug resistance was rarely reported. In this work, we utilized an amphiphilic poly[(R)-3-hydroxybutyrate] (PHB)-b-poly(2-(dimethylamino)ethyl methacrylate) (PDMAEMA) cationic polyester to encapsulate chemotherapeutic paclitaxel (PTX) in hydrophobic PHB domain and Bcl-2 convertor Nur77/ΔDBD gene (Nur77 without DNA binding domain for mitochondria localization) by formation of polyplex due to cationic PDMAEMA segment, to effectively inhibit the drug resistant HepG2/STC2 and SMCC7721/STC2 liver cancer cell growth. Thanks to the cationic nanoparticle complex formation ability and high transfection efficiency to express Bcl-2 conversion proteins, PHB-PDMAEMA/PTX@polyplex could partially impair P-glycoprotein induced PTX efflux and activate the apoptotic function of previous prosurvival Bcl-2 protein. This is the pioneer report of cationic amphiphilic polyester PHB-PDMAEMA to codeliver anticancer drug and therapeutic plasmid to overcome both pump and non-pump mediated chemotherapeutic resistance in liver cancer cells, which might be inspiring for the application of polyester in personalized cancer therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Comparison of OQPSK and CPM for Communications at 60 GHz with a Nonideal Front End

    Directory of Open Access Journals (Sweden)

    Jimmy Nsenga

    2007-03-01

    Full Text Available Short-range digital communications at 60 GHz have recently received a lot of interest because of the huge bandwidth available at those frequencies. The capacity offered to the users could finally reach 2 Gbps, enabling the deployment of new multimedia applications. However, the design of analog components is critical, leading to a possible high nonideality of the front end (FE. The goal of this paper is to compare the suitability of two different air interfaces characterized by a low peak-to-average power ratio (PAPR to support communications at 60 GHz. On one hand, we study the offset-QPSK (OQPSK modulation combined with a channel frequency-domain equalization (FDE. On the other hand, we study the class of continuous phase modulations (CPM combined with a channel time-domain equalizer (TDE. We evaluate their performance in terms of bit error rate (BER considering a typical indoor propagation environment at 60 GHz. For both air interfaces, we analyze the degradation caused by the phase noise (PN coming from the local oscillators; and by the clipping and quantization errors caused by the analog-to-digital converter (ADC; and finally by the nonlinearity in the PA.

  4. Comparison of OQPSK and CPM for Communications at 60 GHz with a Nonideal Front End

    Directory of Open Access Journals (Sweden)

    Nsenga Jimmy

    2007-01-01

    Full Text Available Short-range digital communications at 60 GHz have recently received a lot of interest because of the huge bandwidth available at those frequencies. The capacity offered to the users could finally reach 2 Gbps, enabling the deployment of new multimedia applications. However, the design of analog components is critical, leading to a possible high nonideality of the front end (FE. The goal of this paper is to compare the suitability of two different air interfaces characterized by a low peak-to-average power ratio (PAPR to support communications at 60 GHz. On one hand, we study the offset-QPSK (OQPSK modulation combined with a channel frequency-domain equalization (FDE. On the other hand, we study the class of continuous phase modulations (CPM combined with a channel time-domain equalizer (TDE. We evaluate their performance in terms of bit error rate (BER considering a typical indoor propagation environment at 60 GHz. For both air interfaces, we analyze the degradation caused by the phase noise (PN coming from the local oscillators; and by the clipping and quantization errors caused by the analog-to-digital converter (ADC; and finally by the nonlinearity in the PA.

  5. CPM Is a Useful Cell Surface Marker to Isolate Expandable Bi-Potential Liver Progenitor Cells Derived from Human iPS Cells.

    Science.gov (United States)

    Kido, Taketomo; Koui, Yuta; Suzuki, Kaori; Kobayashi, Ayaka; Miura, Yasushi; Chern, Edward Y; Tanaka, Minoru; Miyajima, Atsushi

    2015-10-13

    To develop a culture system for large-scale production of mature hepatocytes, liver progenitor cells (LPCs) with a high proliferation potential would be advantageous. We have found that carboxypeptidase M (CPM) is highly expressed in embryonic LPCs, hepatoblasts, while its expression is decreased along with hepatic maturation. Consistently, CPM expression was transiently induced during hepatic specification from human-induced pluripotent stem cells (hiPSCs). CPM(+) cells isolated from differentiated hiPSCs at the immature hepatocyte stage proliferated extensively in vitro and expressed a set of genes that were typical of hepatoblasts. Moreover, the CPM(+) cells exhibited a mature hepatocyte phenotype after induction of hepatic maturation and also underwent cholangiocytic differentiation in a three-dimensional culture system. These results indicated that hiPSC-derived CPM(+) cells share the characteristics of LPCs, with the potential to proliferate and differentiate bi-directionally. Thus, CPM is a useful marker for isolating hiPSC-derived LPCs, which allows development of a large-scale culture system for producing hepatocytes and cholangiocytes. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  6. HYC-24L Demonstrates Greater Effectiveness With Less Pain Than CPM-22.5 for Treatment of Perioral Lines in a Randomized Controlled Trial.

    Science.gov (United States)

    Butterwick, Kimberly; Marmur, Ellen; Narurkar, Vic; Cox, Sue Ellen; Joseph, John H; Sadick, Neil S; Tedaldi, Ruth; Wheeler, Sarah; Kolodziejczyk, Julia K; Gallagher, Conor J

    2015-12-01

    This trial compares the effectiveness and safety of HYC-24L (Juvéderm Ultra XC; Allergan plc, Dublin, Ireland) (24 mg/mL of hyaluronic acid, 0.3% lidocaine) and CPM-22.5 (Belotero Balance; Merz Aesthetics, Raleigh, NC) (22.5 mg/mL of hyaluronic acid) for the treatment of perioral lines. Men and women aged 35 years or older with moderate-to-severe perioral lines were recruited for this randomized controlled, rater-blinded, 2-arm trial. The primary endpoint was a comparison of rater-assessed responder rates by the validated 4-point Perioral Lines Severity Scale at Month 6; responders were those who showed a ≥1 point improvement. A secondary endpoint was subject-assessed change in perioral lines measured by the Global Assessment of Change Scale. A total of 136 subjects received treatment and 132 completed the trial (mean age: 58 ± 8 years). Total volume injected was 1.18 mL (HYC-24L) and 1.32 mL (CPM-22.5). At Month 6, a significantly greater proportion of HYC-24L subjects responded to treatment (87%) than CPM-22.5 subjects (72%) (p CPM-22.5 subjects, with the greatest difference at Month 6. No unexpected adverse events occurred. HYC-24L subjects showed a higher response rate and a greater improvement in their perioral lines than CPM-22.5 subjects for up to 6 months.

  7. ASSOCIATION OF COSTUMER VALUE CHAIN ANALYSIS TO QUALITY FUNCTION DEPLOYMENT: DIFFERENT IDENTIFIED COSTUMERS AND REQUIREMENTS ON DEVELOPMENT OF CPM DEVICE

    Directory of Open Access Journals (Sweden)

    Raffaela Leane Zenni Tanure

    2013-06-01

    Full Text Available This study aims to present the differences between the use of QFD and its association with CVCA tool in the development of a CPM device for elbow and forearm rehabilitation. To achieve this goal, the study was divided into three steps. The development of a conceptual model that integrates the proposed CVCA + QFD tool for application in the health device development was done in the first step. The second step consisted of applying the proposed model, referring to the QFD method using 8 matrixes: quality matrix, product, characteristics of the parts, process, process parameters, human resources, infrastructure and costs matrix. The proposed conceptual model was employed fully in the third step, allowing the comparison between the methods. The results enabled to identify a discrepancy between the critical costumers in the use of mentioned methods. Customers were limited to the direct and indirect users in the QFD application: the patient, physician and physical therapist. This list got a considerable increase when CVCA was applied: the clinical engineering, product engineering, process and reliability engineering, project and product managers, financial sector, quality system and regulatory issues. These results show the importance of analyzing the supply chain systemically in order to consider all stakeholders to the CPM device development. Thus, needs and relationships delineation of all process customers can be done.

  8. De hand van Romme. C.P.M. Romme als staatkundig hoofdredacteur van De Volkskrant (1945-1952

    Directory of Open Access Journals (Sweden)

    M. Broersma

    2000-01-01

    Full Text Available Romme's hand: The politician C.P.M. Romme as editor-in-chief of the 'De Volkskrant' (1945-1952Between 1945 and 1953, C.P.M. Romme held two posts simultaneously; he was both the political leader of the Katholieke Volkspartij (KVP and editor-in-chief of the newspaper 'De Volkskrant'. Many assumptions have been made about this joint position, mostly by theorists and researchers into the subject of 'pillarization'. However, Romme's actual influence on the content of the 'Volkskrant' has not yet been properly researched. This article explores the role that Romme the politician played during his editorship of the 'Volkskrant'. It aims to show how Romme used the newspaper to attain his political goals; especially with regard to maintaining Catholic political unity and social solidarity. He wrote leading articles to influence public opinion, acted in a censorial capacity and invited journalists and political supporters to contribute articles that supported his own views. In 1952, the owner of the newspaper, the 'Katholieke Arbeidersbeweging' (The Trade Union for Catholics, forced Romme to resign. Ironically, it was a conflict about maintaining Catholic political unity - Romme's main political goal – that ultimately led to his resignation.

  9. [Cross-cultural adaptation to the European Portuguese of the questionnaire "Patient Knowledge about their Medications" (CPM-ES-ES)].

    Science.gov (United States)

    Salmerón Rubio, Joaquín; Iglésias-Ferreira, Paula; García Delgado, Pilar; Mateus-Santos, Henrique; Martínez-Martínez, Fernando

    2013-12-01

    The scope of this work is to conduct the cross-cultural adaptation from Spanish to European Portuguese of a questionnaire to measure the degree of "Patient Knowledge about their Medications" (CPM-ES-ES). A method based on six steps was applied: 1. Translation into Portuguese, 2. Elaboration of the first consensus version in Portuguese; 3.Back-translation into Spanish; 4. Elaboration of the second consensus version (cultural equivalency); 5. Conducting the pre-test; 6. Evaluation of the overall results. A cross-culturally adapted questionnaire in European Portuguese that measures the degree of "Patient Knowledge about their Medications" is proposed. The pre-test confirmation obtained 100% agreement with the corrected version of the second consensus version after pre-testing. The methodology selected made it possible to cross-culturally adapt the Spanish version of the CPM-ES-ES questionnaire to the Portuguese version. Further studies should demonstrate the equivalence of the psychometric properties of the cross-cultural translation into Portuguese with the original version.

  10. Scheduling of House Development Projects with CPM and PERT Method for Time Efficiency (Case Study: House Type 36)

    Science.gov (United States)

    Kholil, Muhammad; Nurul Alfa, Bonitasari; Hariadi, Madjumsyah

    2018-04-01

    Network planning is one of the management techniques used to plan and control the implementation of a project, which shows the relationship between activities. The objective of this research is to arrange network planning on house construction project on CV. XYZ and to know the role of network planning in increasing the efficiency of time so that can be obtained the optimal project completion period. This research uses descriptive method, where the data collected by direct observation to the company, interview, and literature study. The result of this research is optimal time planning in project work. Based on the results of the research, it can be concluded that the use of the both methods in scheduling of house construction project gives very significant effect on the completion time of the project. The company’s CPM (Critical Path Method) method can complete the project with 131 days, PERT (Program Evaluation Review and Technique) Method takes 136 days. Based on PERT calculation obtained Z = -0.66 or 0,2546 (from normal distribution table), and also obtained the value of probability or probability is 74,54%. This means that the possibility of house construction project activities can be completed on time is high enough. While without using both methods the project completion time takes 173 days. So using the CPM method, the company can save time up to 42 days and has time efficiency by using network planning.

  11. Design of music player based on MCU STC12C5A60S2%一种基于51单片机的音乐播放器的设计

    Institute of Scientific and Technical Information of China (English)

    何谐; 唐大权; 张淑廷; 陈雪

    2014-01-01

    The hardware design method of the music player based on MCU STC12C5A60S2 is introduced in this paper. The program design of the music player based on principle of FAT32 file system is studied. In the music player, MCU STC12C5A60S2 is taken as a main controller,SD card as a memory medium of music files and VS1003 chip as a decoder unit. When the player is running,MCU STC12C5A60S2 reads the music file from the SD card and continuously transfers data flow to VS1003 for decoding. In the meantime,the OLED liquid crystal display shows the message of the music in real time. The tested results from experiments show the music player can play the music files in multiple formats fluently if the player is connected with ear phone.%主要介绍一种基于51单片机的音乐播放器的硬件设计方法,并研究在FAT32文件系统下音乐播放器的程序设计。该音乐播放器采用STC12C5A60S2单片机为主控制器,SD卡作为音乐文件的存储介质,VS1003芯片作为解码器。STC12C5A60S2单片机从 SD卡中读取音乐文件,并不断将数据流传送至VS1003解码,最后连接耳机播放,同时STC12C5A60S2连接OLED液晶显示屏实时显示音乐播放信息。实验表明,该音乐播放器连接耳机能流畅播放多种格式的音乐文件。

  12. Physiological and Proteomic Analysis of the Rice Mutant cpm2 Suggests a Negative Regulatory Role of Jasmonic Acid in Drought Tolerance

    Directory of Open Access Journals (Sweden)

    Rohit Dhakarey

    2017-11-01

    Full Text Available It is widely known that numerous adaptive responses of drought-stressed plants are stimulated by chemical messengers known as phytohormones. Jasmonic acid (JA is one such phytohormone. But there are very few reports revealing its direct implication in drought related responses or its cross-talk with other phytohormones. In this study, we compared the morpho-physiological traits and the root proteome of a wild type (WT rice plant with its JA biosynthesis mutant coleoptile photomorphogenesis 2 (cpm2, disrupted in the allene oxide cyclase (AOC gene, for insights into the role of JA under drought. The mutant had higher stomatal conductance, higher water use efficiency and higher shoot ABA levels under severe drought as compared to the WT. Notably, roots of cpm2 were better developed compared to the WT under both, control and drought stress conditions. Root proteome was analyzed using the Tandem Mass Tag strategy to better understand this difference at the molecular level. Expectedly, AOC was unique but notably highly abundant under drought in the WT. Identification of other differentially abundant proteins (DAPs suggested increased energy metabolism (i.e., increased mobilization of resources and reactive oxygen species scavenging in cpm2 under drought. Additionally, various proteins involved in secondary metabolism, cell growth and cell wall synthesis were also more abundant in cpm2 roots. Proteome-guided transcript, metabolite, and histological analyses provided further insights into the favorable adaptations and responses, most likely orchestrated by the lack of JA, in the cpm2 roots. Our results in cpm2 are discussed in the light of JA crosstalk to other phytohormones. These results together pave the path for understanding the precise role of JA during drought stress in rice.

  13. ADMINISTRACIÓN DEL PROYECTO “DESARROLLO DE CAPACIDADES HUMANAS”, MEDIANTE LAS TÉCNICAS ADMINISTRATIVAS CPM Y PERT, URACCAN – SIUNA, 2012

    OpenAIRE

    Yader Antonio Ordoñez Aguilar; Eddy Alberto Zamora Díaz; Javier Osmar Artola García

    2014-01-01

    Esta investigación ha aplicado el Método de la Ruta Crítica (CPM) y las Técnicas de Evaluación y Revisión de Programas (PERT) en la administración del proyecto: “Desarrollo de capacidades técnicas y humanas para la implementación del plan de desarrollo regional con identidad en el sector de Las Minas”, ejecutado en Siuna, 2012, por la URACCAN. Es un estudio aplicativo retrospectivo con un enfoque cuantitativo enmarcado en las técnicas administrativas de proyecto CPM y PERT mediante el program...

  14. Integrated Cost and Schedule using Monte Carlo Simulation of a CPM Model - 12419

    Energy Technology Data Exchange (ETDEWEB)

    Hulett, David T. [Hulett and Associates, LLC (United States); Nosbisch, Michael R. [Project Time and Cost, Inc. (United States)

    2012-07-01

    This discussion of the recommended practice (RP) 57R-09 of AACE International defines the integrated analysis of schedule and cost risk to estimate the appropriate level of cost and schedule contingency reserve on projects. The main contribution of this RP is to include the impact of schedule risk on cost risk and hence on the need for cost contingency reserves. Additional benefits include the prioritizing of the risks to cost, some of which are risks to schedule, so that risk mitigation may be conducted in a cost-effective way, scatter diagrams of time-cost pairs for developing joint targets of time and cost, and probabilistic cash flow which shows cash flow at different levels of certainty. Integrating cost and schedule risk into one analysis based on the project schedule loaded with costed resources from the cost estimate provides both: (1) more accurate cost estimates than if the schedule risk were ignored or incorporated only partially, and (2) illustrates the importance of schedule risk to cost risk when the durations of activities using labor-type (time-dependent) resources are risky. Many activities such as detailed engineering, construction or software development are mainly conducted by people who need to be paid even if their work takes longer than scheduled. Level-of-effort resources, such as the project management team, are extreme examples of time-dependent resources, since if the project duration exceeds its planned duration the cost of these resources will increase over their budgeted amount. The integrated cost-schedule risk analysis is based on: - A high quality CPM schedule with logic tight enough so that it will provide the correct dates and critical paths during simulation automatically without manual intervention. - A contingency-free estimate of project costs that is loaded on the activities of the schedule. - Resolves inconsistencies between cost estimate and schedule that often creep into those documents as project execution proceeds

  15. Cefpiramide(CPM)の前立腺組織内移行に関する検討

    OpenAIRE

    高田, 耕; 川村, 繁美; 吉田, 郁彦

    1988-01-01

    12例の前立腺肥大症患者を対象とし,CPM 1.0 gの静脈内投与を行い,血清内濃度および恥骨後式前立腺摘除術にて採取した前立腺組織内への移行を検討した.CPMの組織内濃度は,グラム陰性菌のみならずグラム陽性菌に対しても,その抗菌作用が期待できる値を示した

  16. USO DEL MÓDULO DE PREDICCIÓN DE ACCIDENTES (CPM DEL IHSDM PARA EVALUACIÓN DE SEGURIDAD EN SEGMENTOS DE CARRETERAS DE DOS CARRILES

    Directory of Open Access Journals (Sweden)

    Yasmín Andrea Pérez-Rojas

    2013-07-01

    Full Text Available The document presents an alternative for the safety evaluation in the segments of highways in Colombia, given the absence of this type of practical in the engineering of Colombian highways. Therefore, it is approached CPM (Crash Prediction Module of the program IHSDM (Interactive Highway Safety Design Model of FHWA (Federal Highway Administration, adopted thoroughly in other countries to assess safety in highways. This way, the description of the main characteristics of the module CPM is presented for the prediction of accidents in segments of highways without considering those happened or related to the intersections. This way, the description of the main characteristics of the module CPM is presented for the prediction of accidents in segments of highways without considering those happened or related to the intersections. Finally, the results obtained by analyzing the CPM module, the algorithms of the prediction pattern, and the methodological proposal will permit obtain an enough database for the use and application of the module in Colombia.

  17. [CPM--Continuous Passive Motion: treatment of injured or operated knee-joints using passive movement. A meta-analysis of current literature].

    Science.gov (United States)

    Kirschner, P

    2004-04-01

    There is still a controversial discussion in literature about the use of motor driven splints in knee surgery--as the principle of continuous passive motion, CPM. For this reason it seemed useful for an evaluation to look through the papers which were published since 1990. It was obvious, that negative results were published often before this year, but this papers are still quoted standard works. In medical data bases subito-doc.de, medscape.com, medica.de and zbmed.de 230 papers were found by search CPM, continuous passive motion and arthromot. Coincidentally there was a search for authors who were already quoted in other papers. 36 papers concerning CPM after knee surgery were utilized. The role of CPM regarding the range of motion, swelling, duration of hospital stay, use of analgesics, costs, postoperative manipulations, wound healing and thrombo embolic complications was evaluated. Although the results of this partial retrospective, partial prospective, sometimes randomized or double blinded studies are in contradiction, there can only be found a trend to better results. New clinical studies for evidence based guidelines in the handling of continuous passive motion after knee surgery are necessary.

  18. Effectiveness of prolonged use of continuous passive motion (CPM as an adjunct to physiotherapy following total knee arthroplasty: Design of a randomised controlled trial [ISRCTN85759656

    Directory of Open Access Journals (Sweden)

    Geesink Ruud JT

    2006-02-01

    Full Text Available Abstract Background Adequate and intensive rehabilitation is an important requirement for successful Total Knee Arthroplasty. The primary focus of early rehabilitation is ambulation of patients and regaining range of motion in the knee. Although research suggests that Continuous Passive Motion should be implemented in the first rehabilitation phase following surgery, there is substantial debate about the duration of each session and the total period of CPM application and. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. Methods In a randomised controlled trial we intend to investigate the efficacy of prolonged use of a continuous passive motion (CPM device in the home situation as an adjunct to standardised physical therapy. The experimental treatment is compared to standardised physical therapy, in patients with osteoarthritis of the knee undergoing Total Knee Arthroplasty (TKA. Efficacy will be assessed in terms of faster improvements in range of motion and functional recovery. Seventy patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment (less than 80° of knee flexion at the time of discharge will be randomised over two treatment groups, a usual care group and an experimental group The experimental group will receive CPM + physiotherapy for 17 consecutive days after surgery, whereas the usual care group will receive the same treatment during the in-hospital phase (i.e. about four days, followed by physical therapy alone (usual care in the first two weeks after hospital discharge. From 18 days to three months after discharge, both groups will receive standardised PT. The primary focus of rehabilitation will be functional recovery (e.g. ambulation and regaining range of motion (ROM in the knee

  19. Effectiveness of prolonged use of continuous passive motion (CPM) as an adjunct to physiotherapy following total knee arthroplasty: Design of a randomised controlled trial [ISRCTN85759656

    Science.gov (United States)

    Lenssen, Anton F; Crijns, Yvonne HF; Waltjé, Eddie MH; Roox, George M; van Steyn, Mike JA; Geesink, Ruud JT; van den Brandt, Piet A; de Bie, Rob A

    2006-01-01

    Background Adequate and intensive rehabilitation is an important requirement for successful Total Knee Arthroplasty. The primary focus of early rehabilitation is ambulation of patients and regaining range of motion in the knee. Although research suggests that Continuous Passive Motion should be implemented in the first rehabilitation phase following surgery, there is substantial debate about the duration of each session and the total period of CPM application and. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. Methods In a randomised controlled trial we intend to investigate the efficacy of prolonged use of a continuous passive motion (CPM) device in the home situation as an adjunct to standardised physical therapy. The experimental treatment is compared to standardised physical therapy, in patients with osteoarthritis of the knee undergoing Total Knee Arthroplasty (TKA). Efficacy will be assessed in terms of faster improvements in range of motion and functional recovery. Seventy patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment (less than 80° of knee flexion at the time of discharge) will be randomised over two treatment groups, a usual care group and an experimental group The experimental group will receive CPM + physiotherapy for 17 consecutive days after surgery, whereas the usual care group will receive the same treatment during the in-hospital phase (i.e. about four days), followed by physical therapy alone (usual care) in the first two weeks after hospital discharge. From 18 days to three months after discharge, both groups will receive standardised PT. The primary focus of rehabilitation will be functional recovery (e.g. ambulation) and regaining range of motion (ROM) in the knee. Discussion Because

  20. Effectiveness of prolonged use of continuous passive motion (CPM) as an adjunct to physiotherapy following total knee arthroplasty: design of a randomised controlled trial [ISRCTN85759656].

    Science.gov (United States)

    Lenssen, Anton F; Crijns, Yvonne H F; Waltjé, Eddie M H; Roox, George M; van Steyn, Mike J A; Geesink, Ruud J T; van den Brandt, Piet A; de Bie, Rob A

    2006-02-23

    Adequate and intensive rehabilitation is an important requirement for successful Total Knee Arthroplasty. The primary focus of early rehabilitation is ambulation of patients and regaining range of motion in the knee. Although research suggests that Continuous Passive Motion should be implemented in the first rehabilitation phase following surgery, there is substantial debate about the duration of each session and the total period of CPM application and. A Cochrane review on this topic concluded that short-term use of CPM leads to greater short-term range of motion. It also suggested, however, that future research should concentrate on the treatment period during which CPM should be administered. In a randomised controlled trial we intend to investigate the efficacy of prolonged use of a continuous passive motion (CPM) device in the home situation as an adjunct to standardised physical therapy. The experimental treatment is compared to standardised physical therapy, in patients with osteoarthritis of the knee undergoing Total Knee Arthroplasty (TKA). Efficacy will be assessed in terms of faster improvements in range of motion and functional recovery. Seventy patients with knee osteoarthritis undergoing TKA and experiencing early postoperative flexion impairment (less than 80 degrees of knee flexion at the time of discharge) will be randomised over two treatment groups, a usual care group and an experimental group. The experimental group will receive CPM + physiotherapy for 17 consecutive days after surgery, whereas the usual care group will receive the same treatment during the in-hospital phase (i.e. about four days), followed by physical therapy alone (usual care) in the first two weeks after hospital discharge. From 18 days to three months after discharge, both groups will receive standardised PT. The primary focus of rehabilitation will be functional recovery (e.g. ambulation) and regaining range of motion (ROM) in the knee. Because restricted knee ROM affects

  1. La revocación de senadores de designación autonómica (la Ley valenciana 10/2016 y la STC 123/2017 // The Revocation of Senators of autonomic designation (Valencian Law 10/2016 and STC 123/2017

    Directory of Open Access Journals (Sweden)

    Vicente Navarro Marchante

    2018-04-01

    The Valencian Autonomous Community approved at the end of last year the Law 10/2016 that modified several aspects of the territorial law that regulated different aspects about the appointment of senators in representation of the Autonomous Community. The new norm introduces, in a novel way in our right, the possibility of revocation of the senator appointed by the autonomic parliament, in addition to establishing the mandatory of the senator of appearance in the designating chamber as a form of accountability. The possibility of revocation of the senator due to loss of confidence of the autonomous chamber raises doubts of constitutionality by, among others, possible violation of the prohibition of imperative mandate of the members of the Cortes Generales, already resolved by STC 123/2017. This article, along the lines of the analysis of the Valencian norm and its constitutional reserve, reflects over the nature of the representative mandate and the peculiar function of the chamber of territorial representation.

  2. Análise de risco em projetos de engenharia: uso do PERT/CPM com simulação

    Directory of Open Access Journals (Sweden)

    Walter Roberto Hernández Vergara

    2017-01-01

    Full Text Available PERT/CPM is a tool used in project management that allows the planning, scheduling, and coordination of activities for controlling time and cost. Monte Carlo simulation is a process based on samples of random numbers that assists in decision-making under conditions of risk and uncertainty. This study aims to analyze the restrictions in the construction sector, such as financial budgets and time. Through this analysis, the critical path is determined by the PERT/CPM tool, allowing the acceleration of project activities without exceeding the initial investment. The Monte Carlo simulation allowed carrying out a probabilistic analysis to quantify the inherent sensitivity in project completion and to have a more realistic view of future scenarios. The study was carried out at a construction company that furnished the data for its analysis and application.

  3. Biocompatibility and setting time of CPM-MTA and white Portland cement clinker with or without calcium sulfate.

    Science.gov (United States)

    Bramante, Clovis Monteiro; Kato, Marcia Magro; Assis, Gerson Francisco de; Duarte, Marco Antonio Hungaro; Bernardineli, Norberti; Moraes, Ivaldo Gomes de; Garcia, Roberto Brandão; Ordinola-Zapata, Ronald; Bramante, Alexandre Silva

    2013-01-01

    To evaluate the biocompatibility and the setting time of Portland cement clinker with or without 2% or 5% calcium sulfate and MTA-CPM. Twenty-four mice (Rattus norvegicus) received subcutaneously polyethylene tubes filled with Portland cement clinker with or without 2% or 5% calcium sulfate and MTA. After 15, 30 and 60 days of implantation, the animals were killed and specimens were prepared for microscopic analysis. For evaluation of the setting time, each material was analyzed using Gilmore needles weighing 113.5 g and 456.5 g, according to the ASTM specification Number C266-08 guideline. Data were analyzed by ANOVA and Tukey's test for setting time and Kruskal-Wallis and Dunn test for biocompatibility at 5% significance level. Histologic observation showed no statistically significant difference of biocompatibility (p>0.05) among the materials in the subcutaneous tissues. For the setting time, clinker without calcium sulfate showed the shortest initial and final setting times (6.18 s/21.48 s), followed by clinker with 2% calcium sulfate (9.22 s/25.33 s), clinker with 5% calcium sulfate (10.06 s/42.46 s) and MTA (15.01 s/42.46 s). All the tested materials showed biocompatibility and the calcium sulfate absence shortened the initial and final setting times of the white Portland cement clinker.

  4. Development of a computer-assisted system for model-based condylar position analysis (E-CPM).

    Science.gov (United States)

    Ahlers, M O; Jakstat, H

    2009-01-01

    Condylar position analysis is a measuring method for the three-dimensional quantitative acquisition of the position of the mandible in different conditions or at different points in time. Originally, the measurement was done based on a model, using special mechanical condylar position measuring instruments, and on a research scale with mechanical-electronic measuring instruments. Today, as an alternative, it is possible to take measurements with electronic measuring instruments applied directly to the patient. The computerization of imaging has also facilitated condylar position measurement by means of three-dimensional data records obtained by imaging examination methods, which has been used in connection with the simulation and quantification of surgical operation results. However, the comparative measurement of the condylar position at different points in time has so far not been possible to the required degree. An electronic measuring instrument, allowing acquisition of the condylar position in clinical routine and facilitating later calibration with measurements from later examinations by data storage and use of precise equalizing systems, was therefore designed by the present authors. This measuring instrument was implemented on the basis of already existing components from the Reference CPM und Cadiax Compact articulator and registration systems (Gamma Dental, Klosterneuburg, Austria) as well as the matching CMD3D evaluation software (dentaConcept, Hamburg).

  5. Influence of calcination temperature on the zirconia microstructure synthesized by complex polymerization method (CPM): a comparative study

    Energy Technology Data Exchange (ETDEWEB)

    Santos, R.L.P.; Mota, F.V.; Nascimento, R.M.; Henriques, B.P.; Silva, F.S.; Assis, R. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil)

    2016-07-01

    Full text: The aim of this study was to accomplish a previous characterization of the zirconia synthesized by Complex Polymerization Method (CPM) using yttria as stabilizing agent and different calcination temperatures. The powders were crystallized at 800, 900 and 1000 °C for 2h. The structural evolution Y-TZP powders were characterized by X-Ray Diffraction (XRD) and Micro-Raman Spectroscopy. The thermal properties of the calcined pre-pyrolyzed (350 °C for 4 h), samples were investigated by simultaneous thermo analysis (TGA/DTA). After heat treatment the phase Y-TZP was obtained of a single-phase, with absence of the deleterious phases. The results show that average crystallite size of the powder synthesized with 3% of Yttria dopant, increased from 11.5 to 27.9 nm when the calcination temperature increased from 800 to 1000 °C. This behavior was observed for all specimens independent of the Yttria content. The micro-Raman indicate the presence of the tetragonal phase for all samples independent of the calcination temperature employed. (author)

  6. An FCS study of unfolding and refolding of CPM-labeled human serum albumin: role of ionic liquid.

    Science.gov (United States)

    Sasmal, Dibyendu Kumar; Mondal, Tridib; Sen Mojumdar, Supratik; Choudhury, Aparajita; Banerjee, Rajat; Bhattacharyya, Kankan

    2011-11-10

    The effect of a room temperature ionic liquid (RTIL) on the conformational dynamics of a protein, human serum albumin (HSA), is studied by fluorescence correlation spectroscopy (FCS). For this, the protein was covalently labeled by a fluorophore, 7-dimethylamino-3-(4-maleimidophenyl)-4-methylcoumarin (CPM). On addition of a RTIL ([pmim][Br]) to the native protein, the diffusion coefficient (D(t)) decreases and the hydrodynamic radius (R(h)) increases. This suggests that the RTIL ([pmim][Br]) acts as a denaturant when the protein is in the native state. However, addition of [pmim][Br] to a protein denatured by GdnHCl causes an increases in D(t) and decrease in R(h). This suggests that in the presence of GdnHCl addition of RTIL helps the protein to refold. In the native state, the conformational dynamics of protein is described by three distinct time constants: ~3.6 ± 0.7, ~29 ± 4.5, and 133 ± 23 μs. The faster components (~3.6 ± 0.7 and ~29 ± 4.5 μs) are ascribed to chain dynamics of the protein, while the slowest component (133 μs) is responsible for interchain interaction or concerted motion. On addition of [pmim][Br], the conformational dynamics of HSA becomes slower (~5.1 ± 1, ~43.5 ± 2.8, and ~311 ± 2.3 μs in the presence of 1.5 M [pmim][Br]). The time constants for the protein denatured by 6 M GdnHCl are 3.2 ± 0.4, 34 ± 6, and 207 ± 38 μs. When 1.5 M [pmim][Br] is added to the denatured protein (in 6 M GdnHCl), the time constants become ~5 ± 1, ~41 ± 10, and ~230 ± 45 μs. The lifetime histogram shows that, on addition of GdnHCl to HSA, the contribution of the shorter lifetime component decreases and vanishes at 6 M GdnHCl. The shorter lifetime component immediately reappears after addition of RTIL to unfolded HSA. This suggests recoiling of the unfolded protein by RTIL.

  7. Novel Mechanism of Fatty Acid Sensing in Enteroendocrine Cells: Specific Structures in Oxo-Fatty Acids Produced by Gut Bacteria are Responsible for CCK Secretion in STC-1 Cells via GPR40.

    Science.gov (United States)

    Hira, Tohru; Ogasawara, Shono; Yahagi, Asuka; Kamachi, Minami; Li, Jiaxin; Nishimura, Saki; Sakaino, Masayoshi; Yamashita, Takatoshi; Kishino, Shigenobu; Ogawa, Jun; Hara, Hiroshi

    2018-06-25

    The secretion of gut hormones, such as cholecystokinin (CCK) is stimulated by fatty acids. Although a chain length-dependent mechanism has been proposed, other structural relationships to releasing activity remain unclear. We aimed to elucidate specific structures in fatty acids that are responsible for their CCK-releasing activity, and related sensing mechanisms in enteroendocrine cells. We examined CCK secretory activities in a murine CCK-producing cell line STC-1 by exposing the cells to various modified fatty acids produced by gut lactic acid bacteria. The effects of fatty acids on gastric emptying rate as a CCK-mediated function were examined using acetaminophen- and phenol red-methods in rats. Out of more than thirty octadecanoic (C18)-derived fatty acids tested, five oxo-fatty acids potently stimulated CCK secretion without cytotoxic effects in STC-1 cells. Three fatty acids had a distinct specific structure containing one double-bond, whereas the other two had two double-bonds, nearby an oxo residue. CCK secretion induced by representative fatty acids (10-oxo-trans-11-18:1 and 13-oxo-cis-9,cis-15-18:2) was attenuated by a fatty acid-receptor GPR40 antagonist. Oral administration of 13-oxo-cis-9,cis-15-18:2 lowered the gastric emptying rate in rats in a dose- and structure-dependent manner. These results revealed a novel fatty acid-sensing mechanism in enteroendocrine cells. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  8. Preparation and characterizations of Ba0.8Ca0.2TiO3 by complex polymerization method (CPM)

    International Nuclear Information System (INIS)

    Motta, F.V.; Marques, A.P.A.; Escote, M.T.; Melo, D.M.A.; Ferreira, A.G.; Longo, E.; Leite, E.R.; Varela, J.A.

    2008-01-01

    Ba 0.8 Ca 0.2 TiO 3 (BCT) was prepared by the complex polymerization method (CPM) using Ba 0.8 Ca 0.2 CO 3 and [Ti[OCH(CH 3 ) 2 ] 4 as starting materials. The powders were crystallized at several temperatures from 400 to 1200 deg. C using different times (from 1 to 8 h). The phase evolution and the physical properties were characterized by X-ray diffraction, Raman and IR spectroscopy. Such results indicate that the precursor Ba 0.8 Ca 0.2 CO 3 used in the synthesis of Ba 0.8 Ca 0.2 TiO 3 promotes an effective complexation of the ions Ca 2+ in the matrix of BaTiO 3 . After heat treatment for 2 h at 600 deg. C the phase BCT was obtained with absence of the CaTiO 3 or BaCO 3 phases. The CPM is an efficient method in the synthesis of the BCT, using small reaction time and low temperature and cost for the preparation of these powders

  9. Theoretical Prediction on [5]Radialene Sandwich Complexes (CpM)2(C10H10) (Cp = η5-C5H5; M = Fe, Co, Ni): Geometry, Spin States, and Bonding.

    Science.gov (United States)

    Liu, Nan-Nan; Xue, Ying-Ying; Ding, Yi-Hong

    2017-02-09

    [5]Radialene, the missing link for synthesis of radialene family, has been finally obtained via the preparation and decomplexation of the [5]radialene-bis-Fe(CO) 3 complex. The stability of [5]radialene complex benefits from the coordination with Fe(CO) 3 by losing free 1,3-butadiene structures to avoid polymerization. In light of the similar coordination ability of half-sandwiches CpM(Cp = η 5 -C 5 H 5 ; M = Fe, Co, Ni), there is a great possibility that the sandwiched complexes of [5]radialene with CpM are available. Herein, we present the first theoretical prediction on the geometry, spin states and bonding of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ). For M = Fe, Co, Ni, the ground states of (CpM)(C 10 H 10 ) and (CpM) 2 (C 10 H 10 ) are doublet and triplet, singlet and singlet, and doublet and triplet states, where each Fe, Co, and Ni adopts 17, 18, and 19 electron-configuration, respectively. In particular, (CpFe) 2 (C 10 H 10 ) and (CpNi) 2 (C 10 H 10 ) have considerable open-shell singlet features. Generally the trans isomers of (CpM) 2 (C 10 H 10 ) with two CpM fragments on the opposite sides of the [5]radialene plane are apparently more stable than the cis ones with CpM fragments on the same side. However, for the singlet and triplet isomers of (CpNi) 2 (C 10 H 10 ) (both cis and trans isomers), the energy differences are relatively small, indicating that these isomers all have the opportunity to exist. Besides, the easy Diels-Alder (DA) dimerization between the [3]dendralene-like fragments of (CpM)(C 10 H 10 ) suggests the great difficulty in isolating the (CpM)(C 10 H 10 ) monomer.

  10. ADMINISTRACIÓN DEL PROYECTO “DESARROLLO DE CAPACIDADES HUMANAS”, MEDIANTE LAS TÉCNICAS ADMINISTRATIVAS CPM Y PERT, URACCAN – SIUNA, 2012

    Directory of Open Access Journals (Sweden)

    Yader Antonio Ordoñez Aguilar

    2014-09-01

    Full Text Available Esta investigación ha aplicado el Método de la Ruta Crítica (CPM y las Técnicas de Evaluación y Revisión de Programas (PERT en la administración del proyecto: “Desarrollo de capacidades técnicas y humanas para la implementación del plan de desarrollo regional con identidad en el sector de Las Minas”, ejecutado en Siuna, 2012, por la URACCAN. Es un estudio aplicativo retrospectivo con un enfoque cuantitativo enmarcado en las técnicas administrativas de proyecto CPM y PERT mediante el programa WinQSB, en la administración del proyecto en estudio.De acuerdo a los resultados, todo el proyecto puede concluirse en 51.3 meses, equivalente a 4 años y 3 meses, teniendo 12 actividades críticas, las cuales representan que un retraso en cualquiera de estas ocasionaría un retraso en todo el proyecto. El costo total de las actividades de este proyecto es de 617,863.00 euros y el costo total de la ruta crítica es de 231,585.00 euros. El proyecto incurre en otros costos, tales como: mano de obra, transporte, servicios de consulta, evaluación, entre otros, que también forman parte del presupuesto total del proyecto, siendo este de 1,040,251.00 euros. El proyecto necesitó más tiempo para poder concluir cada una de las actividades, ya que en su planificación inicial estaba programado a terminarse en 3 años, lo cual no se cumplió porque tuvieron que solicitar una prórroga de tres meses para la conclusión total del mismo. La ventaja en la aplicación del Método de la Ruta Crítica, es que dio la perspectiva para tener la información del proyecto de manera organizada y lista para cualquier revisión; una de las principales desventajas es que se tuvo que organizar todas las actividades con respecto a sus predecesores inmediatos y tener conocimiento del método, así como el programa WinQSB para evitar resultados adversos.Palabras clave: Técnicas administrativas; Programa WINQSB; actividades críticas; ruta crítica; predecesores

  11. Revisionismo histórico y racismo en la jurisprudencia constitucional : los límites de la libertad de expresión (a propósito de la STC 235/2007

    Directory of Open Access Journals (Sweden)

    Göran Rollnert Liern

    2008-01-01

    Full Text Available Después de plantear la contradicción existente en la jurisprudenciaconstitucional que, por una parte, admite el revisionismo histórico conel límite del respeto a la dignidad y, por otra parte, reconoce con lamáxima amplitud la libertad ideológica, se analiza la STC 235/2007que ha declarado inconstitucional el delito de negación del genocidioy, en cambio, ha considerado constitucional la penalización de la justificacióndel genocidio. Esta sentencia ha clarificado parcialmente lasituación del revisionismo histórico y, en general, de la difusión de ideascontrarias a la Constitución pero sigue existiendo aquella contradicción;no obstante, ha aportado elementos como la distinción entreideas y actividades y la ampliación del ámbito de la libertad de expresiónpor su conexión con la libertad ideológica que permiten defenderuna interpretación de la jurisprudencia constitucional que considereprotegidas por las libertades de expresión e ideológica las expresionescontrarias a la Constitución, porque la dignidad y los derechos delos demás sólo se ven lesionados por afirmaciones ofensivas o actividadeso comportamientos violentos o discriminatorios y no por lasimple expresión de ideas.   After noting the contradiction that exists in constitutional case-lawthat while accepting historical revisionism with the limitation of respectingdignity, at the same time recognizes the greatest extent of thefreedom of thought, analyses Constitutional Judgement 235/2007which declares the denial of genocide as a crime to be unconstitutional,but considers the penalization of the justification of genocide tobe constitutional. This sentence has partially clarified the status of historicalrevisionism and, in general, the dissemination of ideas contraryto the Constitution, but the contradiction still remains; nevertheless,it has furnished elements such as the distinction between ideas and activities,and broadening the scope of the freedom of speech by

  12. PERT and CPM: Workshop Material.

    Science.gov (United States)

    Burroughs Corp., Detroit, MI.

    This is a workbook containing problems in PERT (program evaluation review technique). It is intended to be used in a workshop or classroom to train management personnel in the basic methodology and capability of PERT. This material is not adequate in depth to create an expert in these techniques, but it is felt that the material is adequate to…

  13. Condylar position analysis with a new electronic condylar position measuring instrument E-CPM: influence of different examiners and a working bite on reproducibility.

    Science.gov (United States)

    Vahle-Hinz, K; Rybczynski, A; Jakstat, H; Ahlers, M O

    2009-01-01

    Condylar position analysis facilitates a quantitative comparison of the condylar position with and without a bite record, different records and changed influencing factors. Handling by the examiner when positioning the model is a significant factor with regard to the accuracy of the examination. Measurement accuracy could be improved when positioning the models by using special working bites, hence the objective of the experiments described in this study consisted in examining the extent to which the measuring results are influenced by different examiners and by using working bites. In the first trial, one examiner performed ten measurements without and with an interposed working bite for five model pairs in each case. In the second trial, nine examiners (three specialized dentists, three dental assistants, three students) performed ten measurements in each case without and with an interposed working bite. The three-dimensional position was read digitally with the E-CPM (Gamma Dental, Klosterneuburg/Vienna, Austria), recorded by means of spreadsheet software (Microsoft Excel) and diagnostic software (CMDfact, CMD3D module, dentaConcept, Hamburg), and evaluated with graphing software (Sigma Plot, Systat Software, USA). In the first trial, it was shown that the reproducibility of mounting was improved markedly (p <0.01) by using bite records in the form of working bites. In the second trial, it was shown that the mean error increased significantly (p <0.01) when several examiners performed the measurements compared with the results of one examiner alone. No significantly different results occurred (p < 0.01) in the comparison of the different groups of examiners with different educational and training backgrounds. This applied for the mounting methods without and with working bite. On the other hand, the reproducibility of mounting improved distinctly (p<0.01) in every group of examiners when working bites were used. Reproducibility of condylar position analysis was

  14. Educación ambiental no formal y actitud hacia la conservación del medio ambiente de la población del C.P.M. Francisco Bolognesi de Tacna

    OpenAIRE

    Santana Soto, Humberto Jacinto

    2017-01-01

    El objetivo fue determinar el efecto de la educación ambiental no formal en la actitud hacia la conservación medioambiental de la población del C.P.M. Bolognesi de Tacna en el 2016. El diseño fue cuasiexperimental intrasujetos, con una muestra de 33 pobladores. Principales resultados, la puntuación promedio de la escala de actitud en la dimensión cognitiva, afectiva, conativa y puntuación total, después de la aplicación del estímulo fue superior en el grupo experimental respecto del control. ...

  15. Continuous passive motion and physical therapy (CPM) versus physical therapy (PT) versus delayed physical therapy (DPT) after surgical release for elbow contractures; a study protocol for a prospective randomized controlled trial.

    Science.gov (United States)

    Viveen, Jetske; Doornberg, Job N; Kodde, Izaak F; Goossens, Pjotr; Koenraadt, Koen L M; The, Bertram; Eygendaal, Denise

    2017-11-22

    The elbow is prone to stiffness after trauma. To regain functional elbow motion several conservative- and surgical treatment options are available. Conservative treatment includes physical therapy, intra-articular injections with corticosteroids and a static progressive or dynamic splinting program. If conservative treatment fails, an operative release of the posttraumatic stiff elbow is often performed. The best Evidence-Based rehabilitation protocol for patients after an operative release is unknown to date and differs per surgeon, hospital and country. Options include early- or delayed motion supervised by a physical therapist, immediate continuous passive motion (CPM), (night) splinting and a static progressive or dynamic splinting program. The SET-Study (Stiff Elbow Trial) is a single-centre, prospective, randomized controlled trial. The primary objective of this study is to compare the active Range of Motion (ROM) (flexion arc and rotational arc) twelve months after surgery between three groups. The first group will receive in-hospital CPM in combination with early motion Physical Therapy (PT) supervised by a physical therapist, the second group will receive only in-hospital early motion PT supervised by a physical therapist and the third group will receive outpatient supervised PT from postoperative day seven till ten. Secondary outcome measures will be Patient Reported Outcome Measures (PROMs) including the Mayo Elbow Performance Score (MEPS), the Oxford Elbow Score (OES), the quick Disabilities of Arm, Shoulder and Hand (qDASH) score, Visual Analogue pain Scale in rest and activity (VAS), Pain Catastrophizing Scale (PCS), the Short Form (SF)-36, the Centre for Epidemiological Studies Depression Scale Revised (CESD-R) and the Work Rehabilitation Questionnaire (WORQ) for the upper limb. A successful completion of this trial will provide evidence on the best rehabilitation protocol in order to (re)gain optimal motion after surgical release of the stiff elbow

  16. La juridificación del derecho a decidir en España. La STC 42/2014 y el derecho a aspirar a un proceso de cambio político del orden constitucional. // The juridification of the right to decide in Spain.

    Directory of Open Access Journals (Sweden)

    Joan Ridao i Martín

    2014-12-01

    Full Text Available SUMMARY: 1. The Sentence 42/2014, of the Constitutional Court of Spain, about the «Declaration of sovereignty and the right to decide of the people in Catalonia». 2. The right to self-determination and the juridification of the right to decide in the international context. 3 The fitting of the right to decide in the Spanish domestic constitutional order. Background. 3.1. The so-called «Ibarretxe Plan». 3.2. The Catalan case: the so-called «National Transition». 4. Query tools that do not involve the exercise of the right to self-determination. 4.1. Consequences of the weak standardization of referendums in Spain. 4.2. The potential territorialisation of referendums of Article 92 Spanish Constitution (CE. The eventual delegation of state power to authorize referendums of Article 150.2 CE. 5. Referendums and consultations at the regional level. 5.1. The Catalan legislation regarding referendums. 5.2. The non-referendum consultation: a hybrid not-called referendum. Conclusions. Bibliography. RESUMEN La STC 42/2014, de 25 de marzo, estimó parcialmente, por unanimidad, el recurso del Gobierno contra la «Resolución 5/X del Parlamento de Cataluña, por la que se aprueba la Declaración soberanista y del derecho a decidir del pueblo de Cataluña», declarando «inconstitucional y nulo» el principio primero, según el cual, «el pueblo de Cataluña tiene, por razones de legitimidad democrática, el carácter de sujeto político y jurídico soberano». No obstante, el alto Tribunal declaró constitucionales las referencias al «derecho a decidir de los ciudadanos de Cataluña» al no consagrar, a su juicio, un derecho de autodeterminación no reconocido constitucionalmente sino una aspiración política a concretar mediante un proceso ajustado a la legalidad constitucional, con respeto a los principios de «legitimidad democrática», «pluralismo» y «legalidad». La argumentación del Tribunal no sólo desestimó el argumento de que el

  17. ANKARA İLİ DELİCE İLÇESİ KÖPRÜSÜNÜN CPM METODU İLE MÜHENDİSLİK KRİTERLERİNİN BELİRLENMESİ

    Directory of Open Access Journals (Sweden)

    M. Haluk ÇELİK

    1995-02-01

    Full Text Available Bu çalışmada malzeme olarak seçilmiş olan Ankara ili sınırları içinde yer alan, Delice İlçe Merkezi'nden geçmekte olan Koru deresinde ulaşımı sağlamak amacı ile 13.70 m mesnet açıklığında 8 m platform genişliğinde kirişli betonarme köprü inşaatının CPM-PERT metodu ile iyi bir planlama ve yapımında kullanılan minimum süre ve maliyeti hesaplanmaktır. Projede yapılan her hesapta en erken ve en geç tamamlanma süreleri göz önüne alınmıştır.

  18. ESRD - Clinical Performance Measures (CPM) Project

    Data.gov (United States)

    U.S. Department of Health & Human Services — Section 4558 (b) of the Balanced Budget Act (BBA) requires CMS to develop and implement by January 1, 2000, a method to measure and report the quality of renal...

  19. COMPARE CPM-RMI Trial: Intramyocardial Transplantation of Autologous Bone Marrow-Derived CD133+ Cells and MNCs during CABG in Patients with Recent MI: A Phase II/III, Multicenter, Placebo-Controlled, Randomized, Double-Blind Clinical Trial.

    Science.gov (United States)

    Naseri, Mohammad Hassan; Madani, Hoda; Ahmadi Tafti, Seyed Hossein; Moshkani Farahani, Maryam; Kazemi Saleh, Davood; Hosseinnejad, Hossein; Hosseini, Saeid; Hekmat, Sepideh; Hossein Ahmadi, Zargham; Dehghani, Majid; Saadat, Alireza; Mardpour, Soura; Hosseini, Seyedeh Esmat; Esmaeilzadeh, Maryam; Sadeghian, Hakimeh; Bahoush, Gholamreza; Bassi, Ali; Amin, Ahmad; Fazeli, Roghayeh; Sharafi, Yaser; Arab, Leila; Movahhed, Mansour; Davaran, Saeid; Ramezanzadeh, Narges; Kouhkan, Azam; Hezavehei, Ali; Namiri, Mehrnaz; Kashfi, Fahimeh; Akhlaghi, Ali; Sotoodehnejadnematalahi, Fattah; Vosough Dizaji, Ahmad; Gourabi, Hamid; Syedi, Naeema; Shahverdi, Abdol Hosein; Baharvand, Hossein; Aghdami, Nasser

    2018-07-01

    The regenerative potential of bone marrow-derived mononuclear cells (MNCs) and CD133+ stem cells in the heart varies in terms of their pro-angiogenic effects. This phase II/III, multicenter and double-blind trial is designed to compare the functional effects of intramyocardial autologous transplantation of both cell types and placebo in patients with recent myocardial infarction (RMI) post-coronary artery bypass graft. This was a phase II/III, randomized, double-blind, placebo-controlled trial COMPARE CPM-RMI (CD133, Placebo, MNCs - recent myocardial infarction) conducted in accordance with the Declaration of Helsinki that assessed the safety and efficacy of CD133 and MNCs compared to placebo in patients with RMI. We randomly assigned 77 eligible RMI patients selected from 5 hospitals to receive CD133+ cells, MNC, or a placebo. Patients underwent gated single photon emission computed tomography assessments at 6 and 18 months post-intramyocardial transplantation. We tested the normally distributed efficacy outcomes with a mixed analysis of variance model that used the entire data set of baseline and between-group comparisons as well as within subject (time) and group×time interaction terms. There were no related serious adverse events reported. The intramyocardial transplantation of both cell types increased left ventricular ejection fraction by 9% [95% confidence intervals (CI): 2.14% to 15.78%, P=0.01] and improved decreased systolic wall thickening by -3.7 (95% CI: -7.07 to -0.42, P=0.03). The CD133 group showed significantly decreased non-viable segments by 75% (P=0.001) compared to the placebo and 60% (P=0.01) compared to the MNC group. We observed this improvement at both the 6- and 18-month time points. Intramyocardial injections of CD133+ cells or MNCs appeared to be safe and efficient with superiority of CD133+ cells for patients with RMI. Although the sample size precluded a definitive statement about clinical outcomes, these results have provided the

  20. Project Management using Critical Path Method (CPM): A Pragmatic ...

    African Journals Online (AJOL)

    Traditional techniques of decision-making have hindered the technical efficiency of most professionals and executors of the public project in many developing countries such as Nigeria. The use of Gantt chart in project planning has continued to increase as a source of last resort in spite of its severe limitations for ineffective ...

  1. [Circumscribed palmar hypokeratosis (CPM): The diagnostic value of dermoscopy].

    Science.gov (United States)

    Topin-Ruiz, S; Debarre, J-M; Blanchard, E; Kettani, S; Valmier, P-J; Martin, L; Le Corre, Y

    2017-03-01

    Circumscribed palmar hypokeratosis (CPH) is a rare skin disease, first described in 2002, associated with sudden localized reduction of the corneal layer. In most cases, it presents as an isolated rounded erythematous palmar lesion on the thenar eminence. We describe the dermoscopic semiology of CPH in 3 cases. Three patients between the ages of 59 and 72 presented very limited erythematous lesions suggestive of CPH. Dermoscopic examination of these lesions provided similar findings. Biopsy, which was performed in one patient, confirmed the diagnosis of CPH. Two dermoscopic elements of CPH are characteristic: (1) the sides of the lesion have a "stair step" or "geological strata" type of configuration, and the thickness of the different strata varies; (2) the centre of the lesion showed a homogeneous erythematous area with a vascular pattern composed of dotted vessels of the superficial dermis and sometime vascular loops. These dermoscopic aspects are characteristic and enable CPH to be differentiated from Bowen's disease or porokeratosis of Mibelli. In Bowen's disease, there is no stair step like aspect to the sides of lesions; further, the centre of the lesion shows glomerular vessels (coiled vessels) and/or globular vessels (small red clods). In porokeratosis, peripheral keratotic "white track" structures comprise a single pigmented channel or a double white line. There is no "stair step" or central vascular pattern. The dermoscopic semiology of CPH is highly characteristic and enables differentiation from Bowen's disease and porokeratosis. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  2. Trellis-coded CPM for satellite-based mobile communications

    Science.gov (United States)

    Abrishamkar, Farrokh; Biglieri, Ezio

    1988-01-01

    Digital transmission for satellite-based land mobile communications is discussed. To satisfy the power and bandwidth limitations imposed on such systems, a combination of trellis coding and continuous-phase modulated signals are considered. Some schemes based on this idea are presented, and their performance is analyzed by computer simulation. The results obtained show that a scheme based on directional detection and Viterbi decoding appears promising for practical applications.

  3. Strategic Bidding in Hybrid CPC/CPM Auctions

    OpenAIRE

    Yi Zhu; Kenneth C. Wilbur

    2008-01-01

    Websites increasingly allow advertisers to choose whether to bid for advertising on a per-impression or per-click basis. We present the first analysis of this new hybrid auction market. The conventional wisdom in this industry is that brand advertisers (e.g., Coca-Cola) will bid for impressions, while direct response advertisers (e.g., Amazon.com) will bid for clicks. We find that in an auction setting similar to that used by Facebook and Google, brand advertisers may have an incentive to bid...

  4. MDEP Common Position CP-STC-02. Common Position Addressing Fukushima Daiichi Nuclear Power Accident

    International Nuclear Information System (INIS)

    2016-09-01

    Following the nuclear accident in Japan as a consequence of the earthquake and tsunami, the MDEP Members provide the following information, based on initial information available, to ensure adequate safety of new reactor design activities being undertaken pursuant to the MDEP program of work. Due to the extensive nature of the magnitude and duration of the Fukushima Daiichi NPP accident, it is important to consider lessons learnt at an early stage of the design. In this context, the extensive work done by the IAEA, the International Atomic Energy Agency, is also acknowledged. Vendors, licensees and applicants involved in New Design activities should examine the implications of the Fukushima Daiichi NPP accident and identify relevant issues to be taken into account to strengthen defense in depth. Those lessons learnt should include, but not be limited to, plans to assess the following: - Provisions taken in the design basis concerning flooding, earthquake, other extreme natural phenomena and combinations of external event hazards appropriate to each country, - The robustness of the plant to maintain its safety functions beyond the design basis hazards, - The capability of the plant to withstand extended loss of all electrical power supplies as well as prolonged loss of ultimate heat sink and other essential supplies, and - The capability of the plant to cope with such extreme situations, including provisions to manage severe accidents (such as combustible gas management). In assessing these areas, the effect of multiple units and nuclear fuel storages should be considered. The MDEP regulators will strive to harmonize approaches to incorporate lessons learnt in their ongoing national safety reviews of new reactors. Based on the design-specific common positions, this paper identifies the approaches to address potential safety improvements for several designs as related to lessons learned from the Fukushima Daiichi NPP accident or related issues. Designs being considered are: EPR (1650 MWe pressurized water reactor); AP1000 (1110 MWe pressurized water reactor); APR1400 (1400 MWe pressurized water reactor); VVER (1200 MWe pressurized water reactor); ABWR (boiling water reactor with a power output in the 1350 to 1460 MWe range). The designs were assessed in the following five areas: external hazards reliability of safety functions (addressing station black-out and ultimate heat sinks), accidents with core melt, spent fuel pools, and emergency preparedness in design. Mitigation of extreme external hazards often implies improving the robustness of an NPP. While the MDEP focus in addressing issues related to the Fukushima Daiichi NPP accident has been on safety, it should be noted that improved NPP robustness will also improve the capability of the plant to withstand security related challenges

  5. STC synthesis of best practices for determining value of research results : final report.

    Science.gov (United States)

    2014-01-01

    Transportation research projects are aimed at fostering innovation in different areas, such as : safety, cost savings, quality, efficiency, project delivery, and policy. Transportation agencies and : most notably State Departments of Transportation (...

  6. Trade-Off Study for an STC 70 W Stirling Engine

    Science.gov (United States)

    Qiu, Songgang; Peterson, Allen A.; Augenblick, Jack E.

    2005-02-01

    A high-efficiency, low-weight free-piston Stirling generator, RG-70L, has been conceptually designed. This paper reports the detailed trade-off study of newly designed RG-70L. The trades of operating frequency and piston/displacer strokes on Stirling convertor mass and efficiency are discussed. This paper shows how the operating frequency and strokes were optimized based on the trades. Losses associated with increased frequency were fully investigated and the results are discussed in the paper. Various optional linear alternator configurations are also presented and the estimated masses are reported.

  7. STC synthesis of research results for water quality management at construction sites : final report.

    Science.gov (United States)

    2014-01-01

    The United States Environmental Protection Agency (EPA) lists sediment as the most common pollutant in U.S. streams, rivers, lakes, and : reservoirs. This is of significant importance to state Departments of Transportation (DOT) due to the large amou...

  8. Electro-optical measurements of 3D-stc detectors fabricated at ITC-irst

    Energy Technology Data Exchange (ETDEWEB)

    Zoboli, Andrea [INFN and Department of ICT, University of Trento, via Sommarive, 14 - 38050 Povo di Trento (Italy)], E-mail: zoboli@dit.unitn.it; Boscardin, Maurizio [ITC-irst, Microsystems Division, via Sommarive, 18 - 38050 Povo di Trento (Italy); Bosisio, Luciano [INFN and Department of Physics, University of Trieste, via A. Valerio, 2 - 34127 Trieste (Italy); Dalla Betta, Gian-Franco [INFN and Department of ICT, University of Trento, via Sommarive, 14 - 38050 Povo di Trento (Italy); Piemonte, Claudio; Pozza, Alberto; Ronchin, Sabina; Zorzi, Nicola [ITC-irst, Microsystems Division, via Sommarive, 18 - 38050 Povo di Trento (Italy)

    2007-12-11

    In the past two years 3D silicon radiation detectors have been developed at ITC-irst (Trento, Italy). As a first step toward full 3D devices, simplified structures featuring columnar electrodes of one doping type only were fabricated. This paper reports the electro-optical characterization of 3D test diodes made with this approach. Experimental results and TCAD simulations provide good insight into the charge collection mechanism and response speed limitation of these structures.

  9. MDEP Position Paper - PP-STC-01 - MDEP Steering Technical Committee Position Paper on Safety Goals

    International Nuclear Information System (INIS)

    2011-01-01

    In considering the acceptability of a nuclear facility in relation to safety, Governments and regulatory bodies define a range of legal, mandatory requirements which are supplemented by regulatory requirements and expectations which may not have a mandatory nature. The term 'safety goals' is used to cover all health and safety requirements and expectations which must be met: these may be deterministic rules and/or probabilistic targets. They should cover the safety of workers, public and the environment in line with the IAEA's Basic Safety Objective encompassing safety in normal operation through to severe plant states. Although all regulators have safety goals, these are expressed in many different ways and exercises in comparing them frequently are done at a very low level e.g. specific temperature limits in the reactor core. The differences in the requirements from different regulators are difficult to resolve as the goals are derived using different principles and assumptions and are usually for a specific technology. Therefore the Multinational Design Evaluation Programme (MDEP) set up a sub-committee to investigate a different approach. This approach was to start with the high level safety goals and try to derive a structure and means of deriving lower level safety goals that can be seen to be clearly related to the higher level ones. The work will greatly assist in the process of harmonisation of regulatory requirements and enhance coherence and consistency between goals for different technologies. MDEP expects that higher levels of safety will be achieved in the design and operation of new reactors. MDEP strongly supports the structure of safety goals and targets, as set out in this paper, for consideration of its members and IAEA and other organisations, in moving towards international harmonisation of regulatory requirements. MDEP strongly supports the use of integrated decision-making for design evaluation and operational safety. MDEP recognises the need to develop the process, through continued interactions with other international organisations, to further harmonise regulatory requirements

  10. Self-supporting radioisotope generators with STC-55W Stirling converters

    International Nuclear Information System (INIS)

    Or, C.; Kumar, V.; Carpenter, R.; Schock, A.

    2000-01-01

    Previous Orbital Stirling generator designs rely on the spacecraft mounting structure to fasten the radiators, the converters, and the heat source assembly. This paper describes a self-supporting generator concept with a 1-piece honeycomb panel serving as a radiator and a rigid platform for the converters and the heat source assembly to be bolted on. This self-supporting generator allows for simpler mounting structure and more options on mounting location. Using this self-supporting generator concept, we derived four different design options to connect the converter pair rigidly to reduce vibration. This paper describes the four design options and their assembly procedure

  11. Perceived effectiveness of training and development: a case study in stc technologies pvt ltd., chennai

    OpenAIRE

    Swaminathan, j; Gowri shankar, u

    2011-01-01

    Training is the act of increasing the knowledge and skill of an employee for doing particular job .The training is to acquire new skill, technical knowledge, problemsolving, etc. Training improves the performance of employees on present jobs and prepares them for taking up new assignments in the future. Training also helps in the development of the employees. The main objective of the study is to measure the effectiveness of the training in the organization and its impact on employee job perf...

  12. Accident analysis for new reactor concepts and VVER type reactor design with advanced fuel. STC with Russia. Final report

    International Nuclear Information System (INIS)

    Grundmann, U.; Kliem, S.; Mittag, S.; Rohde, U.; Seidel, A.

    2000-10-01

    In the frame of a project on scientific-technical cooperation funded by BMBF/BMWi, the 3D reactor dynamics code DYN3D developed at Forschungszentrum Rossendorf (FZR), has been transferred to the Institute of Physics and Power Engineering (IPPE) Obninsk in Russia and integrated into the software package of IPPE. DYN3D has been coupled to a thermohydraulic system code used in IPPE making available 3D neutron kinetics within this software package. A new macroscopic cross section library has been created using a modified version of the WIMS/D4 code. This library includes data for modernized fuel design containing burnable absorbers in different concentrations, which is tested in VVER-1000 type reactors. The cross section library has been connected to DYN3D. Calculations were performed to check the library in comparison with other data libraries and codes. The code DYN3D and the coupled 3D neutron kinetics/thermal hydraulics code system were used to perform analyses of Anticipated Transients Without Scram (ATWS) for the reactor design ABV-67, an integral reactor concept with small power developed under participation of IPPE. The fluid dynamics code DINCOR developed at IPPE was transferred to FZR. It was used in validation calculations on test problems for the short-term core melt behaviour (CORVIS experiments). (orig.) [de

  13. LA ORGANIZACIÓN INSTITUCIONAL DE LA COMUNIDAD AUTÓNOMA EN LA STC 31/2010

    Directory of Open Access Journals (Sweden)

    José Antonio Montilla Martos

    2011-03-01

    Full Text Available This work analyses the legal foundations of Constitutional Court Ruling31/2010 which deals with the sections challenged in the Section of the Statute of Catalonia with reference to the institutions, except in matters relating to local government. There is a particular focus on the two declarations of unconstitutionality affecting this section: the exclusive nature of the supervision by the Ombudsman’s Office of the autonomous government and the related scope in some of the cases contained in the Statement of the Council of Statutory Guarantees. Additionally, it deals with the presentation of the Generalitat as the ordinary governing body and the treatment of other institutions such as the Accounts Syndicate and the Audiovisual Council.There is also a separate study of the different cases, which are unrelatedbeyond being included under the same power. However, the conclusion aims to provide some reflections applicable to all cases including the Ruling of the Constitutional Court on Statute of Catalonia as a whole.

  14. Adaption, validation and application of advanced codes with 3-dimensional neutron kinetics for accident analysis calculations - STC with Bulgaria

    International Nuclear Information System (INIS)

    Grundmann, U.; Kliem, S.; Mittag, S.; Rohde, U.; Seidel, A.; Panayotov, D.; Ilieva, B.

    2001-08-01

    In the frame of a project on scientific-technical co-operation funded by BMBF/BMWi, the program code DYN3D and the coupled code ATHLET-DYN3D have been transferred to the Institute for Nuclear Research and Nuclear Energy (INRNE) Sofia. The coupled code represents an implementation of the 3D core model DYN3D developed by FZR into the GRS thermal-hydraulics code system ATHLET. For the purpose of validation of these codes, a measurement data base about a start-up experiment obtained at the unit 6 of Kozloduy NPP (VVER-1000/V-320) has been generated. The results of performed validation calculations were compared with measurement values from the data base. A simplified model for estimation of cross flow mixing between fuel assemblies has been implemented into the program code DYN3D by Bulgarian experts. Using this cross flow model, transient processes with asymmetrical boundary conditions can be analysed more realistic. The validation of the implemented model were performed with help of comparison calculations between modified DYD3D code and thermal-hydraulics code COBRA-4I, and also on the base of the collected measurement data from Kozloduy NPP. (orig.) [de

  15. POSICIÓN Y FUNCIONES DE LOS ESTATUTOS DE AUTONOMÍA EN LA STC 31/2010

    Directory of Open Access Journals (Sweden)

    Miguel A. Aparicio Pérez

    2011-03-01

    Full Text Available In a line similar to that proposed in the State Council Report of 16 February 2006 on modifi cations to the Constitution, the Constitutional Court Ruling31/2010 has severely limited the constitutional functions of the Statutes of Autonomy while denying them any special legislative category outside thosefound in any other type of organic law. According to the jurisprudentialdoctrine of the declaration, it is clear that the Statutes of Autonomy are notadequate regulations for defining the powers and functions contained inthe powers that they attribute to the respective Autonomous Communities,therefore although they can be “described” these provisions lack regulatoryforce. Neither can the Statutes contemplate a possible development of the Autonomous State, given that the constitutional categories that belong toit and even the sub-matters over which it exercises competent functions constitutean interpretative monopoly of the Constitutional Court. This set oflimitations and inabilities mean that the Statutes of Autonomy cannot ensurean ambit of exclusive autonomous powers because, under any circumstances,the State has the power to regulate the corresponding matters usingits horizontal powers, and moreover, with the effect of supremacy. Andin the end, in relation to shared powers, the State can defi ned the basics inthe amount of detail and under the form of regulations it considers appropriate(legislative, regulatory or executive. We are therefore looking at anew attempt to declare the process of autonomy as being closed, denyingthe Statutes of possible exercising the device principle and eradicating withinthem, in appropriate feedback, their regulatory strength and their constitutional functions of origin.

  16. STC synthesis of transportation funding sources and alternatives in the southeastern states now and in the future : research project capsule.

    Science.gov (United States)

    2014-02-01

    The purpose of this synthesis is to examine a wide variety of alternative funding mechanisms currently employed : by individual states and to comprehensively assess policy and fi nance proposals with respect to their suffi ciency, : pragmatism, and p...

  17. Conservation Process Model (cpm): a Twofold Scientific Research Scope in the Information Modelling for Cultural Heritage

    Science.gov (United States)

    Fiorani, D.; Acierno, M.

    2017-05-01

    The aim of the present research is to develop an instrument able to adequately support the conservation process by means of a twofold approach, based on both BIM environment and ontology formalisation. Although BIM has been successfully experimented within AEC (Architecture Engineering Construction) field, it has showed many drawbacks for architectural heritage. To cope with unicity and more generally complexity of ancient buildings, applications so far developed have shown to poorly adapt BIM to conservation design with unsatisfactory results (Dore, Murphy 2013; Carrara 2014). In order to combine achievements reached within AEC through BIM environment (design control and management) with an appropriate, semantically enriched and flexible The presented model has at its core a knowledge base developed through information ontologies and oriented around the formalization and computability of all the knowledge necessary for the full comprehension of the object of architectural heritage an its conservation. Such a knowledge representation is worked out upon conceptual categories defined above all within architectural criticism and conservation scope. The present paper aims at further extending the scope of conceptual modelling within cultural heritage conservation already formalized by the model. A special focus is directed on decay analysis and surfaces conservation project.

  18. CAT - A Disk Cataloging System for the CP/M Operating System.

    Science.gov (United States)

    1980-08-04

    MAC KM80 C02 sCQcwr *MAC MACROSO XC02 SCIN *MAC MACROSO XC02 SCIO, MAC M9CRO80 *C02 scLOIJT .*? AC M9LCRO80 XC02 44 CAT Interrupted 44 Chipter 5 -Page 6...7 A A088 167 ARMY SATELLITE COMMUNICATIONS AGENCY FORT MONMOUTH N.J F/S 9/2 CAT - A DISK CATALOGING SYSTEM FOR THE CP/ OPERATING SYSTEM.(U) UG 80...RECIPIENT’S CATALOG NUMBER 4. TITLE (and Subtitle) 5. TYPE OF REPORT & PERIOD COVERED S atsk Cat oging System for theP/M Final ..a.St. 6. PERFORMING ORG

  19. CONSERVATION PROCESS MODEL (CPM: A TWOFOLD SCIENTIFIC RESEARCH SCOPE IN THE INFORMATION MODELLING FOR CULTURAL HERITAGE

    Directory of Open Access Journals (Sweden)

    D. Fiorani

    2017-05-01

    Full Text Available The aim of the present research is to develop an instrument able to adequately support the conservation process by means of a twofold approach, based on both BIM environment and ontology formalisation. Although BIM has been successfully experimented within AEC (Architecture Engineering Construction field, it has showed many drawbacks for architectural heritage. To cope with unicity and more generally complexity of ancient buildings, applications so far developed have shown to poorly adapt BIM to conservation design with unsatisfactory results (Dore, Murphy 2013; Carrara 2014. In order to combine achievements reached within AEC through BIM environment (design control and management with an appropriate, semantically enriched and flexible The presented model has at its core a knowledge base developed through information ontologies and oriented around the formalization and computability of all the knowledge necessary for the full comprehension of the object of architectural heritage an its conservation. Such a knowledge representation is worked out upon conceptual categories defined above all within architectural criticism and conservation scope. The present paper aims at further extending the scope of conceptual modelling within cultural heritage conservation already formalized by the model. A special focus is directed on decay analysis and surfaces conservation project.

  20. PEMBUATAN SISTEM KONTROL MESIN CAULKING ROD GUIDE OTOMATIS MENGGUNAKAN PLC OMRON CPM1A

    Directory of Open Access Journals (Sweden)

    Syahril Ardi

    2015-02-01

    Full Text Available Kenaikan tingkat produksi shock absorber perusahaan manufaktur membuat proses produksi harus berjalan dengan baik . Pipa proses pemotongan pada mendempul panduan mesin batang memiliki beberapa masalah yang harus diatasi . Untuk mengatasi masalah tersebut kemudian melakukan modifikasi mesin batang mendempul yang secara otomatis dapat mengurangi waktu siklus pada proses mendempul batang dari 4,5 detik per potong sehingga tingkat produksi memotong garis pipa dapat ditingkatkan . Sistem kontrol otomatis mendempul mesin batang panduan ini dirancang untuk menggunakan Programmable Logic Controller (PLC

  1. MPA and CPM Curriculum: An Analysis of the Views of Public Administrators.

    Science.gov (United States)

    Rose, Bruce J.

    Views of state public administrators about management education and training needs were investigated, as were administrator views concerning short-term management development workshops. Data was drawn from responses to questionnaires mailed to 5,980 state administrators who were selected from a national survey and from random samples using lists…

  2. Design of Simplified Maximum-Likelihood Receivers for Multiuser CPM Systems

    Directory of Open Access Journals (Sweden)

    Li Bing

    2014-01-01

    Full Text Available A class of simplified maximum-likelihood receivers designed for continuous phase modulation based multiuser systems is proposed. The presented receiver is built upon a front end employing mismatched filters and a maximum-likelihood detector defined in a low-dimensional signal space. The performance of the proposed receivers is analyzed and compared to some existing receivers. Some schemes are designed to implement the proposed receivers and to reveal the roles of different system parameters. Analysis and numerical results show that the proposed receivers can approach the optimum multiuser receivers with significantly (even exponentially in some cases reduced complexity and marginal performance degradation.

  3. A PERT/CPM of the Computer Assisted Completion of The Ministry September Report. Research Report.

    Science.gov (United States)

    Feeney, J. D.

    Using two statistical analysis techniques (the Program Evaluation and Review Technique and the Critical Path Method), this study analyzed procedures for compiling the required yearly report of the Metropolitan Separate School Board (Catholic) of Toronto, Canada. The computer-assisted analysis organized the process of completing the report more…

  4. Nanodisc-Tm: Rapid functional assessment of nanodisc reconstituted membrane proteins by CPM assay.

    Science.gov (United States)

    Ashok, Yashwanth; Jaakola, Veli-Pekka

    2016-01-01

    Membrane proteins are generally unstable in detergents. Therefore, biochemical and biophysical studies of membrane proteins in lipidic environments provides a near native-like environment suitable for membrane proteins. However, manipulation of proteins embedded in lipid bilayer has remained difficult. Methods such as nanodiscs and lipid cubic phase have been developed for easy manipulation of membrane proteins and have yielded significant insights into membrane proteins. Traditionally functional reconstitution of receptors in nanodiscs has been studied with radioligands. We present a simple and faster method for studying the functionality of reconstituted membrane proteins for routine characterization of protein batches after initial optimization of suitable conditions using radioligands. The benefits of the method are •Faster and generic method to assess functional reconstitution of membrane proteins.•Adaptable in high throughput format (≥96 well format).•Stability measurement in near-native lipid environment and lipid dependent melting temperatures.

  5. Femtosecond Carrier Dynamics and Modelocking in Monolithic CPM Lasers. [SB1

    DEFF Research Database (Denmark)

    Brorson, S.D.; Bischoff, Svend; MØrk, J.

    1996-01-01

    Femtosecond pump-probe measurements of the dynamics in both forward- and reverse-biased semiconductor optical waveguides arepresented. Slow (nanosecond) as well as ultrafast (femtosecond) dynamics are observed in both kinds of structures....

  6. A NEW METHOD FOR CONSTRUCTING CONFIDENCE INTERVAL FOR CPM BASED ON FUZZY DATA

    Directory of Open Access Journals (Sweden)

    Bahram Sadeghpour Gildeh

    2011-06-01

    Full Text Available A measurement control system ensures that measuring equipment and measurement processes are fit for their intended use and its importance in achieving product quality objectives. In most real life applications, the observations are fuzzy. In some cases specification limits (SLs are not precise numbers and they are expressed in fuzzy terms, s o that the classical capability indices could not be applied. In this paper we obtain 100(1 - α% fuzzy confidence interval for C pm fuzzy process capability index, where instead of precise quality we have two membership functions for specification limits.

  7. Design of simplified maximum-likelihood receivers for multiuser CPM systems.

    Science.gov (United States)

    Bing, Li; Bai, Baoming

    2014-01-01

    A class of simplified maximum-likelihood receivers designed for continuous phase modulation based multiuser systems is proposed. The presented receiver is built upon a front end employing mismatched filters and a maximum-likelihood detector defined in a low-dimensional signal space. The performance of the proposed receivers is analyzed and compared to some existing receivers. Some schemes are designed to implement the proposed receivers and to reveal the roles of different system parameters. Analysis and numerical results show that the proposed receivers can approach the optimum multiuser receivers with significantly (even exponentially in some cases) reduced complexity and marginal performance degradation.

  8. Modelling and characterization of colliding-pulse mode-locked (CPM) quantum well lasers. [MPS1

    DEFF Research Database (Denmark)

    Bischoff, Svend; Brorson, S.D.; Franck, T.

    1996-01-01

    A theoretical and experimental study of passive colliding pulse mode-locked quantum well lasers is presented. The theoretical model for the gain dynamics is based on semi-classical density matrixequations. The gain dynamics are characterized exp...

  9. CPM scheduling : the Contracting Officers' Guide for risk minimization and claims analysis

    OpenAIRE

    Prather, Craig S.

    1998-01-01

    CIVINS (Civilian Institutions) Thesis document There are several hundred contract management related positions in the Navy's Civil Engineer Corps. Many junior and senior Contracting Officers and their representatives who serve in these positions have little to no experience with approving, monitoring and analyzing contractors' construction schedules. Typically, the contractor submits an initial schedule for approval, however, due to the lack of experience and knowledge, scheduling software...

  10. Status Survey of Bunkers 738A and 825A at Spangdahlem AB, Germany

    Science.gov (United States)

    2015-10-02

    cpm ), to activity in units of dpm...lnl’lt R~dvul. 1.500 V - 2% AANGE REFERENCE ".~S FOUND" CORRECT E) MUI.TI?t. ER CAl POINT READING READING :< 1000 400 CPM 400,000 CPM 400,0 0Q CPM ...1000 100 CPM 100.000 CPM 100,0 00 CPM X 100 400 CPM 40,0(•0 CPM 40,000 CPM )( 100 100 CPM 10 .0GO CPM 10 .000 CPM X 10 400 CPM 4 ,000

  11. Multi-wall cask advantages with quarter-scale model drop test results for the NAC-STC Storable Transport Cask

    International Nuclear Information System (INIS)

    Danner, T.A.; Thompson, T.C.; Yaksh, M.C.

    1993-01-01

    Physical drop test results for a quarter-scale model multi-wall cask are presented for the 9 meter end, side and oblique drops with impact limiters, and for the 1 meter side and closure lid pin puncture drops. Lessons learned and final cask test qualification are presented. (J.P.N.)

  12. Contributions to the validation of advanced codes for accident analysis calculations with 3-dimensional neutron kinetics. STC with the Ukraine. Final report

    International Nuclear Information System (INIS)

    Grundmann, U.; Kliem, S.; Rohde, U.; Khalimonchuk, V.; Kuchin, A.; Seidel, A.

    2000-10-01

    In the frame of a project of scientific-technical cooperation funded by BMBF/BMWi, the coupled code ATHLET-DYN3D has been transferred to the Scientific and Technical Centre on Nuclear and Radiation Safety Kiev (Ukraine). This program code represents an implementation of the 3D core model DYN3D developed by FZR into the GRS thermohydraulics code system ATHLET. For the purpose of validation of this coupled code, a measurement data base has been generated. In the data base suitable experimental data for operational transients from NPPs are collected. The data collection and documentation was performed in accordance with a directive about requirements to measurement data for code validation, which has been elaborated within the project. The validation calculations have been performed for two selected transients. The results of these calculations were compared with measurement values from the data base. The function of the code DYN3D was expanded with a subroutine for reactivity coefficients calculation. Using this modification of the code DYN3D, investigations of reactivity contributions on different operational processes can be performed. (orig.) [de

  13. Consideraciones en torno al status jurídico de los profesores de religión católica (comentario de la STC 38/2007

    Directory of Open Access Journals (Sweden)

    Agustín Motilla

    2011-03-01

    Full Text Available La sentenza è riportata per esteso in calce al commento. SUMARIO: 1. Antecedentes: el largo y tortuoso camino hacia la delimitación del status profesional - 2. Planteamiento del recurso de inconstitucionalidad - 3. Algunas cuestiones previas a la resolución del fondo - 4. La compatibilidad del régimen del profesorado de religión católica con la aconfesionalidad del Estado. -5. La revisión judicial del procedimiento de designación de los profesores de religión católica - 6. Limitaciones al derecho de libertad religiosa de las personas que trabajan como profesores de religión - 7. Consideraciones finales.

  14. USO DA FERRAMENTA PERT/CPM NO SERVIÇO DE MANUTENÇÃO DE EQUIPAMENTOS SUBMARINOS

    OpenAIRE

    Jéssica Siqueira de Almeida

    2014-01-01

    O petróleo é um recurso de grande valor econômico, pois é fonte de energia primária e um dos principais itens de exportação. A atividade de exploração e produção de petróleo atraiu muitas empresas que estão cada vez mais investindo em equipamentos de alta tecnologia e automação. Nesta perspectiva, máquinas e equipamentos de qualidade e de resposta rápida à superfície se tornaram imprescindíveis. Apesar do alto investimento, a inovação desses equipamentos é muito rentável para a...

  15. A MELHORIA DO PROCESSO PRODUTIVO EM UMA EMPRESA DE FAST FOOD ATRAVÉS DO PERT/CPM

    OpenAIRE

    Barreto, Eduardo Guimarães Lima; Santos, Roberta de Lourdes Silva dos; Menezes, Valeska Lisandra de; Silva, Ricardo Moreira da

    2010-01-01

    A principal característica de uma empresa de fast food está no consumo de alimentos que podem ser preparados e servidos em um pequeno intervalo de tempo. Empresas deste tipo se tornaram sinônimos de um estilo de vida acelerado desde o final do século XX, provocando mudança nos hábitos alimentares de boa parte dos brasileiros. Através de pesquisa qualitativa e de campo, este artigo analisa e propõe melhorias no processo produtivo em uma empresa de fast food localizada na cidade de João Pessoa-...

  16. Treatment of facial atrophic scars with Esthélis, a hyaluronic acid filler with polydense cohesive matrix (CPM).

    Science.gov (United States)

    Hasson, Ariel; Romero, William A

    2010-12-01

    The treatment of atrophic scars is difficult and dermal filler materials provide a simple alternative with immediate results. Esthélis® is an injectable non-animal crosslinked hyaluronic acid of Swiss origin characterized by a polydense cohesive matrix (CPM®) which produces a gel of uniform consistency with better biointegration to the tissues and a longer duration. To evaluate Esthélis in the treatment of atrophic scars. Twelve patients aged 18-56 years with facial atrophic scars caused by acne vulgaris, dog bite, piercing, basal cell carcinoma and leishmaniasis were treated with Esthélis. The injection technique was linear threading, serial puncture or a combination of both. Clinical efficacy was assessed independently by the authors and by patients immediately, one week and one month after the injection. Adverse events were registered. Authors described the results as moderate (27%), good (57%) and excellent (17%), immediately, one week and one month after the injection. Patients evaluated the cosmetic improvement as good (42%) or excellent (58%) one month after the treatment. Pain during the injection was described as slight or moderate. Only mild erythema was observed immediately after injection, which spontaneously resolved within few hours. Esthélis showed good or excellent results in most patients with atrophic scars, and these were perceived as even better when patients evaluated the cosmetic improvement. The best results were observed in patients with more deforming scars such as surgical scars or trauma.

  17. LD-pumped Nd:YVO sub 4 frequency-doubled by CPM LBO laser at 671 nm

    CERN Document Server

    Zheng Quan; Qian Long Sheng; Zhao Ling

    2001-01-01

    A design of LD-pumped high efficient Nd:YVO sub 4 /LBO red laser is reported. Using critical phase-matching LBO for the first time, 671 nm red laser is obtained by 1.342 mu m intracavity frequency doubling. With 800 mW incident pump laser, 52 mW and 97 mW TEM00 mode red laser output are obtained by II-typed and I-typed LBO. The optical-to-optical conversions are up to 6.5% and 12.1% respectively

  18. Stored Radioactive Material Landfill Site no. 7 (LF-7), Massachusetts Military Reservation, Cape Cod, MA

    Science.gov (United States)

    2013-03-07

    11 FIQI’i’Ut OOUC!JIC:C W(HIO ,U:I ICC~OIW. co:wtO artS Alii /IAT!OICAL GUI.:O a.u<:. liASSAOIUS:4’"T:’S W’l-iCO.l RE?I.Y TD ATTN OF1 102 FW/srr9...100 CPM j,DDO CPM /, [)C>D CPM X 1 400 CPM ~DD CPM 4bD CPM X 1 100 CPM /C’O CPM IOO CPM Log Scale 200 CPM i?-DD CPM 9-DO CPM DIGITAL SCALER READOUT

  19. Short-term capture of the Earth-Moon system

    Science.gov (United States)

    Qi, Yi; de Ruiter, Anton

    2018-06-01

    In this paper, the short-term capture (STC) of an asteroid in the Earth-Moon system is proposed and investigated. First, the space condition of STC is analysed and five subsets of the feasible region are defined and discussed. Then, the time condition of STC is studied by parameter scanning in the Sun-Earth-Moon-asteroid restricted four-body problem. Numerical results indicate that there is a clear association between the distributions of the time probability of STC and the five subsets. Next, the influence of the Jacobi constant on STC is examined using the space and time probabilities of STC. Combining the space and time probabilities of STC, we propose a STC index to evaluate the probability of STC comprehensively. Finally, three potential STC asteroids are found and analysed.

  20. A Rugged Ultra-Wideband (UWB) Circular Planar Monopole for Multichannel Radar

    Science.gov (United States)

    2016-03-01

    Introduction 1 2 Fundamental Design and Performance of a UWB- CPM 2 3 Introduction to the Vivaldi Antenna and Contrast to the UWB- CPM 3 4 Baseline UWB- CPM 7...5. First Revision of the UWB- CPM 12 6. Second Revision of the UWB- CPM 21 7. Second Revision UWB- CPM versus the Vivaldi 28 8. Summary and...return loss for the baseline UWB- CPM with and without a reflector ...........................................................................8 Fig. 6

  1. Stacking reactions of the borole complex Cp*Rh(η5-C4H4BPh) with the dicationic fragments [Cp*M]2+ (M = Rh or Ir)

    International Nuclear Information System (INIS)

    Loginov, D.A.; Muratov, D.V.; Starikova, Z.A.; Petrovskij, P.V.; Kudinov, A.R.

    2006-01-01

    The reaction of the (borole)rhodium iodide complex [(η-C 4 H 4 BPh)RhI] 4 with Cp*Li afforded the sandwich compound Cp*Rh(η-C 4 H 4 BPh) (1). The reactions of compound 1 with the solvated complexes [Cp*M(MeNO 2 ) 3 ] 2+ (BF 4 - ) 2 gave triple-decker cationic complexes with the central borole ligand [Cp*Rh(μ-η 5 :η 5 -C 4 H 4 BPh)MCp*] 2+ (BF 4 - ) 2 (M = Rh or Ir). The structure of complex 1 was established by X-ray diffraction [ru

  2. Laser Cladding of CPM Tool Steels on Hardened H13 Hot-Work Steel for Low-Cost High-Performance Automotive Tooling

    Science.gov (United States)

    Chen, J.; Xue, L.

    2012-06-01

    This paper summarizes our research on laser cladding of high-vanadium CPM® tool steels (3V, 9V, and 15V) onto the surfaces of low-cost hardened H13 hot-work tool steel to substantially enhance resistance against abrasive wear. The results provide great potential for fabricating high-performance automotive tooling (including molds and dies) at affordable cost. The microstructure and hardness development of the laser-clad tool steels so obtained are presented as well.

  3. Sodium-reduced continuous venovenous hemodiafiltration (CVVHDF) for the prevention of central pontine myelinolysis (CPM) in hyponatremic patients scheduled for orthotopic liver transplantation.

    Science.gov (United States)

    Lenk, Marcus R; Kaspar, Michael

    2012-08-01

    Two patients in end-stage hepatic failure presented for orthotopic liver transplantation with longstanding severe hyponatremia (121 and 122 mmol/L). Both patients underwent liver transplantation with the concomitant use of continuous venovenous hemodiafiltration. Replacement and dialysate solutions were prepared individually to contain a sodium level that was individually considered safe with regard to the development of central pontine myelinolysis. The sodium increase in both patients was within the expected and planned limits despite a situation of mass transfusion. Both patients did well postoperatively and neither patient suffered neurological deficits. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. Stanniocalcin-2 is a HIF-1 target gene that promotes cell proliferation in hypoxia

    Energy Technology Data Exchange (ETDEWEB)

    Law, Alice Y.S. [Department of Biology, Hong Kong Baptist University, Kowloon Tong (Hong Kong); Wong, Chris K.C., E-mail: ckcwong@hkbu.edu.hk [Department of Biology, Hong Kong Baptist University, Kowloon Tong (Hong Kong)

    2010-02-01

    Stanniocalcin-2 (STC2), the paralog of STC1, has been suggested as a novel target of oxidative stress response to protect cells from apoptosis. The expression of STC2 has been reported to be highly correlated with human cancer development. In this study, we reported that STC2 is a HIF-1 target gene and is involved in the regulation of cell proliferation. STC2 was shown to be up-regulated in different breast and ovarian cancer cells, following exposure to hypoxia. Using ovarian cancer cells (SKOV3), the underlying mechanism of HIF-1 mediated STC2 gene transactivation was characterized. Hypoxia-induced STC2 expression was found to be HIF-1{alpha} dependent and required the recruitment of p300 and HDAC7. Using STC2 promoter deletion constructs and site-directed mutagenesis, two authentic consensus HIF-1 binding sites were identified. Under hypoxic condition, the silencing of STC2 reduced while the overexpression of STC2 increased the levels of phosphorylated retinoblastoma and cyclin D in both SKOV3 and MCF7 cells. The change in cell cycle proteins correlated with the data of the serial cell counts. The results indicated that cell proliferation was reduced in STC2-silenced cells but was increased in STC2-overexpressing hypoxic cells. Solid tumor progression is usually associated with hypoxia. The identification and functional analysis of STC2 up-regulation by hypoxia, a feature of the tumor microenvironment, sheds light on a possible role for STC2 in tumors.

  5. SILICATE TECHNOLOGY CORPORATION'S SOLIDIFICATION/ STABILIZATION TECHNOLOGY FOR ORGANIC AND INORGANIC CONTAMINANTS IN SOILS - APPLICATIONS ANALYSIS REPORT

    Science.gov (United States)

    This Applications Analysis Report evaluates the solidification/stabilization treatment process of Silicate Technology Corporation (STC) for the on-site treatment of hazardous waste. The STC immobilization technology utilizes a proprietary product (FMS Silicate) to chemically stab...

  6. TECHNOLOGY EVALUATION REPORT: SILICATE TECHNOLOGY CORPORATION - SOLIDIFICATION/STABILIZATION OF PCP AND INORGANIC CONTAMINANTS IN SOILS - SELMA, CA

    Science.gov (United States)

    This Technolgy Evaluation Report evaluates the solidification/stabilization process of Silicate Technology Corporation (STC) for the on-site treatment of contaminated soil The STC immobilization technology uses a proprietary product (FMS Silicate) to chemically stabilize and ...

  7. 77 FR 16074 - Notice of Listening Sessions on Implementation of Unemployment Insurance Provisions of the Middle...

    Science.gov (United States)

    2012-03-19

    ... Department of Labor (Department) is interested in hearing from stakeholders on the following issues: Model... percent reimbursement of the amount of STC paid under a program meeting the new definition for an STC...' allowances, payable to the individual under State law. However, no payments may be made to a State for STC...

  8. 48 CFR 852.236-83 - Payments under fixed-price construction contracts (including NAS).

    Science.gov (United States)

    2010-10-01

    ... (CPM) network. (4) The CPM network shall include a separate cost loaded activity for adjusting and... shall show on the critical path method (CPM) network the total cost of the guarantee period services in... contracting officer. The activity on the CPM shall have money only and not activity time. (ii) The contractor...

  9. Data of evolutionary structure change: 1BS7A-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS7A-3CPMA 1BS7 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM... 3CPM A 3CPMA THR CA 223 GLY CA 250 ILE CA 233 3CPM... A 3CPMA IKKYSDKLVPF ILE CA 313 ARG CA 309 GLN CA 237 3CPM

  10. Data of evolutionary structure change: 1BS5A-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS5A-3CPMA 1BS5 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM...line> 3CPM A 3CPMA THR CA 218 GLY CA 252 ILE CA 234 3CPM... A 3CPMA IKKYSDKLVPFILE CA 320 ARG CA 317 GLN CA 243 3CPM

  11. Data of evolutionary structure change: 1DFFA-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DFFA-3CPMA 1DFF 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM...line> 3CPM A 3CPMA THR CA 218 GLY CA 249 ILE CA 245 3CPM... A 3CPMA IKKYSDKLVPFILE CA 305 ARG CA 316 GLN CA 241 3CPM

  12. Stanniocalcin-1 Potently Inhibits the Proteolytic Activity of the Metalloproteinase Pregnancy-associated Plasma Protein-A

    DEFF Research Database (Denmark)

    Kløverpris, Søren; Mikkelsen, Jakob Hauge; Pedersen, Josefine Hvidkjær

    2015-01-01

    regulation in these species. Several physiological functions of STC1 have been reported, although many molecular details are still lacking. We here demonstrate that STC1 is an inhibitor of the metzincin metalloproteinase, pregnancy-associated plasma protein-A (PAPP-A), which modulates insulin-like growth...... that the homologous STC2 inhibits PAPP-A proteolytic activity, and that this depends on the formation of a covalent complex between the inhibitor and the proteinase, mediated by Cys-120 of STC2. We find that STC1 is unable to bind covalently to PAPP-A, in agreement with the absence of a corresponding cysteine residue....... It rather binds to PAPP-A with high affinity (KD = 75 pm). We further demonstrate that both STC1 and STC2 show inhibitory activity toward PAPP-A2, but not selected serine proteinases and metalloproteinases. We therefore conclude that the STCs are proteinase inhibitors, probably restricted in specificity...

  13. Mapping of Carboxypeptidase M in Normal Human Kidney and Renal Cell Carcinoma

    Science.gov (United States)

    Denis, Catherine J.; Van Acker, Nathalie; De Schepper, Stefanie; De Bie, Martine; Andries, Luc; Fransen, Erik; Hendriks, Dirk; Kockx, Mark M.

    2013-01-01

    Although the kidney generally has been regarded as an excellent source of carboxypeptidase M (CPM), little is known about its renal-specific expression level and distribution. This study provides a detailed localization of CPM in healthy and diseased human kidneys. The results indicate a broad distribution of CPM along the renal tubular structures in the healthy kidney. CPM was identified at the parietal epithelium beneath the Bowman’s basement membrane and in glomerular mesangial cells. Capillaries, podocytes, and most interstitial cells were CPM negative. Tumor cells of renal cell carcinoma subtypes lose CPM expression upon dedifferentiation. Tissue microarray analysis demonstrated a correlation between low CPM expression and tumor cell type. CPM staining was intense on phagocytotic tumor-associated macrophages. Immunoreactive CPM was also detected in the tumor-associated vasculature. The absence of CPM in normal renal blood vessels points toward a role for CPM in angiogenesis. Coexistence of CPM and the epidermal growth factor receptor (EGFR) was detected in papillary renal cell carcinoma. However, the different subcellular localization of CPM and EGFR argues against an interaction between these h proteins. The description of the distribution of CPM in human kidney forms the foundation for further study of the (patho)physiological activities of CPM in the kidney. PMID:23172796

  14. Common Prairie feeds with different soluble and insoluble fractions used for CPM diet formulation in dairy cattle: Impact of carbohydrate-protein matrix structure on protein and other primary nutrient digestion

    Science.gov (United States)

    Peng, Quanhui; Wang, Zhisheng; Zhang, Xuewei; Yu, Peiqiang

    2014-03-01

    An experiment was conducted to investigate the relationship of carbohydrates molecular spectral characteristics to rumen degradability of primary nutrients in Prairie feeds in dairy cattle. In total, 12 different types of feeds were selected, each type of feed was from three different source with total 37 samples. Six types of them were energy-sourced feeds and the others were protein-sourced feeds. The carbohydrates molecular spectral intensity of various functional groups were collected using Fourier transform infrared attenuated total reflectance (ATR-FT/IR) spectroscopy. In the in situ study, the results showed that the rumen digestibility and digestible fractions of primary nutrients (DM, OM, NCP, and CP) were significantly different (P digestibility and digestible fractions of DM, OM and NCP. Spectral intensities of H_1150, H_1015, A_1, and A_3 were weakly negatively associated with in situ rumen degradation of CP. Spectral intensities of A_1240 and H_1240, mainly associated with cellulosic compounds, were correlated with rumen CP degradation. The multiple regression analysis demonstrated that the spectral intensities of A_3 and H_1415 played the most important role and could be used as a potential tool to predict rumen protein degradation of feeds in dairy cattle. In conclusion, this study showed that the carbohydrates as a whole have an effect on protein rumen degradation, rather than cellulose alone, indicating carbohydrate-protein matrix structure impact protein utilization in dairy cattle. The non-invasive molecular spectral technique (ATR-FT/IR) could be used as a rapid potential tool to predict rumen protein degradation of feedstuffs by using molecular spectral bands intensities in carbohydrate fingerprint region.

  15. Common Prairie feeds with different soluble and insoluble fractions used for CPM diet formulation in dairy cattle: impact of carbohydrate-protein matrix structure on protein and other primary nutrient digestion.

    Science.gov (United States)

    Peng, Quanhui; Wang, Zhisheng; Zhang, Xuewei; Yu, Peiqiang

    2014-01-01

    An experiment was conducted to investigate the relationship of carbohydrates molecular spectral characteristics to rumen degradability of primary nutrients in Prairie feeds in dairy cattle. In total, 12 different types of feeds were selected, each type of feed was from three different source with total 37 samples. Six types of them were energy-sourced feeds and the others were protein-sourced feeds. The carbohydrates molecular spectral intensity of various functional groups were collected using Fourier transform infrared attenuated total reflectance (ATR-FT/IR) spectroscopy. In the in situ study, the results showed that the rumen digestibility and digestible fractions of primary nutrients (DM, OM, NCP, and CP) were significantly different (P<0.05) among the feeds. The spectral bands features were significantly different (P<0.05) among the feeds. Spectral intensities of A_Cell, H_1415 and H_1370 were weakly positively correlated with in situ rumen digestibility and digestible fractions of DM, OM and NCP. Spectral intensities of H_1150, H_1015, A_1, and A_3 were weakly negatively associated with in situ rumen degradation of CP. Spectral intensities of A_1240 and H_1240, mainly associated with cellulosic compounds, were correlated with rumen CP degradation. The multiple regression analysis demonstrated that the spectral intensities of A_3 and H_1415 played the most important role and could be used as a potential tool to predict rumen protein degradation of feeds in dairy cattle. In conclusion, this study showed that the carbohydrates as a whole have an effect on protein rumen degradation, rather than cellulose alone, indicating carbohydrate-protein matrix structure impact protein utilization in dairy cattle. The non-invasive molecular spectral technique (ATR-FT/IR) could be used as a rapid potential tool to predict rumen protein degradation of feedstuffs by using molecular spectral bands intensities in carbohydrate fingerprint region. Copyright © 2013 Elsevier B.V. All rights reserved.

  16. Prospective Study of Surgical Decision-making Processes for Contralateral Prophylactic Mastectomy in Women With Breast Cancer.

    Science.gov (United States)

    Parker, Patricia A; Peterson, Susan K; Bedrosian, Isabelle; Crosby, Melissa A; Shen, Yu; Black, Dalliah M; Babiera, Gildy; Kuerer, Henry M; Ying, Jun; Dong, Wenli; Cantor, Scott B; Brewster, Abenaa M

    2016-01-01

    We prospectively examined the psychosocial predictors and the decision-making process regarding contralateral prophylactic mastectomy (CPM) among women with sporadic breast cancer. Increasing numbers of women with breast cancer are seeking CPM. Data are limited about the surgical decision-making process and the psychosocial factors that influence interest in CPM. Women with early-stage unilateral breast cancer (n = 117) were recruited before their first surgical visit at MD Anderson and completed questionnaires assessing knowledge of and interest in CPM and associated psychosocial factors. After the appointment, women and their surgeons completed questions about the extent that various surgical options (including CPM) were discussed; also, the women rated their perceived likelihood of having CPM and the surgeons rated the appropriateness of CPM. Before their first visit, 50% of women were moderately to extremely interested in CPM and 12 (10%) of women had CPM at the time of their primary breast cancer surgery. Less knowledge about breast cancer (P = 0.02) and greater cancer worry (P = 0.03) predicted interest in CPM. Greater cancer worry predicted who had CPM (P = 0.02). Interest in CPM before surgical visit and the likelihood of having CPM after the visit differed (P ≤ 0.001). Surgeons' rating of the appropriateness of CPM and the patient's reported likelihood of having CPM were not significantly different (P = 0.49). Interest in CPM is common among women with sporadic breast cancer. The informational and emotional aspects of CPM may affect the decision to have CPM and should be addressed when discussing surgical options.

  17. Hypoxic preconditioning induces neuroprotective stanniocalcin-1 in brain via IL-6 signaling

    DEFF Research Database (Denmark)

    Westberg, Johan A; Serlachius, Martina; Lankila, Petri

    2007-01-01

    BACKGROUND AND PURPOSE: Exposure of animals for a few hours to moderate hypoxia confers relative protection against subsequent ischemic brain damage. This phenomenon, known as hypoxic preconditioning, depends on new RNA and protein synthesis, but its molecular mechanisms are poorly understood...... originally reported expression of mammalian STC-1 in brain neurons and showed that STC-1 guards neurons against hypercalcemic and hypoxic damage. METHODS: We treated neural Paju cells with IL-6 and measured the induction of STC-1 mRNA. In addition, we quantified the effect of hypoxic preconditioning on Stc-1...... mRNA levels in brains of wild-type and IL-6 deficient mice. Furthermore, we monitored the Stc-1 response in brains of wild-type and transgenic mice, overexpressing IL-6 in the astroglia, before and after induced brain injury. RESULTS: Hypoxic preconditioning induced an upregulated expression of Stc...

  18. Effect of Sea Tangle ( and Charcoal Supplementation as Alternatives to Antibiotics on Growth Performance and Meat Quality of Ducks

    Directory of Open Access Journals (Sweden)

    M. M. Islam

    2014-02-01

    Full Text Available A total of 150 growing ducks were assigned to five dietary treatments to study the effect of sea tangle and charcoal (STC supplementation on growth performance and meat characteristics in a completely randomized design. There were six replicates and five ducklings in each replication. The five dietary treatments were control, antibiotic, and 0.1%, 0.5%, and 1% STC supplemented diets. No significant differences were found on ADG, ADFI, and gain:feed among treatments in different weeks. The overall (0 to 3 weeks ADFI decreased in antibiotic treatment (p<0.05 whereas the gain:feed increased significantly upon 1.0% STC supplementation compared to control (p<0.05. No significant variation was found in meat chemical composition except crude fat content which was high in 1.0% STC dietary group (p<0.05. Meat cholesterol was reduced in 0.1% STC group (p<0.05 compared to other dose levels while serum cholesterol was unaffected. High density lipoprotein (HDL content was high in 1.0% STC (p<0.05 and low density lipoprotein (LDL was low in 0.1% and 1.0% STC dietary groups (p = 0.06. No significant effect was found on the thiobarbituric acid reactive substances (TBARS of fresh meat, whereas the TBARS value of meat preserved for 1 week was reduced significantly in STC dietary groups (p<0.05. The 0.1% STC dietary group showed an increased myristic acid (p = 0.07 content whereas, the content of eicosapentaenoic (EPA and docosahexaenoic (DHA acids increased in STC supplementation than antibiotic group (p<0.05. An increased concentration of omega-3 fatty acids and a reduced ratio of n-6/n-3 PUFA ratio was found upon 1.0% STC supplementation compared to antibiotic dietary group (p<0.05. Therefore, 1.0% STC dietary supplementation can be used as alternatives to antibiotics in duck production.

  19. AcEST: BP913929 [AcEST

    Lifescience Database Archive (English)

    Full Text Available g OS=... 54 2e-15 sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 64 3e-10 sp|P53971|FAP...: 509 CREKCHEGPCPPCN 522 >sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanogaster GN=stc PE=1 S...e-20 tr|B6K130|B6K130_SCHJP Shuttle craft like transcriptional regula... 69 4e-20

  20. 75 FR 81643 - In the Matter of Certain Semiconductor Products Made by Advanced Lithography Techniques and...

    Science.gov (United States)

    2010-12-28

    ... Semiconductor Products Made by Advanced Lithography Techniques and Products Containing Same; Notice of... Mexico) (``STC''), alleging a violation of section 337 in the importation, sale for [[Page 81644

  1. Recombinant adeno-associated virus-delivered hypoxia-inducible stanniocalcin-1 expression effectively inhibits hypoxia-induced cell apoptosis in cardiomyocytes.

    Science.gov (United States)

    Shi, Xin; Wang, Jianzhong; Qin, Yan

    2014-12-01

    Ischemia/hypoxia-induced oxidative stress is detrimental for the survival of cardiomyocytes and cardiac function. Stanniocalcin-1 (STC-1), a glycoprotein, has been found to play an inhibitory role in the production of reactive oxygen species (ROS). Here, we speculated that the overexpression of STC-1 might alleviate oxidative damage in cardiomyocytes under conditions of hypoxia. To control the expression of STC-1 in hypoxia, we constructed a recombinant adeno-associated virus (AAV) carrying the hypoxia-responsive element (HRE) to mediate hypoxia induction. Cardiomyocytes were infected with AAV-HRE-STC-1 and cultured in normoxic or hypoxic conditions, and STC-1 overexpression was only detected in hypoxic cultured cardiomyocytes by using quantitative real-time polymerase chain reaction and Western blot analysis. Using the 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, AAV-HRE-STC-1 infection was shown to significantly enhance cell survival under hypoxia. Hypoxia-induced cell apoptosis was inhibited by AAV-HRE-STC-1 infection by using the Annexin V-fluorescein isothiocyanate (FITC)/propidium iodide apoptosis assay. Moreover, the proapoptotic protein Caspase-3 and anti-apoptotic protein Bcl-2, which were dysregulated by hypoxia, were reversed by AAV-HRE-STC-1 infection. AAV-HRE-STC-1-mediated STC-1 overexpression markedly inhibited ROS production in cardiomyocytes cultured under hypoxic conditions. AAV-HRE-STC-1 infection significantly upregulated uncoupled protein 3 (UCP3), whereas silencing of UCP3 blocked the inhibitory effect of AAV-HRE-STC-1 on ROS production. In contrast, AAV-HRE-STC-1 infection had no effect on UCP2, and knockdown of UCP2 did not block the inhibitory effect of AAV-HRE-STC-1 on ROS production in the cardiomyocytes cultured under hypoxic conditions. Taken together, STC1 activates antioxidant pathway in cardiomyocytes through the induction of UCP3, implying that AAV-HRE-STC-1 has potential in the treatment of ischemic

  2. The proteolytic activity of pregnancy-associated plasma protein-A is potentially regulated by stanniocalcin-1 and -2 during human ovarian follicle development

    DEFF Research Database (Denmark)

    Jepsen, Malene R.; Kløverpris, Søren; Bøtkjær, Jane A.

    2016-01-01

    STUDY QUESTION: Is the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) regulated by the stanniocalcins (STC1 and STC2) during human follicle maturation? SUMMARY ANSWER: The STCs and PAPP-A show similar expression by immunohistochemistry in developing follicles, and regulation...... of PAPP-A proteolytic activity is suggested by the identification of inhibited protein complexes between PAPP-A and STC1 or STC2 in human follicular fluid (FF). WHAT IS KNOWN ALREADY: The insulin-like growth factor (IGF)-regulating proteinase PAPP-A is secreted by the granulosa cells of estrogen...

  3. Stanniocalcin 2 promotes cell proliferation and cisplatin resistance in cervical cancer

    International Nuclear Information System (INIS)

    Wang, Yuxia; Gao, Ying; Cheng, Hairong; Yang, Guichun; Tan, Wenhua

    2015-01-01

    Cervical cancer is one of the most common carcinomas in the female reproductive system. Treatment of cervical cancer involves surgical removal and chemotherapy. Resistance to platinum-based chemotherapy drugs including cisplatin has increasingly become an important problem in the treatment of cervical cancer patients. We found in this study that stanniocalcin 2 (STC2) expression was upregulated in both cervical cancer tissues and cell lines. The levels of STC2 expression in cervical cancer cell lines were positively correlated with the rate of cell proliferation. Furthermore, in cisplatin resistant cervical cancer cells, the levels of STC2 expression were significantly elevated. Modulation of STC2 expression by siRNA or overexpression in cisplatin resistant cells resulted in altered cell survival, apoptosis, and cisplatin resistance. Finally, we found that there was significant difference in the activity of the MAPK signaling pathway between cisplatin sensitive and resistant cervical cancer cells, and that STC2 could regulate the activity of the MAPK signaling pathway. - Highlights: • STC2 was upregulated in cervical cancer and promoted cervical cancer cell proliferation. • Cisplatin resistant cells had elevated STC2 levels and enhanced proliferation. • STC2 regulated cisplatin chemosensitivity in cervical cancer cells. • STC2 regulated the activity of the MAPK signaling pathway.

  4. Multiple addresses: 201 S. LSD and 401 N. LSD, Lindsay Light Radiological Survey

    Science.gov (United States)

    The field gamma measurements beneath the removed pavement and within the excavated areas of theproject did not exceed the instrument threshold previously stated, and ranged from a minimum of 700cpm to a maximum of 4,500 cpm shielded.

  5. 75 FR 58014 - Pipeline Safety: Information Collection Activity; Request for Comments

    Science.gov (United States)

    2010-09-23

    ..., supports pipeline safety by ensuring the proper functioning of CPM leak detection systems. Affected Public...-phase hazardous liquid pipeline facilities that use computational pipeline monitoring (CPM) leak... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration [Docket No...

  6. Central Pontine Myelinolysis

    Science.gov (United States)

    ... Clinical Trials Organizations Publications Definition Central pontine myelinolysis (CPM) is a neurological disorder that most frequently occurs ... Experts estimate that 10 percent of those with CPM will also have areas of EPM. The initial ...

  7. 76 FR 18262 - January 2011 Pay Schedules

    Science.gov (United States)

    2011-04-01

    ... an OPM memorandum, CPM 2009-27. (See http://www.opm.gov/oca/compmemo/index.asp .) Executive Order... Schedule ($165,300 in 2011, the same level as in 2010). On December 27, 2010, OPM issued a memorandum (CPM...

  8. Techniques for Analysing Problems in Engineering Projects

    DEFF Research Database (Denmark)

    Thorsteinsson, Uffe

    1998-01-01

    Description of how CPM network can be used for analysing complex problems in engineering projects.......Description of how CPM network can be used for analysing complex problems in engineering projects....

  9. 75 FR 4592 - January 2010 Pay Adjustments

    Science.gov (United States)

    2010-01-28

    ... an OPM memorandum, CPM 2009-27. (See http://www.opm.gov/oca/compmemo/index.asp .) The Executive order... III of the Executive Schedule ($165,300 in 2010). On December 23, 2009, OPM issued a memorandum (CPM...

  10. Systemic Exercise-Induced Hypoalgesia Following Isometric Exercise Reduces Conditioned Pain Modulation

    DEFF Research Database (Denmark)

    Alsouhibani, Ali; Vaegter, Henrik Bjarke; Hoeger Bement, Marie

    2018-01-01

    Objective: Physically active individuals show greater conditioned pain modulation (CPM) compared with less active individuals. Understanding the effects of acute exercise on CPM may allow for a more targeted use of exercise in the management of pain. This study investigated the effects of acute...... isometric exercise on CPM. In addition, the between-session and within-session reliability of CPM was investigated. Design: Experimental, randomized crossover study. Setting: Laboratory at Marquette University. Subjects: Thirty healthy adults (19.3±1.5 years, 15 males). Methods: Subjects underwent CPM....... Results: PPTs increased during ice water immersion (i.e., CPM), and quadriceps PPT increased after exercise (P CPM decreased similarly following exercise and quiet rest (P > 0.05). CPM within-session reliability was fair to good (intraclass correlation coefficient [ICC] = 0...

  11. Waning of "conditioned pain modulation": a novel expression of subtle pronociception in migraine.

    Science.gov (United States)

    Nahman-Averbuch, Hadas; Granovsky, Yelena; Coghill, Robert C; Yarnitsky, David; Sprecher, Elliot; Weissman-Fogel, Irit

    2013-01-01

    To assess the decay of the conditioned pain modulation (CPM) response along repeated applications as a possible expression of subtle pronociception in migraine. One of the most explored mechanisms underlying the pain modulation system is "diffuse noxious inhibitory controls," which is measured psychophysically in the lab by the CPM paradigm. There are contradicting reports on CPM response in migraine, questioning whether migraineurs express pronociceptive pain modulation. Migraineurs (n = 26) and healthy controls (n = 35), all females, underwent 3 stimulation series, consisting of repeated (1) "test-stimulus" (Ts) alone that was given first followed by (2) parallel CPM application (CPM-parallel), and (3) sequential CPM application (CPM-sequential), in which the Ts is delivered during or following the conditioning-stimulus, respectively. In all series, the Ts repeated 4 times (0-3). In the CPM series, repetition "0" consisted of the Ts-alone that was followed by 3 repetitions of the Ts with a conditioning-stimulus application. Although there was no difference between migraineurs and controls for the first CPM response in each series, we found waning of CPM-parallel efficiency along the series for migraineurs (P = .005 for third vs first CPM), but not for controls. Further, greater CPM waning in the CPM-sequential series was correlated with less reported extent of pain reduction by episodic medication (r = 0.493, P = .028). Migraineurs have subtle deficits in endogenous pain modulation which requires a more challenging test protocol than the commonly used single CPM. Waning of CPM response seems to reveal this pronociceptive state. The clinical relevance of the CPM waning effect is highlighted by its association with clinical parameters of migraine. © 2013 American Headache Society.

  12. Consolidated Site (CS) 024 Verification Survey at Former McClellan AFB, Sacramento, California

    Science.gov (United States)

    2015-03-31

    than 26981 counts per minute ( cpm )]. Yellow dots correspond to data points between 2 and 3 SD above the mean (between 26988 and 28649 cpm ). Red...dots represent all data points above 3 SD (greater than 28650 cpm ). Survey personnel expect higher concentrations in areas marked in red. The color...collected for the trench was dirt. Consequently, the background counts observed in this location are different from the trench, approximately 6100 cpm

  13. 1-99 W. Hubbard St, May 2018, Lindsay Light Radiological Survey

    Science.gov (United States)

    Radiological Survey of Right-of-Way Utility Excavation.The count rates in the excavation ranged from 2,100 cpm to 4,200 cpm.No count rates were found at any time that exceeded the instrument specific threshold limits of 7,366 and 6,415 cpm.

  14. 76 FR 20651 - Application To Export Electric Energy; Cargill Power Markets, LLC

    Science.gov (United States)

    2011-04-13

    ... application. SUMMARY: Cargill Power Markets, LLC (CPM) has applied for authority to transmit electric energy... the FPA (16 U.S.C. 824a(e)). On March 22, 2011, DOE received an application from CPM for authority to... international transmission facilities. CPM does not own any electric transmission facilities nor does it hold a...

  15. 76 FR 19069 - Application to Export Electric Energy; Cargill Power Markets, LLC

    Science.gov (United States)

    2011-04-06

    ... application. SUMMARY: Cargill Power Markets, LLC (CPM) has applied to renew its authority to transmit electric... Order No. EA-209, which authorized CPM to transmit electric energy from the United States to Canada as a... CPM export authorization two additional times: On July 3, 2001 in Order No. EA-209-A and on May 31...

  16. Childhood physical maltreatment with physical injuries is associated with higher adult psychopathology symptoms.

    Science.gov (United States)

    Lamela, Diogo; Figueiredo, Bárbara

    2018-05-29

    Previous research has neglected the distinction between childhood physical maltreatment (CPM) behaviors and the physical sequelae resulting from CPM. Prior empirical work has combined CPM behaviors (e.g., beat, hit with a belt) and CPM physical sequelae (e.g., bruises, fractures) into a single conceptual category to predict adverse psychological consequences in adults. This is preventing the examination whether specific subgroups of CPM exposure may report a higher risk of psychopathology symptoms in adulthood. The aim of this study was to examine whether distinct experiences of CPM histories (no physical maltreatment, physical maltreatment only, and physical maltreatment with physical sequelae) would be differentially associated with specific psychopathology dimensions in adulthood. symptoms METHOD: Data were drawn from the Portuguese National Representative Study of Psychosocial Context of Child Abuse and Neglect (N = 941). Participants completed the Childhood History Questionnaire and the Brief Symptom Inventory. Three groups were created based on participants' experience of CPM assessed by the Childhood History Questionnaire. Participants who reported that suffered physical sequelae of the CPM exhibited significantly higher symptoms in all psychopathology dimensions than participants with no history of CPM and participants that were exposed to physical maltreatment without sequelae. These findings suggest that clinicians should discriminate CPM behavior from CPM physical sequelae in order to increase effectiveness of mental health treatment with adults with history of CPM. Our findings are discussed in light of the evolutionary-developmental frameworks of adaptative development and cumulative risk hypothesis. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  17. 76 FR 45710 - Pay in Nonforeign Areas

    Science.gov (United States)

    2011-08-01

    ... requirements in section 1915(b)(1). OPM explained this methodology in a memorandum (CPM 2009-27) issued on... December 27, 2010, OPM issued a memorandum (CPM 2010-23) that provided special rules for adjusting retained... described in CPM 2010-23 after the transition period. Those special adjustment rules were needed while...

  18. 76 FR 22091 - California Independent System, Operator Corporation; Supplemental Notice of Agenda and Discussion...

    Science.gov (United States)

    2011-04-20

    ... Corporation's (CAISO) Capacity Procurement Mechanism (CPM) compensation methodology and exceptional dispatch... conference is to provide Commission staff and interested parties an opportunity to discuss the CPM... (202) 502-6751. Dated: April 13, 2011. Kimberly D. Bose, Secretary. Agenda for the CAISO CPM...

  19. Remediation of cadmium-contaminated soil by extraction with para-sulphonato-thiacalix[4]arene, a novel supramolecular receptor

    International Nuclear Information System (INIS)

    Li Yushuang; Hu Xiaojun; Song Xueying; Sun Tieheng

    2012-01-01

    Batch extractions were conducted to evaluate the performance of para-sulphonato-thiacalix[4]arene (STC[4]A), a novel supramolecular receptor, for removing cadmium (Cd) from soil. The extraction mechanism was investigated by determination of the conditional stability constants (log K) of the STC[4]A-Cd complex. The influences of various variables were examined, including pH, contact time, and extractant concentration. The Cd extraction efficiency increased with increasing pH, reaching the maximum at pH 11 and then declining at higher pH values. This pH dependence was explained by the variation in the log K value of the STC[4]A-Cd complex along with pH change. When the STC[4]A dose was increased to an STC[4]A:Cd molar ratio of 2.5:1, Cd was exhaustively removed (up to 96.8%). The comparison experiment revealed that the Cd extraction performance of STC[4]A was almost equivalent to that of EDTA and significantly better than that of natural organic acids. STC[4]A extraction could efficiently prevent co-dissolution of soil minerals. - Highlights: ► First report on para-sulphonato-thiacalix[4]arene (STC[4]A) as extractant for soil washing. ► The Cd extraction performance of STC[4]A was almost equivalent to that of EDTA. ► STC[4]A extraction could efficiently avoid the dissolution of soil minerals, such as K, Ca, Mn. ► Extraction mechanism was investigated by determination of log K values of STC[4]A-Cd complex. ► A rational explanation for the pH dependence of extraction performance was given. - This is the first report on para-sulphonato-thiacalix[4]arene as an extractant for soil washing, which proved to be very efficient for Cd removal and could prevent co-dissolution of soil minerals.

  20. Contralateral prophylactic mastectomy: current perspectives

    Science.gov (United States)

    Yao, Katharine; Sisco, Mark; Bedrosian, Isabelle

    2016-01-01

    There has been an increasing trend in the use of contralateral prophylactic mastectomy (CPM) in the United States among women diagnosed with unilateral breast cancer, particularly young women. Approximately one-third of women CPM in the US. Most studies have shown that the CPM trend is mainly patient-driven, which reflects a changing environment for newly diagnosed breast cancer patients. The most common reason that women choose CPM is based on misperceptions about CPM’s effect on survival and overestimation of their contralateral breast cancer (CBC) risk. No prospective studies have shown survival benefit to CPM, and the CBC rate for most women is low at 10 years. Fear of recurrence is also a big driver of CPM decisions. Nonetheless, studies have shown that women are mostly satisfied with undergoing CPM, but complications and subsequent surgeries with reconstruction have been associated with dissatisfaction with CPM. Studies on surgeon’s perspectives on CPM are sparse but show that the most common reasons surgeons discuss CPM with patients is because of a suspicious family history or for a patient who is a confirmed BRCA mutation carrier. Studies on the cost–effectiveness of CPM have been conflicting and are highly dependent on patient’s quality of life after CPM. Most recent guidelines for CPM are contradictory. Future areas of research include the development of interventions to better inform patients about CPM, modification of the guidelines to form a more consistent statement, longer term studies on CBC risk and CPM’s effect on survival, and prospective studies that track the psychosocial effects of CPM on body image and sexuality. PMID:27382334

  1. Laparoscopic and open subtotal colectomies have similar short-term results

    NARCIS (Netherlands)

    Hoogenboom, Froukje J.; Bosker, Robbert J. I.; Groen, Henk; Meijerink, Wilhelmus J. H. J.; Lamme, Bas; Pierie, Jean Pierre E. N.

    2013-01-01

    Background: Laparoscopic subtotal colectomy (STC) is a complex procedure. It is possible that short-term benefits for segmental resections cannot be attributed to this complex procedure. This study aims to assess differences in shortterm results for laparoscopic versus open STC during a 15year

  2. Stanniocalcin 1 binds hemin through a partially conserved heme regulatory motif

    International Nuclear Information System (INIS)

    Westberg, Johan A.; Jiang, Ji; Andersson, Leif C.

    2011-01-01

    Highlights: → Stanniocalcin 1 (STC1) binds heme through novel heme binding motif. → Central iron atom of heme and cysteine-114 of STC1 are essential for binding. → STC1 binds Fe 2+ and Fe 3+ heme. → STC1 peptide prevents oxidative decay of heme. -- Abstract: Hemin (iron protoporphyrin IX) is a necessary component of many proteins, functioning either as a cofactor or an intracellular messenger. Hemoproteins have diverse functions, such as transportation of gases, gas detection, chemical catalysis and electron transfer. Stanniocalcin 1 (STC1) is a protein involved in respiratory responses of the cell but whose mechanism of action is still undetermined. We examined the ability of STC1 to bind hemin in both its reduced and oxidized states and located Cys 114 as the axial ligand of the central iron atom of hemin. The amino acid sequence differs from the established (Cys-Pro) heme regulatory motif (HRM) and therefore presents a novel heme binding motif (Cys-Ser). A STC1 peptide containing the heme binding sequence was able to inhibit both spontaneous and H 2 O 2 induced decay of hemin. Binding of hemin does not affect the mitochondrial localization of STC1.

  3. Comprehensive characterisation and analysis of PV module performance under real operating conditions

    NARCIS (Netherlands)

    Louwen, Atse; de Waal, Arjen C.; Schropp, Ruud E.I.; Faaij, André P.C.; van Sark, Wilfried G.J.H.M.

    2017-01-01

    The specifications of photovoltaic modules show performance under standard testing conditions (STC), but only limited information relating to performance at non-STC conditions. While performance is affected by irradiance, temperature, spectral composition of irradiance, angle-of-incidence of the

  4. Comprehensive characterisation and analysis of PV module performance under real operating conditions

    NARCIS (Netherlands)

    Louwen, Atse; de Waal, Arjen C.; Schropp, Ruud E I; Faaij, André P C; van Sark, Wilfried G J H M

    The specifications of photovoltaic modules show performance under standard testing conditions (STC), but only limited information relating to performance at non-STC conditions. While performance is affected by irradiance, temperature, spectral composition of irradiance, angle-of-incidence of the

  5. Rare and low-frequency coding variants alter human adult height

    DEFF Research Database (Denmark)

    Marouli, Eirini; Graff, Mariaelisa; Medina-Gomez, Carolina

    2017-01-01

    to 2 centimetres per allele (such as those in IHH, STC2, AR and CRISPLD2), greater than ten times the average effect of common variants. In functional follow-up studies, rare height-increasing alleles of STC2 (giving an increase of 1-2 centimetres per allele) compromised proteolytic inhibition of PAPP...

  6. The Demonstration of Short-Term Consolidation.

    Science.gov (United States)

    Jolicoeur, Pierre; Dell'Acqua, Roberto

    1998-01-01

    Results of seven experiments involving 112 college students or staff using a dual-task approach provide evidence that encoding information into short-term memory involves a distinct process termed short-term consolidation (STC). Results suggest that STC has limited capacity and that it requires central processing mechanisms. (SLD)

  7. Stanniocalcin 1 binds hemin through a partially conserved heme regulatory motif

    Energy Technology Data Exchange (ETDEWEB)

    Westberg, Johan A., E-mail: johan.westberg@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland); Jiang, Ji, E-mail: ji.jiang@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland); Andersson, Leif C., E-mail: leif.andersson@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland)

    2011-06-03

    Highlights: {yields} Stanniocalcin 1 (STC1) binds heme through novel heme binding motif. {yields} Central iron atom of heme and cysteine-114 of STC1 are essential for binding. {yields} STC1 binds Fe{sup 2+} and Fe{sup 3+} heme. {yields} STC1 peptide prevents oxidative decay of heme. -- Abstract: Hemin (iron protoporphyrin IX) is a necessary component of many proteins, functioning either as a cofactor or an intracellular messenger. Hemoproteins have diverse functions, such as transportation of gases, gas detection, chemical catalysis and electron transfer. Stanniocalcin 1 (STC1) is a protein involved in respiratory responses of the cell but whose mechanism of action is still undetermined. We examined the ability of STC1 to bind hemin in both its reduced and oxidized states and located Cys{sup 114} as the axial ligand of the central iron atom of hemin. The amino acid sequence differs from the established (Cys-Pro) heme regulatory motif (HRM) and therefore presents a novel heme binding motif (Cys-Ser). A STC1 peptide containing the heme binding sequence was able to inhibit both spontaneous and H{sub 2}O{sub 2} induced decay of hemin. Binding of hemin does not affect the mitochondrial localization of STC1.

  8. Strong Teens: A School-Based Small Group Experience for African American Males

    Science.gov (United States)

    White, Nathan J.; Rayle, Andrea Dixon

    2007-01-01

    This article describes the school-based, small group adaptation of the existing Strong Teens Curriculum (STC) for African American male adolescents in high schools. The STC was created to equip adolescents with skills that promote more effective social interaction and enhance personal emotional and psychological wellness. The authors present a…

  9. Stanniocalcin 1 effects on the renal gluconeogenesis pathway in rat and fish.

    Science.gov (United States)

    Schein, Vanessa; Kucharski, Luiz C; Guerreiro, Pedro M G; Martins, Tiago Leal; Morgado, Isabel; Power, Deborah M; Canario, Adelino V M; da Silva, Roselis S M

    2015-10-15

    The mammalian kidney contributes significantly to glucose homeostasis through gluconeogenesis. Considering that stanniocalcin 1 (STC1) regulates ATP production, is synthesized and acts in different cell types of the nephron, the present study hypothesized that STC1 may be implicated in the regulation of gluconeogenesis in the vertebrate kidney. Human STC1 strongly reduced gluconeogenesis from (14)C-glutamine in rat renal medulla (MD) slices but not in renal cortex (CX), nor from (14)C-lactic acid. Total PEPCK activity was markedly reduced by hSTC1 in MD but not in CX. Pck2 (mitochondrial PEPCK isoform) was down-regulated by hSTC1 in MD but not in CX. In fish (Dicentrarchus labrax) kidney slices, both STC1-A and -B isoforms decreased gluconeogenesis from (14)C-acid lactic, while STC1-A increased gluconeogenesis from (14)C-glutamine. Overall, our results demonstrate a role for STC1 in the control of glucose synthesis via renal gluconeogenesis in mammals and suggest that it may have a similar role in teleost fishes. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  10. 77 FR 48175 - Comment Request for Information Collection for Applications, Grants and Administration of Short...

    Science.gov (United States)

    2012-08-13

    ... Collection for Applications, Grants and Administration of Short Time Compensation (STC) Provisions, Extension... act'') contains Subtitle D, Short-Time Compensation Program, also known as the ``Layoff Prevention Act..., or wish to initiate a new program in, a layoff aversion program known as short time compensation (STC...

  11. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  12. AcEST: DK953656 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 34 0.61 sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Sch... 34 0.61 sp|P40798|STC_DROME Protein shuttle craft...D D ++ G S D+ E Sbjct: 352 TVTGTVIPKSSTVHEPPSSNDSHPLLQLFKDSKISDDDSPSN--AEGASTEDSKGE 405 >sp|P40798|STC_DROME Protein shuttle craft

  13. AcEST: BP919540 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 29 7.5 sp|A8QA10|ATP23_MALGO Mitochondrial inn...KEVHVFDVYEGEHMEEGKKSVAFSLQYL 772 >sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanogaster GN=st

  14. Algorithms and Architectures for Elastic-Wave Inversion Final Report CRADA No. TC02144.0

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lindtjorn, O. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-15

    This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Schlumberger Technology Corporation (STC), to perform a computational feasibility study that investigates hardware platforms and software algorithms applicable to STC for Reverse Time Migration (RTM) / Reverse Time Inversion (RTI) of 3-D seismic data.

  15. Best Practices in School-to-Careers: The Automotive Industry.

    Science.gov (United States)

    National Employer Leadership Council, Washington, DC.

    This document highlights the school-to-careers (STC) partnerships connecting workplace experiences to classroom learning to prepare students for successful employment in the automotive industry. First, the current state of the automotive industry is reviewed and the role of STC in addressing automotive service needs is explained. Next, the…

  16. 77 FR 67261 - Airworthiness Directives; Aeronautical Accessories, Inc., High Landing Gear Forward Crosstube...

    Science.gov (United States)

    2012-11-09

    ... based on a supplemental type certificate (STC). This AD requires counting and recording the total number... on an STC. That NPRM proposed to require creating a component history card or equivalent record and counting and recording the total number of landings for the crosstubes. It also proposed to require...

  17. 76 FR 20720 - Advisory Panel for Integrative Activities; Notice of Meeting

    Science.gov (United States)

    2011-04-13

    ... Foundation announces the following meeting: Name: Committee of Visitors Panel for the Experimental Program to Stimulate Competitive Research Science and Technology Centers (STC) 1373. Dates: May 16, 2011; 6 p.m.-8 p.m... materials. Agenda May 16, 2011 6 p.m.-8 p.m. Open Session; Welcome, overview of STC program. May 17, 2011 8...

  18. How Auditory Experience Differentially Influences the Function of Left and Right Superior Temporal Cortices.

    Science.gov (United States)

    Twomey, Tae; Waters, Dafydd; Price, Cathy J; Evans, Samuel; MacSweeney, Mairéad

    2017-09-27

    To investigate how hearing status, sign language experience, and task demands influence functional responses in the human superior temporal cortices (STC) we collected fMRI data from deaf and hearing participants (male and female), who either acquired sign language early or late in life. Our stimuli in all tasks were pictures of objects. We varied the linguistic and visuospatial processing demands in three different tasks that involved decisions about (1) the sublexical (phonological) structure of the British Sign Language (BSL) signs for the objects, (2) the semantic category of the objects, and (3) the physical features of the objects.Neuroimaging data revealed that in participants who were deaf from birth, STC showed increased activation during visual processing tasks. Importantly, this differed across hemispheres. Right STC was consistently activated regardless of the task whereas left STC was sensitive to task demands. Significant activation was detected in the left STC only for the BSL phonological task. This task, we argue, placed greater demands on visuospatial processing than the other two tasks. In hearing signers, enhanced activation was absent in both left and right STC during all three tasks. Lateralization analyses demonstrated that the effect of deafness was more task-dependent in the left than the right STC whereas it was more task-independent in the right than the left STC. These findings indicate how the absence of auditory input from birth leads to dissociable and altered functions of left and right STC in deaf participants. SIGNIFICANCE STATEMENT Those born deaf can offer unique insights into neuroplasticity, in particular in regions of superior temporal cortex (STC) that primarily respond to auditory input in hearing people. Here we demonstrate that in those deaf from birth the left and the right STC have altered and dissociable functions. The right STC was activated regardless of demands on visual processing. In contrast, the left STC was

  19. Endogenous analgesic effect of pregabalin: A double-blind and randomized controlled trial.

    Science.gov (United States)

    Sugimine, S; Saito, S; Araki, T; Yamamoto, K; Obata, H

    2017-07-01

    Conditioned pain modulation (CPM) is widely used to measure endogenous analgesia, and a recent study indicated that drugs that act on endogenous analgesia are more effective in individuals with lower CPM. Recent animal studies have indicated that pregabalin activates endogenous analgesia by stimulating the descending pain inhibitory system. The present study examined whether the analgesic effect of pregabalin is greater in individuals with lower original endogenous analgesia using CPM. Fifty-nine healthy subjects were randomly assigned to either a pregabalin group or a placebo group, and 50 of them completed the study. CPM was measured before and after pregabalin or placebo administration. The correlation of initial CPM to change in CPM was compared between the pregabalin and placebo groups. Initial CPM was significantly correlated with the change in CPM in the pregabalin group (r = -0.73, p CPM significantly affected the change in CPM in the pregabalin group but not in the placebo group (pregabalin group: adj R 2  = 0.51, p CPM) was stronger for subjects with lower original endogenous analgesia, suggesting that the mechanism of pregabalin involves the improvement of endogenous analgesia. © 2017 European Pain Federation - EFIC®.

  20. Análise da função manual na síndrome do túnel do carpo

    OpenAIRE

    Mattos, Daniela Junckes da Silva

    2010-01-01

    Este estudo investigou efeito da Síndrome do Túnel do Carpo (STC) na função manual. Foram analisados os parâmetros da força de preensão e suas associações com as características da STC, bem como o controle da força de preensão de indivíduos com STC em tarefas funcionais e o efeito causado pela fadiga e peso do objeto. Foram avaliadas 13 mulheres com STC (GE) e 13 sem STC (GC) com idade de 43,54 ± 7,70 e 43,23 ± 7,89 anos, respectivamente. O GE foi classificado quando à gravidade dos sintomas ...

  1. Status of international cooperation in nuclear technology on testing/research reactors between JAEA and INP-NNC

    International Nuclear Information System (INIS)

    Kawamura, Hiroshi; Tsuchiya, Kunihiko; Takemoto, Noriyuki; Kimura, Akihiro; Tanimoto, Masataka; Izumo, Hironobu; Chakrov, Petr; Gizatulin, Shamil; Chakrova, Yelena; Ludmila, Chkushuina; Asset, Shaimerdenov; Nataliya, Romanova

    2012-02-01

    Based on the implementing arrangement between National Nuclear Center of the Republic of Kazakhstan (NNC) and the Japan Atomic Energy Agency (JAEA) for 'Nuclear Technology on Testing/Research Reactors' in cooperation in Research and Development in Nuclear Energy and Technology, four specific topics of cooperation (STC) have been carried out from June, 2009. Four STCs are as follows; (1) STC No.II-1 : International Standard of Instrumentation. (2) STC No.II-2 : Irradiation Technology of RI Production. (3) STC No.II-3 : Lifetime Expansion of Beryllium Reflector. (4) STC No.II-4 : Irradiation Technology for NTD-Si. The information exchange, personal exchange and cooperation experiments are carried out under these STCs. The status in the field of nuclear technology on testing/research reactors in the implementing arrangement is summarized, and future plans of these specific topics of cooperation are described in this report. (author)

  2. Clinical Evolution of Central Pontine Myelinolysis in a Patient with Alcohol Withdrawal: A Blurred Clinical Horizon

    Directory of Open Access Journals (Sweden)

    Abdul S. Mohammed

    2016-01-01

    Full Text Available Central pontine myelinolysis (CPM, a potentially fatal and debilitating neurological condition, was first described in 1959 in a study on alcoholic and malnourished patients. It is a condition most frequently related to rapid correction of hyponatremia. Chronic alcoholism associated CPM tends to be benign with a favorable prognosis compared to CPM secondary to rapid correction of hyponatremia. We describe a normonatremic, alcoholic patient who presented with CPM after a rapid rise in his sodium levels. Our case illustrates the fact that CPM can manifest even in patients who are normonatremic at baseline. Rapid rises in sodium levels should be promptly reversed before clinical symptoms manifest in patient with risk factors for CPM irrespective of their baseline sodium levels. Furthermore, clinical evolution of CPM can be difficult to discern from the natural course of alcohol withdrawal delirium, requiring astuteness and maintenance of a high degree of clinical suspicion on the part of the physician.

  3. Sp1 is a transcription repressor to stanniocalcin-1 expression in TSA-treated human colon cancer cells, HT29.

    Science.gov (United States)

    Law, Alice Y S; Yeung, B H Y; Ching, L Y; Wong, Chris K C

    2011-08-01

    Our previous study demonstrated that, stanniocalcin-1 (STC1) was a target of histone deacetylase (HDAC) inhibitors and was involved in trichostatin A (TSA) induced apoptosis in the human colon cancer cells, HT29. In this study, we reported that the transcriptional factor, specificity protein 1 (Sp1) in association with retinoblastoma (Rb) repressed STC1 gene transcription in TSA-treated HT29 cells. Our data demonstrated that, a co-treatment of the cells with TSA and Sp1 inhibitor, mithramycin A (MTM) led to a marked synergistic induction of STC1 transcript levels, STC1 promoter (1 kb)-driven luciferase activity and an increase of apoptotic cell population. The knockdown of Sp1 gene expression in TSA treated cells, revealed the repressor role of Sp1 in STC1 transcription. Using a protein phosphatase inhibitor okadaic acid (OKA), an increase of Sp1 hyperphosphorylation and so a reduction of its transcriptional activity, led to a significant induction of STC1 gene expression. Chromatin immunoprecipitation (ChIP) assay revealed that Sp1 binding on STC1 proximal promoter in TSA treated cells. The binding of Sp1 to STC1 promoter was abolished by the co-treatment of MTM or OKA in TSA-treated cells. Re-ChIP assay illustrated that Sp1-mediated inhibition of STC1 transcription was associated with the recruitment of another repressor molecule, Rb. Collectively our findings identify STC1 is a downstream target of Sp1. Copyright © 2011 Wiley-Liss, Inc.

  4. Movement Discordance between Healthy and Non-Healthy US Adults.

    Directory of Open Access Journals (Sweden)

    Ann M Swartz

    Full Text Available Physical activity is known to significantly impact cardiometabolic health. Accelerometer data, as a measure of physical activity, can be used to objectively identify a disparity in movement (movement discordance between healthy and unhealthy adults. The purpose of this study was to examine the Movement Discordance between healthy and unhealthy adults in a large US population sample.Demographic, health and accelerometer data from the National Health and Nutrition Examination Study (NHANES 2003-2004 and 2005-2006 cohorts were used for this study. Participants were classified as either having a "normal" or "abnormal" value for each cardiometabolic health parameter examined, based on published criteria. Linear regression analyses were performed to determine significance of each abnormal health parameter (risk factor in its unique effect on the accelerometer counts, controlling for age and gender. Average accelerometer counts per minute (cpm by gender and age categories were estimated separately for the groups of normal and abnormal cardiometabolic risk.Average cpm for those with healthy levels of each individual cardiometabolic health parameter range from 296 cpm (for C reactive protein to 337 cpm (for waist circumference, while average cpm for those with abnormal levels of each individual cardiometabolic health parameter range from 216 cpm (for insulin to 291 cpm (for LDL-cholesterol. After controlling for age and gender, waist circumference, HbA1c, Insulin, Homocysteine, and HDL-Cholesterol were the cardiometabolic health parameters that showed significant, unique and independent effects on cpm. Overall, individuals who have abnormal values for all significant cardiometabolic health parameters ("unhealthy" averaged 267 cpm (SE = 15 cpm, while the healthy sample of this study averaged 428 cpm (SE = 10 cpm. The difference in cpm between the unhealthy and healthy groups is similar between males and females. Further, for both males and females, the

  5. Influence of Distance to Hospital and Insurance Status on the Rates of Contralateral Prophylactic Mastectomy, a National Cancer Data Base study.

    Science.gov (United States)

    Ward, Erin P; Unkart, Jonathan T; Bryant, Alex; Murphy, James; Blair, Sarah L

    2017-10-01

    We evaluated the impact of travel distance and insurance status on contralateral prophylactic mastectomy (CPM) rates in breast cancer. We queried the National Cancer Data Base (NCDB) for women >18 years of age with a nonmetastatic primary breast cancer of ductal, lobular, or mixed histology. Patient- and facility-specific CPM rates were calculated based on insurance, race, and distance to treatment center. Standard univariable and multivariable regression analysis was performed. Overall, the CPM rate was 6.5% for the 864,105 patients identified. Most patients traveled CPM. However, distance to the treatment center and insurance type had a greater absolute impact on rates of CPM for Black and Hispanic patients. Absolute CPM rate increases for patients >100 miles from a treatment center compared with those CPM rates. Increased travel distance is independently associated with increased rates of CPM for all patients and increased facility-specific rates of CPM. Black and Hispanic patients were found to be more vulnerable to the impact of travel distance and insurance status on rates of CPM.

  6. Age and gender differences in mechanically induced intraoral temporal summation and conditioned pain modulation in healthy subjects.

    Science.gov (United States)

    Khan, Junad; Korczeniewska, Olga; Benoliel, Rafael; Kalladka, Mythili; Eliav, Eli; Nasri-Heir, Cibelle

    2018-04-13

    The aim of this study was to investigate intraoral temporal summation (TS) and conditioned pain modulation (CPM) and compare the outcome with TS and CPM induced in the forearm. In addition, we aimed to study the effect of age and gender on intraoral and forearm TS and CPM. Mechanical stimulation was induced with # 5.46 von Frey filament applying 26 grams of force. A single stimulus, followed by a train of 30 successive stimuli, was applied intraorally and to the dominant forearm. CPM was assessed with the TS test as the painful stimulus and with immersion of the nondominant hand in a hot water bath as the conditioning stimulus. Gender was significantly associated with TS but not with CPM measures. Females had significantly lower mean TS measured in the face and in the dominant forearm compared with males. Age was significantly associated with CPM, but not with TS measures. In both sites examined, older patients had significantly lower mean CPM compared with younger patients. Mechanical TM elicited in the oral cavity can be used as test stimulus for CPM testing. Intraoral modulation, both TS and CPM, has an extent similar to that of the standard cutaneous extremity. TS was lower in females, and CPM was reduced with age. Copyright © 2018 Elsevier Inc. All rights reserved.

  7. Regulatory control of Chinese Proprietary Medicines in Singapore.

    Science.gov (United States)

    Yee, Shen-Kuan; Chu, Swee-Seng; Xu, Yi-Min; Choo, Peck-Lin

    2005-02-01

    In Singapore, there has been a growing public interest in traditional Chinese medicine (TCM), which plays an important role in the healthcare system. With effect from 1 September 1999, the control on Chinese Proprietary Medicines (CPM) was implemented in three phases over a span of 3 years. Under the CPM regulatory framework, CPM importers, wholesalers, manufacturers and re-packers must be licensed and CPM products assessed and listed by the health authority before they are allowed for sale. Product assessment is based on the criteria of safety and quality which include limits of toxic heavy metals and microbial contents. During the 3-year CPM listing exercise, irregularities were detected, including intrinsic toxicity, adulteration, substitution, contamination, misidentification, non-traditional and/or inappropriate usage, incorrect preparation, inappropriate labelling, exaggerated claims and/or advertising. The full implementation of CPM control by September 2001 saw the listing of 7943 CPM products and brought about an improvement in the quality and safety of CPM in Singapore as well as the removal of sub-standard, fake/imitation and adulterated products. The standards of practices by local CPM dealers have also been raised. These improvements have, in turn, increased the level of public confidence in CPM products in Singapore.

  8. Remediation of cadmium-contaminated soil by extraction with para-sulphonato-thiacalix[4]arene, a novel supramolecular receptor.

    Science.gov (United States)

    Li, Yushuang; Hu, Xiaojun; Song, Xueying; Sun, Tieheng

    2012-08-01

    Batch extractions were conducted to evaluate the performance of para-sulphonato-thiacalix[4]arene (STC[4]A), a novel supramolecular receptor, for removing cadmium (Cd) from soil. The extraction mechanism was investigated by determination of the conditional stability constants (log K) of the STC[4]A-Cd complex. The influences of various variables were examined, including pH, contact time, and extractant concentration. The Cd extraction efficiency increased with increasing pH, reaching the maximum at pH 11 and then declining at higher pH values. This pH dependence was explained by the variation in the log K value of the STC[4]A-Cd complex along with pH change. When the STC[4]A dose was increased to an STC[4]A:Cd molar ratio of 2.5:1, Cd was exhaustively removed (up to 96.8%). The comparison experiment revealed that the Cd extraction performance of STC[4]A was almost equivalent to that of EDTA and significantly better than that of natural organic acids. STC[4]A extraction could efficiently prevent co-dissolution of soil minerals. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. Synergistic effect of p53 on TSA-induced stanniocalcin 1 expression in human nasopharyngeal carcinoma cells, CNE2.

    Science.gov (United States)

    Ching, L Y; Yeung, Bonnie H Y; Wong, Chris K C

    2012-06-01

    Human stanniocalcin 1 (STC1) has recently been identified as a putative protein factor involved in cellular apoptosis. The use of histone deacetylase inhibitor (i.e. trichostatin A (TSA)) and doxorubicin (Dox) is one of the common treatment methods to induce apoptosis in human cancer cells. A study on TSA and Dox-mediated apoptosis may shed light on the regulation and function of STC1 in cancer treatment. In this study, TSA and Dox cotreatment in human nasopharyngeal carcinoma cells (CNE2) elicited synergistic effects on STC1 gene expression and cellular apoptosis. An activation of p53 (TP53) transcriptional activity in Dox- or Dox+TSA-treated cells was revealed by the increased expression levels of p53 mRNA/protein as well as p53-driven luciferase activities. To elucidate the possible involvement of p53 in STC1 gene transcription, a vector expressing wild-type or dominant negative (DN) p53 was transiently transfected into the cells. Both STC1 promoter luciferase constructs and chromatin immunoprecipitation assays did not support the direct role of p53 in STC1 gene transactivation. However, the synergistic effects of p53 on the induction of NF-κB phosphorylation and the recruitment of acetylated histone H3 in STC1 promoter were observed in TSA-cotreated cells. The overexpression of exogenous STC1 sensitized apoptosis in Dox-treated cells. Taken together, this study provides data to show the cross talk of NF-κB, p53, and histone protein in the regulation of STC1 expression and function.

  10. Establishing the functional connectivity of the frontotemporal network in pre-attentive change detection with Transcranial Magnetic Stimulation and event-related optical signal.

    Science.gov (United States)

    Tse, Chun-Yu; Long-Yin, Yip; Lui, Troby Ka-Yan; Xiao, Xue-Zhen; Wang, Yang; Chu, Winnie Chiu Wing; Parks, Nathan Allen; Chan, Sandra Sau-Man; Neggers, Sebastiaan Franciscus Wijnandus

    2018-06-18

    Current theories of pre-attentive deviant detection postulate that before the Superior Temporal Cortex (STC) detects a change, the Inferior Frontal Cortex (IFC) engages in stimulus analysis, which is particularly critical for ambiguous deviations (e.g., deviant preceded by a short train of standards). These theories rest on the assumption that IFC and STC are functionally connected, which has only been supported by correlational brain imaging studies. We examined this functional connectivity assumption by applying Transcranial Magnetic Stimulation (TMS) to disrupt IFC function, while measuring the later STC mismatch response with the event-related optical signal (EROS). EROS can localize brain activity in both spatial and temporal dimensions via measurement of optical property changes associated with neuronal activity, and is inert to the electromagnetic interference produced by TMS. Specifically, the STC mismatch response at 120-180 ms elicited by a deviant preceded by a short standard train when IFC TMS was applied at 80 ms was compared with the STC mismatch responses in temporal control (TMS with 200 ms delay), spatial control (sham TMS at vertex), auditory control (TMS pulse noise only), and cognitive control (deviant preceded by a long standard train) conditions. The STC mismatch response to deviants preceded by the short train was abolished by TMS of the IFC at 80 ms, while the STC responses remained intact in all other control conditions. These results confirm the involvement of the IFC in the STC mismatch response and support a functional connection between IFC and STC. Copyright © 2018. Published by Elsevier Inc.

  11. Stanniocalcin-1 regulates re-epithelialization in human keratinocytes.

    Directory of Open Access Journals (Sweden)

    Bonnie H Y Yeung

    Full Text Available Stanniocalcin-1 (STC1, a glycoprotein hormone, is believed to be involved in various biological processes such as inflammation, oxidative responses and cell migration. Riding on these emerging evidences, we hypothesized that STC1 may participate in the re-epithelialization during wound healing. Re-epithelialization is a critical step that involves keratinocyte lamellipodia (e-lam formation, followed by cell migration. In this study, staurosporine (STS treatment induced human keratinocyte (HaCaT e-lam formation on fibronectin matrix and migration via the activation of focal adhesion kinase (FAK, the surge of intracellular calcium level [Ca²⁺]i and the inactivation of Akt. In accompanied with these migratory features, a time- and dose-dependent increase in STC1 expression was detected. STC1 gene expression was found not the downstream target of FAK-signaling as illustrated by FAK inhibition using PF573228. The reduction of [Ca²⁺]i by BAPTA/AM blocked the STS-mediated keratinocyte migration and STC1 gene expression. Alternatively the increase of [Ca²⁺]i by ionomycin exerted promotional effect on STS-induced STC1 gene expression. The inhibition of Akt by SH6 and GSK3β by lithium chloride (LiCl could respectively induce and inhibit the STS-mediated e-lam formation, cell migration and STC1 gene expression. The STS-mediated e-lam formation and cell migration were notably hindered or induced respectively by STC1 knockdown or overexpression. This notion was further supported by the scratched wound assay. Collectively the findings provide the first evidence that STC1 promotes re-epithelialization in wound healing.

  12. Stanniocalcin-1 regulates re-epithelialization in human keratinocytes.

    Science.gov (United States)

    Yeung, Bonnie H Y; Wong, Chris K C

    2011-01-01

    Stanniocalcin-1 (STC1), a glycoprotein hormone, is believed to be involved in various biological processes such as inflammation, oxidative responses and cell migration. Riding on these emerging evidences, we hypothesized that STC1 may participate in the re-epithelialization during wound healing. Re-epithelialization is a critical step that involves keratinocyte lamellipodia (e-lam) formation, followed by cell migration. In this study, staurosporine (STS) treatment induced human keratinocyte (HaCaT) e-lam formation on fibronectin matrix and migration via the activation of focal adhesion kinase (FAK), the surge of intracellular calcium level [Ca²⁺]i and the inactivation of Akt. In accompanied with these migratory features, a time- and dose-dependent increase in STC1 expression was detected. STC1 gene expression was found not the downstream target of FAK-signaling as illustrated by FAK inhibition using PF573228. The reduction of [Ca²⁺]i by BAPTA/AM blocked the STS-mediated keratinocyte migration and STC1 gene expression. Alternatively the increase of [Ca²⁺]i by ionomycin exerted promotional effect on STS-induced STC1 gene expression. The inhibition of Akt by SH6 and GSK3β by lithium chloride (LiCl) could respectively induce and inhibit the STS-mediated e-lam formation, cell migration and STC1 gene expression. The STS-mediated e-lam formation and cell migration were notably hindered or induced respectively by STC1 knockdown or overexpression. This notion was further supported by the scratched wound assay. Collectively the findings provide the first evidence that STC1 promotes re-epithelialization in wound healing.

  13. Aflatoxin B1 and sterigmatocystin survey in beer sold in China.

    Science.gov (United States)

    Zhao, Yarong; Huang, Jianxiang; Ma, Liyan; Liu, Shuai; Wang, Fuhua

    2017-03-01

    A total of 101 samples of beer from the Chinese market were analysed for the presence of aflatoxin B 1 (AFB 1 ) and sterigmatocystin (STC), using methods based on liquid chromatography-tandem mass spectrometry. The limit of quantification and the limit of detection in beer were 0.1 and 0.03 µg/kg, respectively. Recoveries of AFB 1 and STC from spiked beer samples were 97.8-103.6% and 92.7-102.1%, respectively. None of the beer purchased samples were contaminated with AFB 1 or STC.

  14. Annotated trajectories and the Space-Time-Cube

    DEFF Research Database (Denmark)

    Kveladze, Irma; Kraak, Menno-Jan

    2012-01-01

    too, because these have not been adopted to the purpose. A suitable solution to display and study movements is the Space-Time-Cube (STC), the graphic representation of Hägerstrand’s Time Geography. This paper answers the question of how suitable the STC is to display the above describe combination...... of trajectories and annotations to avoid the visual clutter. Although the STC will be described here as a stand-alone solution it is part of a wider geovisual analytics environment and is used next to maps and other graphics to be able to answer user questions. As a case study data set the travel log data...

  15. Analog design of wireless control for home equipment

    Science.gov (United States)

    Zheng, Shiyong; Li, Zhao; Li, Biqing; Jiang, Suping

    2018-04-01

    This design consists of a STC89C52 microcontroller, a serial Bluetooth module and the Android system. Production of STC89C52 controlled by single-chip computer telephone systems. The system is composed of mobile phone Android system as a master in the family centre,via serial Bluetooth module pass instructions and information to implement wireless transceiver using STC89C52 MCU wireless Bluetooth transmission to control homedevices. System high reliability, low cost easy to use, stong applicability and other characerristics, can be used in single-user family, has great significance.

  16. Design of smart home terminal controller based on ZigBee

    Science.gov (United States)

    Li, Biqing; Li, Zhao; Zhang, Hongyan

    2018-04-01

    With the development in scienc and technology, and the improvement of living conditions, people pay more and more attention to the comfort of household life. Therefore, smart home has become the development trend of the future furniture. This design is composed of three blocks: transmitting module, receiving module and data acquisition module. ZigBee and STC89C52 belong to launch module as well as belong to receive module. Launch module contains ZigBee, serial communication module and monolithic STC89C52. The receiving module contains light control parts, curtain control part, ZigBee and microcontroller STC89C52. Data acquisition module includes temperature and humidity detection.

  17. Uma comparação da aplicabilidade do PERT/CPM com o método de corrente crítica no gerenciamento de projetos de construção de linhas de distribuição de energia elétrica

    OpenAIRE

    Lima, Patricia Meira Ribeiro de

    2013-01-01

    Nos últimos anos muito se tem falado a respeito de gerenciamento de projetos e de como as suas contribuições são importantes para as organizações que buscam excelência e efetividade em seus empreendimentos. Segundo o Project Management Institute (PMI), é estimado que 25% do PIB mundial estejam destinados a projetos, caracterizando cada vez mais o reconhecimento e a importância dessa metodologia e aumentando a sua difusão. As organizações que adotam essa metodologia de gerenciamento buscam van...

  18. DNA based identification of medicinal materials in Chinese patent medicines

    Science.gov (United States)

    Chen, Rong; Dong, Juan; Cui, Xin; Wang, Wei; Yasmeen, Afshan; Deng, Yun; Zeng, Xiaomao; Tang, Zhuo

    2012-12-01

    Chinese patent medicines (CPM) are highly processed and easy to use Traditional Chinese Medicine (TCM). The market for CPM in China alone is tens of billions US dollars annually and some of the CPM are also used as dietary supplements for health augmentation in the western countries. But concerns continue to be raised about the legality, safety and efficacy of many popular CPM. Here we report a pioneer work of applying molecular biotechnology to the identification of CPM, particularly well refined oral liquids and injections. What's more, this PCR based method can also be developed to an easy to use and cost-effective visual chip by taking advantage of G-quadruplex based Hybridization Chain Reaction. This study demonstrates that DNA identification of specific Medicinal materials is an efficient and cost-effective way to audit highly processed CPM and will assist in monitoring their quality and legality.

  19. Pain modulatory phenotypes differentiate subgroups with different clinical and experimental pain sensitivity

    DEFF Research Database (Denmark)

    Vaegter, Henrik B.; Graven-Nielsen, Thomas

    2016-01-01

    between subgroups. Cuff algometry was performed on lower legs in 400 chronic pain patients to assess pressure pain threshold (cPPT), pressure pain tolerance (cPTT), temporal summation of pain (TSP: increase in pain scores to ten repeated stimulations), and conditioned pain modulation (CPM: increase in c......PPT during cuff pain conditioning on the contralateral leg). Heat detection (HDT) and heat pain thresholds (HPT) at clinical painful and non-painful body areas were assessed. Based on TSP and CPM four distinct groups were formed: Group 1 (n=85) had impaired CPM and facilitated TSP. Group 2 (n=148) had...... impaired CPM and normal TSP. Group 3 (n=45) had normal CPM and facilitated TSP. Group 4 (n=122) had normal CPM and normal TSP. Group 1 showed more pain regions compared with the other three groups (PCPM and facilitated TSP plays an important role in widespread pain. Group 1...

  20. Characteristics of proportional counters used in X-ray radiometric analysis

    International Nuclear Information System (INIS)

    Mamikonyan, S.V.; Martishchenko, L.G.; Mel'ttser, L.V.

    1972-01-01

    Counters with extended (up to 10 cm 2 ) apertres have been described and the results obtained are presented. CPM-15 and CPM-16 counters are intended for sensoring and spectral analysis of X-rays in the range of 2.5 to 23 and 2.5 to 15 keV, respectively. The only difference is in the gas composition. The CPM-15 counter is filled with 90 per cent xenon plus 10 per cent methane used as a quenching dopant. The CPM-16 is filled with 90 per cent argon and 10 per cent methane. The life time is 10 10 pulses at 1800 V for CPM-16 and at 2200 V for CPM-15

  1. Exercise does not produce hypoalgesia when performed immediately after a painful stimulus

    DEFF Research Database (Denmark)

    Gajsar, Hannah; Nahrwold, Katharina; Titze, Christina

    2018-01-01

    Exercise-induced hypoalgesia (EIH) and conditioned pain modulation (CPM) are assumed to reflect descending pain inhibition. Potential interactions between EIH and CPM may be important in the therapy of chronic pain, as reduced CPM and increased pain after exercise are frequently observed....... This study compared the EIH response after CPM was activated using a cold pressor task with the EIH response after a control condition. Thirty-one participants (age: 27.7±9.8; 15 female) completed two sessions: a cold pressor task (CPT) session, i.e. testing EIH with preceding CPM activation induced using......, back and leg were used to determine the effects of exercise after the cold pressor test and control condition. Furthermore, correlations between CPM and EIH, in the CPT session as well as control session, were calculated at each assessment site. A significant time x condition interaction (F(1, 30...

  2. Predicting women's intentions for contralateral prophylactic mastectomy: An application of an extended theory of planned behaviour.

    Science.gov (United States)

    Richards, Imogen; Tesson, Stephanie; Porter, David; Phillips, Kelly-Anne; Rankin, Nicole; Musiello, Toni; Marven, Michelle; Butow, Phyllis

    2016-04-01

    Most women with unilateral breast cancer (BC) without BRCA1/2 gene mutations are at low risk of contralateral breast cancer (CBC). One CBC risk-management option is contralateral prophylactic mastectomy (CPM). While there is no evidence that CPM increases life-expectancy, its uptake is increasing. This study aimed to assess the validity of an extended social-cognition model, the Theory of Planned Behaviour (TPB), in predicting women's intentions to undergo CPM. Four hundred women previously treated for BC completed an online survey exploring demographic and disease factors, attitude, subjective norm, perceived behavioural control, anticipated regret, uncertainty avoidance, self-efficacy to not have CPM and intentions to undergo CPM in a common hypothetical decision-making scenario. The TPB uniquely explained 25.7% of intention variance. Greater anticipated regret, uncertainty avoidance and lower self-efficacy to cope with not having CPM were associated with stronger CPM intentions, explaining an additional 7.7%, 10.6% and 2.9% respectively, of variance over and above the TPB. Women who had undergone CPM, had not attended university, and had children reported stronger CPM intentions. A holistic understanding of CPM decision-making appears to require consideration beyond CBC risk, demographics and disease characteristics, exploring women's expectations about CPM outcomes, others' opinions, and avoidance of emotionality and difficulties associated with not undergoing surgery. This study provides a theoretical basis from which the complexity of CPM decision-making may be understood, and from which resources for patients and treating staff may be developed to support women's informed decision-making aligning with their personal values. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. A psychophysical study of endogenous analgesia: the role of the conditioning pain in the induction and magnitude of conditioned pain modulation.

    Science.gov (United States)

    Nir, Rony-Reuven; Granovsky, Yelena; Yarnitsky, David; Sprecher, Elliot; Granot, Michal

    2011-05-01

    Endogenous analgesia (EA) can be examined experimentally using a conditioned pain modulation (CPM) paradigm. While noxious conditioning stimulation intensities (CSIs) are mainly used, it has not been fully investigated in the same experimental design whether the experienced conditioning pain level affects CPM responses. The principal goal of the present study was to characterize CPM induction and magnitudes evoked by various conditioning pain levels. Furthermore, we explored associations between conditioning pain reports and CPM responses across various CSIs. Thirty healthy, young, right-handed males were tested with a parallel CPM paradigm. Three different CSIs (hand water-immersion) induced mild, moderate and intense pain levels, rated 12.41 ± 7.85, 31.57 ± 9.56 and 58.1 ± 11.43, respectively (0-100 numerical pain scale) (P < 0.0001). Contact-heat 'test-stimulus' levels were compared before and during conditioning. Within the group, (i) CPM was induced only by the moderate and intense CSIs (Ps ≤ 0.001); (ii) no difference was demonstrated between the magnitudes of these CPM responses. Regression analysis revealed that CPM induction was independent of the perceived conditioning pain level, but associated with the absolute CSI (P < 0.0001). Conditioning pain levels were correlated across all CSIs, as were CPM magnitudes (Ps ≤ 0.01). We conclude that among males, (i) once a CPM response is evoked by a required conditioning pain experience, its magnitude is not further affected by increasing conditioning pain and (ii) CPM magnitudes are inter-correlated, but unrelated to conditioning pain reports. These observations may suggest that CPM responses represent an intrinsic element of an individual's EA processes, which are not significantly affected by the experienced conditioning pain. Copyright © 2010 European Federation of International Association for the Study of Pain Chapters. Published by Elsevier Ltd. All rights reserved.

  4. Physical Activity May Be Associated with Conditioned Pain Modulation in Women but Not Men among Healthy Individuals

    OpenAIRE

    Shiro, Yukiko; Ikemoto, Tatsunori; Terasawa, Yuta; Arai, Young-Chang P.; Hayashi, Kazuhiro; Ushida, Takahiro; Matsubara, Takako

    2017-01-01

    Background. Conditioned pain modulation (CPM), a phenomenon also known as diffuse noxious inhibitory control, is thought to be affected by various factors, including sex and level of physical activity. However, the involvement of these factors in CPM remains unclear. Methods. Eighty-six healthy young subjects (M/F, 43/43) participated in this study. Participants were assessed on the basis of their mechanical pressure pain threshold (PPT), CPM response, body mass index (BMI), basal metabolic r...

  5. Physical maltreatment of children with autism in Henan province in China: A cross-sectional study.

    Science.gov (United States)

    Duan, Guiqin; Chen, Jingqi; Zhang, Wenjing; Yu, Buyi; Jin, Yanqin; Wang, Yazhe; Yao, Meiling

    2015-10-01

    The aim of this study was to investigate the frequency of child physical maltreatment (CPM) in children with autism aged 2-5 years in Henan province (China), and to explore the risk factors for severe CPM in these children. This cross-sectional study was performed at the Psychology Clinic of the Third Affiliated Hospital of Zhengzhou University between September 2012 and September 2013 with 180 parents of children with autism. Children and parents had no history of any cognitive therapy. The childhood autism rating scale (CARS) was used to evaluate the severity of autism in children. Data on parental CPM during the past 3 months were collected from parental self-reporting. Logistic regression was used to investigate the risk factors of severe CPM. CPM was self-reported by 88% of the parents of children with autism. One hundred and fifty four of these cases were in the minor CPM group (86%) and 64 in the severe CPM group (36%). Most cases of severe CPM were unlikely to have caused injury. Univariate analyses showed that child's age (p=.018), age started to speak (p=.043) and CARS score (p=.048) were associated with severe CPM. Child's age (p=.011) and CARS score (p=.041) were independently associated with severe CPM. The risk of severe CPM increased with age and CARS score. Our findings showed that CPM is widespread in families of children with autism in Central China and more knowledge should be provided to parents of children with autism, particularly in cases of severe autism (those with high CARS scores). Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Chlropyrifos-methyl shows anti-androgenic activity without estrogenic activity in rats

    International Nuclear Information System (INIS)

    Kang, Hwan Goo; Jeong, Sang Hee; Cho, Joon Hyoung; Kim, Dong Gyu; Park, Jong Myung; Cho, Myung Haing

    2004-01-01

    Chlorpyrifos-methyl (CPM), an organophosphate insecticide, widely used for grain storage and agriculture, has been suspected as endocrine disrupter by a few in vitro studies. This study was performed to investigate the (anti-) estrogenicity and (anti-) androgenicity of CPM in vivo using immature rat uterotrophic assay and rat Hershberger assay. CPM with or without 17β-estradiol were administered to 20 days old female rats to investigate its (anti-) estrogenic activity. Uterine and vaginal weight, uterine epithelial cell height were not affected by the treatment of CPM (2, 10, 50, 250 mg/kg). CPM 250 mg/kg potentiated relative vagina weight in 17β-estradiol treated immature female rats without any changing of uterine weight. Relative liver weight was increased with decrease of body weight by CPM 250 mg/kg treatment. Uterine cell proliferation tested with bromodeoxyuridine labeling index was not observed in CPM treated rats. CPM with or without testosterone propionate were administered to castrated rat of 51 days old for 10 days to investigate the (anti-)androgenic activity,. The weight of relative and absolute androgen-dependent accessory sex organs; seminal vesicle with coagulating glands (SV/CG), ventral prostate gland (VP), glans penis (GP), levator ani plus bulbocarvernosus muscle (LABC) and Cowper's gland (CG,) were unchanged by the treatment of CPM alone. While CPM induced the increase of relative adrenal gland weight, CPM 50 mg/kg decreased the weights of CV/CG, VP, CG and LABC without change of GP without changing of GP when it was treated with TP. In conclusion, CPM dose not show estrogenic and anti-estrogenic activity in immature female rats, but it represents anti-androgenic activity by inhibition of the TP-stimulated increase of the weight of accessory sex organs

  7. Systemic Exercise-Induced Hypoalgesia Following Isometric Exercise Reduces Conditioned Pain Modulation.

    Science.gov (United States)

    Alsouhibani, Ali; Vaegter, Henrik Bjarke; Hoeger Bement, Marie

    2018-04-03

    Physically active individuals show greater conditioned pain modulation (CPM) compared with less active individuals. Understanding the effects of acute exercise on CPM may allow for a more targeted use of exercise in the management of pain. This study investigated the effects of acute isometric exercise on CPM. In addition, the between-session and within-session reliability of CPM was investigated. Experimental, randomized crossover study. Laboratory at Marquette University. Thirty healthy adults (19.3±1.5 years, 15 males). Subjects underwent CPM testing before and after isometric exercise (knee extension, 30% maximum voluntary contraction for three minutes) and quiet rest in two separate experimental sessions. Pressure pain thresholds (PPTs) at the quadriceps and upper trapezius muscles were assessed before, during, and after ice water immersions. PPTs increased during ice water immersion (i.e., CPM), and quadriceps PPT increased after exercise (P CPM decreased similarly following exercise and quiet rest (P > 0.05). CPM within-session reliability was fair to good (intraclass correlation coefficient [ICC] = 0.43-0.70), and the between-session reliability was poor (ICC = 0.20-0.35). Due to the variability in the systemic exercise-induced hypoalgesia (EIH) response, participants were divided into systemic EIH responders (N = 9) and nonresponders (N = 21). EIH responders experienced attenuated CPM following exercise (P = 0.03), whereas the nonresponders showed no significant change (P > 0.05). Isometric exercise decreased CPM in individuals who reported systemic EIH, suggesting activation of shared mechanisms between CPM and systemic EIH responses. These results may improve the understanding of increased pain after exercise in patients with chronic pain and potentially attenuated CPM.

  8. Rapid Discrimination of Chlorpheniramine Maleate and Assessment of Its Surface Content Uniformity in a Pharmaceutical Formulation by NIR-CI Coupled with Statistical Measurement

    Directory of Open Access Journals (Sweden)

    Luwei Zhou

    2014-01-01

    Full Text Available This study demonstrated that near infrared chemical imaging (NIR-CI was a rapid and nondestructive technique for discrimination of chlorpheniramine maleate (CPM and assessment of its surface content uniformity (SCU in a pharmaceutical formulation. The characteristic wavenumber method was used for discriminating CPM distribution on the tablet surface. To assess the surface content uniformity of CPM, binary image and statistical measurement were proposed. Furthermore, high-performance liquid chromatography (HPLC was used as reference method for accurately determining volume content of CPM in the sample. Moreover, HPLC was performed to assess volume content uniformity (VCU of CPM in whole region and part region of the tablets. The NIR-CI result showed that the spatial distribution of CPM was heterogeneous on the tablet surface. Through the comparison of content uniformity of CPM determined by NIR-CI and HPLC, respectively, it demonstrated that a high degree of VCU did not imply a high degree of SCU of the samples. These results indicate that HPLC method is not suitable for testing SCU, and this has been verified by NIR-CI. This study proves the feasibility of NIR-CI for rapid discrimination of CPM and assessment of its SCU, which is helpful for the quality control of commercial CPM tablets.

  9. Psychophysical testing of spatial and temporal dimensions of endogenous analgesia: conditioned pain modulation and offset analgesia.

    Science.gov (United States)

    Honigman, Liat; Yarnitsky, David; Sprecher, Elliot; Weissman-Fogel, Irit

    2013-08-01

    The endogenous analgesia (EA) system is psychophysically evaluated using various paradigms, including conditioned pain modulation (CPM) and offset analgesia (OA) testing, respectively, the spatial and temporal filtering processes of noxious information. Though both paradigms assess the function of the EA system, it is still unknown whether they reflect the same aspects of EA and consequently whether they provide additive or equivalent data. Twenty-nine healthy volunteers (15 males) underwent 5 trials of different stimulation conditions in random order including: (1) the classic OA three-temperature stimulus train ('OA'); (2) a three-temperature stimulus train as control for the OA ('OAcon'); (3) a constant temperature stimulus ('constant'); (4) the classic parallel CPM ('CPM'); and (5) a combination of OA and CPM ('OA + CPM'). We found that in males, the pain reduction during the OA + CPM condition was greater than during the OA (P = 0.003) and CPM (P = 0.07) conditions. Furthermore, a correlation was found between OA and CPM (r = 0.62, P = 0.01) at the time of maximum OA effect. The additive effect found suggests that the two paradigms represent at least partially different aspects of EA. The moderate association between the CPM and OA magnitudes indicates, on the other hand, some commonality of their underlying mechanisms.

  10. Women's preferences for contralateral prophylactic mastectomy: An investigation using protection motivation theory.

    Science.gov (United States)

    Tesson, Stephanie; Richards, Imogen; Porter, David; Phillips, Kelly-Anne; Rankin, Nicole; Musiello, Toni; Marven, Michelle; Butow, Phyllis

    2016-05-01

    Most women diagnosed with unilateral breast cancer without BRCA1 or BRCA2 mutations are at low risk of contralateral breast cancer. Contralateral Prophylactic Mastectomy (CPM) decreases the relative risk of contralateral breast cancer, but may not increase life expectancy; yet international uptake is increasing. This study applied protection motivation theory (PMT) to determine factors associated with women's intentions to undergo CPM. Three hundred eighty-eight women previously diagnosed with unilateral breast cancer and of negative or unknown BRCA1 or BRCA2 status were recruited from an advocacy group's research database. Participants completed measures of PMT constructs based on a common hypothetical CPM decision-making scenario. PMT constructs explained 16% of variance in intentions to undergo CPM. Response efficacy (CPM's advantages) and response costs (CPM's disadvantages) were unique individual predictors of intentions. Decision-making appears driven by considerations of the psychological, cosmetic and emotional advantages and disadvantages of CPM. Overestimations of threat to life from contralateral breast cancer and survival benefit from CPM also appear influential factors. Patients require balanced and medically accurate information regarding the pros and cons of CPM, survival rates, and recurrence risks to ensure realistic and informed decision-making.

  11. Application of electron and Bremsstrahlung beams for composite materials processing

    International Nuclear Information System (INIS)

    Zalyubovsky, I.I.; Avilov, A.M.; Popov, G.F.; Rudychev, V.G.

    1998-01-01

    In Kharkiv University the radiation process of obtaining composite polymer materials, CPM, with high strength properties and corrosion resistance was studied. CPM are manufactured by vacuum impregnating capillary-porous materials with synthetic monomers and oligomers or by molding granular waste and resins which are further treated by relativistic electron or Bremsstrahlung beam. Such radiation treatment yields new CPM in which capillary-porous structure acting as reinforcement is filled with polymer. The results of the applied research with industrial electron accelerator in the field of thick CPM formation are presented

  12. Conditioning pain stimulation does not affect itch induced by intra-epidermal histamine pricks but aggravates neurogenic inflammation in healthy volunteers

    DEFF Research Database (Denmark)

    Andersen, Hjalte Holm; Imai, Yosuke; Petersen, Kristian Kjær

    2016-01-01

    This study investigated whether itch induced by intra-epidermal histamine is subjected to modulation by a standardized conditioned pain modulation (CPM) paradigm in 24 healthy volunteers. CPM was induced by computer-controlled cuff pressure algometry and histamine was introduced to the volar...... forearm by skin prick test punctures. Moreover, neurogenic inflammation and wheal reactions induced by histamine and autonomic nervous system responses (heart rate variability and skin conductance) were monitored. CPM did not modulate the intensity of histamine-induced itch suggesting that pruriceptive...... signaling is not inhibited by pain-recruited endogenous modulation, however, CPM was found to aggravate histamine-induced neurogenic inflammation, likely facilitated by efferent sympathetic fibers....

  13. Surgical Management of Metastatic Colorectal Cancer: A Single-Centre Experience on Oncological Outcomes of Pulmonary Resection vs Cytoreductive Surgery and HIPEC.

    Science.gov (United States)

    Wong, Evelyn Yi Ting; Tan, Grace Hwei Ching; Ng, Deanna Wan Jie; Koh, Tina Puay Theng; Kumar, Mrinal; Teo, Melissa Ching Ching

    2017-12-01

    Metastasectomy is accepted as standard of care for selected patients with colorectal pulmonary metastases (CLM); however, the role of cytoreductive surgery (CRS) and hyperthermic intraperitoneal chemotherapy (HIPEC) for colorectal peritoneal metastases (CPM) is not universally accepted. We aim to compare oncological outcomes of patients with CLM and CPM after pulmonary resection and CRS-HIPEC, respectively, by comparing overall survival (OS) and disease-free survival (DFS). A retrospective review of 49 CLM patients who underwent pulmonary resection, and 52 CPM patients who underwent CRS-HIPEC in a single institution from January 2003 to March 2015, was performed. The 5-year OS for CLM patients and CPM patients were 59.6 and 40.5%, respectively (p = 0.100), while the 5-year DFS were 24.0 and 14.2%, respectively (p = 0.173). CPM patients had longer median operative time (8.38 vs. 1.75 h, p CPM patients by multivariate analysis. There were no independent prognostic factors for DFS in CLM patients by multivariate analysis, but peritoneal cancer index score, bladder involvement, and higher nodal stage at presentation of the initial malignancy were independent prognostic factors for DFS in CPM patients. OS and DFS for CPM patients after CRS and HIPEC are comparable to CLM patients after lung resection, although morbidity appears higher. The prognostic factors affecting survival after surgery are different between CPM and CLM patients and must be considered when selecting patients for metastasectomy.

  14. Fixed or adapted conditioning intensity for repeated conditioned pain modulation.

    Science.gov (United States)

    Hoegh, M; Petersen, K K; Graven-Nielsen, T

    2017-12-29

    Aims Conditioned pain modulation (CPM) is used to assess descending pain modulation through a test stimulation (TS) and a conditioning stimulation (CS). Due to potential carry-over effects, sequential CPM paradigms might alter the intensity of the CS, which potentially can alter the CPM-effect. This study aimed to investigate the difference between a fixed and adaptive CS intensity on CPM-effect. Methods On the dominant leg of 20 healthy subjects the cuff pressure detection threshold (PDT) was recorded as TS and the pain tolerance threshold (PTT) was assessed on the non-dominant leg for estimating the CS. The difference in PDT before and during CS defined the CPM-effect. The CPM-effect was assessed four times using a CS with intensities of 70% of baseline PTT (fixed) or 70% of PTT measured throughout the session (adaptive). Pain intensity of the conditioning stimulus was assessed on a numeric rating scale (NRS). Data were analyzed with repeated-measures ANOVA. Results No difference was found comparing the four PDTs assessed before CSs for the fixed and the adaptive paradigms. The CS pressure intensity for the adaptive paradigm was increasing during the four repeated assessments (P CPM-effect was higher using the fixed condition compared with the adaptive condition (P CPM paradigms using a fixed conditioning stimulus produced an increased CPM-effect compared with adaptive and increasing conditioning intensities.

  15. Consolidated Site (CS) 022 Verification Survey at Former McClellan AFB, Sacramento, California

    Science.gov (United States)

    2015-03-31

    green dots represent all measured activity points below 1.5 standard deviations (SD) above the mean value [less than 26568 counts per minute ( cpm ...Yellow dots correspond to data points between 0.5 and 1.5 SD above the mean (between 26569 and 29972 cpm ). Orange dots correspond to data points...between 1.5 and 2.5 SD above the mean (between 29973 and 33377 cpm ). Red dots represent all data points above 2.5 SD (greater than 33378 cpm

  16. Alloactivated HLA class II-positive T-cell lines induce IL-2 reactivity but lack accessory cell function in mixed leukocyte culture

    DEFF Research Database (Denmark)

    Odum, N; Dickmeiss, E; Hofmann, B

    1989-01-01

    in the primary mixed leukocyte reaction (median counts per minute (cpm) 5.5 x 10(3] was significantly lower than that of peripheral blood mononuclear cells (cpm: 44.0 x 10(3]. The stimulation by Ta was almost only seen when the Ta were specifically directed against the class II antigens of the responder...... peripheral blood mononuclear cells (i.e., in combinations with "backstimulation") (median cpm: 21,000). In mixed leukocyte reaction combinations without backstimulation, significantly weaker reactions were seen (median cpm: 1,000). This observation may explain previous controversies concerning...

  17. Project management and administration of research and development

    International Nuclear Information System (INIS)

    Kim, Guk; Lee, Sang Bok; Eom, Ju Tae; An, Ha Eil

    1997-07-01

    This book mentions project and project management with project from production system of view, history of project management, writing way of network with definition and symbol of network, principle for drawing of network, draw up of network, I-J network and PDM network, general conception of PERT/CPM on definition of PERT, definition of CPM, comparison of PERT/CPM, discussion of PERT/CPM, WBS, work order and network, PDM calculation, cost management, reduction of construction time, R and D such as operation and R and D and analysis on R and D, system explanation of Nex-Pert.

  18. Magnetic resonance imaging of sequelae of central pontine myelinolysis in chronic alcohol abusers

    Energy Technology Data Exchange (ETDEWEB)

    Uchino, Akira; Kudo, Sho [Department of Radiology, Saga Medical School, 5-1-1 Nabeshima, 849-8501, Saga (Japan); Yuzuriha, Takefumi; Murakami, Masaru; Endoh, Koichi; Hiejima, Shigeto; Koga, Hiroshi [Center for Emotional and Behavional Disorders, Hizen National Hospital, 160 Mitsu, Higashisefuri, Kanzaki, 842-0192, Saga (Japan)

    2003-12-01

    Central pontine myelinolysis (CPM) is one of the serious neurological complications of alcoholism. This study evaluated magnetic resonance images of sequelae of CPM. Approximately 600 alcoholic patients were examined by a 1.0-T magnetic resonance imaging device, and 11 patients were retrospectively found to have a central pontine lesion, a presumed sequela of CPM. The lesions had various shapes and most were cavitary. In 3 of the 11 patients bilateral symmetrical oval lesions were faintly visible in the middle cerebellar peduncles. These middle cerebellar peduncular lesions were diagnosed as having Wallerian degeneration of the pontocerebellar tract secondary to CPM. (orig.)

  19. Social Network, Surgeon, and Media Influence on the Decision to Undergo Contralateral Prophylactic Mastectomy.

    Science.gov (United States)

    Venetis, Maria K; MacGeorge, Erina L; Baptiste, Dadrie F; Mouton, Ashton; Friley, Lorin B; Pastor, Rebekah; Hatten, Kristen; Lagoo, Janaka; Bowling, Monet W; Clare, Susan E

    2018-06-01

    The rate of contralateral prophylactic mastectomy (CPM) has risen sharply in the past decade. The current study was designed to examine social network, surgeon, and media influence on patients' CPM decision-making, examining not only who influenced the decision, and to what extent, but also the type of influence exerted. Patients (N=113) who underwent CPM at 4 Indiana University-affiliated hospitals between 2008 and 2012 completed structured telephone interviews in 2013. Questions addressed the involvement and influence of the social network (family, friends, and nonsurgeon health professionals), surgeon, and media on the CPM decision. Spouses, children, family, friends, and health professionals were reported as exerting a meaningful degree of influence on patients' decisions, largely in ways that were positive or neutral toward CPM. Most surgeons were regarded as providing options rather than encouraging or discouraging CPM. Media influence was present, but limited. Patients who choose CPM do so with influence and support from members of their social networks. Reversing the increasing choice of CPM will require educating these influential others, which can be accomplished by encouraging patients to include them in clinical consultations, and by providing patients with educational materials that can be shared with their social networks. Surgeons need to be perceived as having an opinion, specifically that CPM should be reserved for those patients for whom it is medically indicated.

  20. Feasibility Demonstration of a Multi-Cylinder Stirling Convertor with a Duplex Linear Alternator, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Stirling Technology Company (STC) proposes to integrate an existing Multi-Cylinder Free-Piston Stirling Engine (MPFPSE) with innovative compact linear alternators....

  1. Investigation of the mechanism of soft tissue conduction explains several perplexing auditory phenomena.

    Science.gov (United States)

    Adelman, Cahtia; Chordekar, Shai; Perez, Ronen; Sohmer, Haim

    2014-09-01

    Soft tissue conduction (STC) is a recently expounded mode of auditory stimulation in which the clinical bone vibrator delivers auditory frequency vibratory stimuli to skin sites on the head, neck, and thorax. Investigation of the mechanism of STC stimulation has served as a platform for the elucidation of the mechanics of cochlear activation, in general, and to a better understanding of several perplexing auditory phenomena. This review demonstrates that it is likely that the cochlear hair cells can be directly activated at low sound intensities by the fluid pressures initiated in the cochlea; that the fetus in utero, completely enveloped in amniotic fluid, hears by STC; that a speaker hears his/her own voice by air conduction and by STC; and that pulsatile tinnitus is likely due to pulsatile turbulent blood flow producing fluid pressures that reach the cochlea through the soft tissues.

  2. Spatiotemporal correlation of optical coherence tomography in-vivo images of rabbit airway for the diagnosis of edema

    Science.gov (United States)

    Kang, DongYel; Wang, Alex; Volgger, Veronika; Chen, Zhongping; Wong, Brian J. F.

    2015-07-01

    Detection of an early stage of subglottic edema is vital for airway management and prevention of stenosis, a life-threatening condition in critically ill neonates. As an observer for the task of diagnosing edema in vivo, we investigated spatiotemporal correlation (STC) of full-range optical coherence tomography (OCT) images acquired in the rabbit airway with experimentally simulated edema. Operating the STC observer on OCT images generates STC coefficients as test statistics for the statistical decision task. Resulting from this, the receiver operating characteristic (ROC) curves for the diagnosis of airway edema with full-range OCT in-vivo images were extracted and areas under ROC curves were calculated. These statistically quantified results demonstrated the potential clinical feasibility of the STC method as a means to identify early airway edema.

  3. Long-term performance potential of concentrated photovoltaic (CPV) systems

    KAUST Repository

    Burhan, Muhammad; Shahzad, Muhammad Wakil; Ng, Kim Choon

    2017-01-01

    estimation of a large PV field, the long term performance as electrical output is a more rational approach over the conventional testing methods, such as at Standard Testing Conditions (STC) and at the Nominal Operating Cell Temperature (NOCT) available

  4. Adaptive Space–Time Coding Using ARQ

    KAUST Repository

    Makki, Behrooz; Svensson, Tommy; Eriksson, Thomas; Alouini, Mohamed-Slim

    2015-01-01

    We study the energy-limited outage probability of the block space-time coding (STC)-based systems utilizing automatic repeat request (ARQ) feedback and adaptive power allocation. Taking the ARQ feedback costs into account, we derive closed

  5. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-03-15

    Mar 15, 2017 ... 53. ORIGINAL ARTICLE. Predictors of Hospitalization among Children on ART in Ethiopia: a .... Technology Commission (STC) the now renamed as Ministry of Science ..... The effect of highly active antiretroviral therapy on the ...

  6. Narrative of the annotated Space–Time Cube – revisiting a historical event

    DEFF Research Database (Denmark)

    Kraak, Menno-Jan; Kveladze, Irma

    2017-01-01

    The Space–Time Cube (STC) is a suitable representation to display multiple characteristics of movement data and will especially reveal temporal patterns in the data. By adding annotations to the cube’s paths and stations, the narrative of the display is enhanced. To illustrate the STC’s storytell......The Space–Time Cube (STC) is a suitable representation to display multiple characteristics of movement data and will especially reveal temporal patterns in the data. By adding annotations to the cube’s paths and stations, the narrative of the display is enhanced. To illustrate the STC......’s storytelling capabilities, a historical event, Napoleon’s crossing of the Berezina River during his Russian campaign in 1812 is presented and linked to an event in 2012 when the authors made a similar trip. Also, a set of different visual queries and their results are presented, emphasizing the STC...... as an alternative addition to a more extended visualization environment....

  7. Evaluación económica de una engorda de toretes en dos sistemas de alimentación

    Directory of Open Access Journals (Sweden)

    José Manuel González Pérez

    2016-01-01

    Full Text Available Se evaluó económicamente la en - gorda de toretes en dos sistemas de alimenta - ción: uno bajo el sistema silvopastoril intensivo ( ssp i y otro bajo un sistema tradicional de confinamiento ( stc . Se usaron 78 toretes, divi - didos equitativamente en los ssp i y stc , en Apa - tzingán, Michoacán, México. Para la evaluación se utilizaron los indicadores del van , la tir , el prc , y la r = b / c . Los indicadores económicos obtenidos para el ssp i fueron positivos y para el stc resultaron negativos. Se observó que no fue rentable la engorda de toretes en el trópico Michoacano bajo el stc ; sin embargo, fue viable económicamente bajo un ssp i.

  8. Stanniocalcin-1 Protects a Mouse Model from Renal Ischemia-Reperfusion Injury by Affecting ROS-Mediated Multiple Signaling Pathways.

    Science.gov (United States)

    Liu, Dajun; Shang, Huiping; Liu, Ying

    2016-07-12

    Stanniocalcin-1 (STC-1) protects against renal ischemia-reperfusion injury (RIRI). However, the molecular mechanisms remain widely unknown. STC-1 inhibits reactive oxygen species (ROS), whereas most ROS-mediated pathways are associated with ischemic injury. Therefore, to explore the mechanism, the effects of STC-1 on ROS-medicated pathways were studied. Non-traumatic vascular clamps were used to establish RIRI mouse models. The serum levels of STC-1, interleukin-6 (IL-6), interferon (IFN) γ, P53, and capase-3 were measured by ELISA kits. Superoxide dismutase (SOD) and malondialdehyde (MDA) were measured by fluorescence spectrofluorometer. All these molecules changed significantly in a RIRI model mouse when compared with those in a sham control. Kidney cells were isolated from sham and model mice. STC-1 was overexpressed or knockout in these kidney cells. The molecules in ROS-medicated pathways were measured by real-time quantitative PCR and Western blot. The results showed that STC-1 is an effective ROS scavenger. The serum levels of STC-1, MDA and SOD activity were increased while the serum levels of IL-6, iIFN-γ, P53, and capase-3 were decreased in a model group when compared with a sham control (p ROS-mediated molecules. Therefore, STC-1 maybe improve anti-inflammation, anti-oxidant and anti-apoptosis activities by affecting ROS-mediated pathways, especially the phospho-modifications of the respective proteins, resulting in the increase of SOD and reduce of capase-3, p53, IL-6 and IFN-γ.

  9. The ESO Scientific and Technical Committee.

    Science.gov (United States)

    Léna, P.

    1982-03-01

    Since 1978, the structure of ESO involves a Scientific and Technical Committee (STC) which advises the Council on scientific and technical matters. This committee meets twice a year, usually at Garehing; its members are nominated by the Council and their term is 4 years. The STC has 10 members, who are as evenly distributed as possible among member countries, although indeed mainly chosen for their scientific abilities. The chairman is invited to attend Council meetings and to report to the members.

  10. AcEST: DK952414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CPKELPCGHRCKEMCHPGECPFNCNQKVKLRCPCKRIKKELQCNK 813 >sp|P40798|STC_DROME Protein shuttle craft...in 1... 190 4e-48 sp|Q6ZNB6|NFXL1_HUMAN NF-X1-type zinc finger protein NFXL1 OS=Ho... 58 4e-08 sp|P40798|STC..._DROME Protein shuttle craft OS=Drosophila melanoga... 54 6e-07 sp|A0JMY5|NFXL1_XENLA NF-X1-type zinc finger

  11. Stanniocalcin 2 Regulates Non-capacitative Ca2+ Entry and Aggregation in Mouse Platelets

    Directory of Open Access Journals (Sweden)

    Esther López

    2018-03-01

    Full Text Available Stanniocalcin 2 (STC2 is a fish protein that controls body Ca2+ and phosphate metabolism. STC2 has also been described in mammals, and as platelet function highly depends on both extracellular and intracellular Ca2+, we have explored its expression and function in these cells. STC2−/− mice exhibit shorter tail bleeding time than WT mice. Platelets from STC2-deficient mice showed enhanced aggregation, as well as enhanced Ca2+ mobilization in response to the physiological agonist thrombin (Thr and the diacylglycerol analog, OAG, a selective activator of the non-capacitative Ca2+ entry channels. Interestingly, platelets from STC2−/− mice exhibit attenuated interaction between STIM1 and Orai1 in response to Thr, thus suggesting that STC2 is required for Thr-evoked STIM1-Orai1 interaction and the subsequent store-operated Ca2+ entry (SOCE. We have further assessed possible changes in the expression of the most relevant channels involved in non-capacitative Ca2+ entry in platelets. Then, protein expression of Orai3, TRPC3 and TRPC6 were evaluated by Western blotting, and the results revealed that while the expression of Orai3 was enhanced in the STC2-deficient mice, others like TRPC3 and TRPC6 remains almost unaltered. Summarizing, our results provide for the first time evidence for a role of STC2 in platelet physiology through the regulation of agonist-induced Ca2+ entry, which might be mediated by the regulation of Orai3 channel expression.

  12. Characterization of a Murine Model of Bioequivalent Bladder Wound Healing and Repair Following Subtotal Cystectomy

    Directory of Open Access Journals (Sweden)

    Mona Zarifpour

    2017-05-01

    Full Text Available Previous work demonstrated restoration of a bioequivalent bladder within 8 weeks of removing the majority of the bladder (subtotal cystectomy or STC in rats. The goal of the present study was to extend our investigations of bladder repair to the murine model, to harness the power of mouse genetics to delineate the cellular and molecular mechanisms responsible for the observed robust bladder regrowth. Female C57 black mice underwent STC, and at 4, 8, and 12 weeks post-STC, bladder repair and function were assessed via cystometry, ex vivo pharmacologic organ bath studies, and T2-weighted magnetic resonance imaging (MRI. Histology was also performed to measure bladder wall thickness. We observed a time-dependent increase in bladder capacity (BC following STC, such that 8 and 12 weeks post-STC, BC and micturition volumes were indistinguishable from those of age-matched non-STC controls and significantly higher than observed at 4 weeks. MRI studies confirmed that bladder volume was indistinguishable within 3 months (11 weeks post-STC. Additionally, bladders emptied completely at all time points studied (i.e., no increases in residual volume, consistent with functional bladder repair. At 8 and 12 weeks post-STC, there were no significant differences in bladder wall thickness or in the different components (urothelium, lamina propria, or smooth muscle layers of the bladder wall compared with age-matched control animals. The maximal contractile response to pharmacological activation and electrical field stimulation increased over time in isolated tissue strips from repaired bladders but remained lower at all time points compared with controls. We have established and validated a murine model for the study of de novo organ repair that will allow for further mechanistic studies of this phenomenon after, for example, genetic manipulation.

  13. Effect of diosmin on chronic nonbacterial prostatitis caused by pelvic congestion in rats

    Directory of Open Access Journals (Sweden)

    Gong-ting CUI

    2014-08-01

    Full Text Available Objective To explore the effect of diosmin on chronic nonbacterial prostatitis (CNP in rats and its possible mechanisms. Methods Thirty-two healthy adult male SD rats were randomly divided into 4 groups: Sham-operated group (SO group, chronic prostatitis model group (CPM group, chronic prostatitis model + prostat treatment group (CPM-P group, and chronic prostatitis model + diosmin treatment group (CPM-D group. Rats in SO group underwent laparotomy only to expose the prostate, and those in other groups received prostatic vein ligation to reproduce pelvic congestion. HE staining was used for the examination of the prostate 35 days after the operation. 80mg/(kg.d of diosmin was given to the rats in CPM-D group, and 60mg/(kg.d of diosmin to the rats in CPM-P group twice a day by gavage for 7 days. Same volume of 5% acacia gum was given to rats in SO and CPM groups. All of the rats were sacrificed 1h after the last administration, and the serum levels of interleukin-10 (IL-10, IL-8, IL-1β, malondialdehyde (MDA, nitric oxide (NO were determined by ELISA, and the pathological changes in the prostate tissue were observed after HE staining and compared between the groups. Results The serum levels of IL-1β, IL-8 and NO were significantly lower in CPM-D group and CPM-P group than in CPM group (P<0.05, the serum level of IL-10 was significantly higher in CPM-D group and CPM-P group than in CPM group (P<0.05, and the serum MDA level was similar between the 3 groups. HE staining showed that chronic inflammatory changes in rats' prostate were reduced more significantly in CPM-P group and CPM-D group than in CPM group. Conclusion The therapeutic effect of diosmin on pelvic-congestion-induced chronic prostatitis is similar to that of prostat tablets, and its mechanism may be related to the alleviation of local inflammatory response by reducing the IL-1β, IL-8 and NO levels and increasing the IL-10 content in serum. DOI: 10.11855/j.issn.0577-7402.2014.06.04

  14. Relationship between Personality Traits and Endogenous Analgesia: The Role of Harm Avoidance.

    Science.gov (United States)

    Nahman-Averbuch, Hadas; Yarnitsky, David; Sprecher, Elliot; Granovsky, Yelena; Granot, Michal

    2016-01-01

    Whether psychological factors such as anxiety and pain catastrophizing levels influence the expression of endogenous analgesia in general and, more specifically, the conditioned pain modulation (CPM) response is still under debate. It may be assumed that other psychological characteristics also play a role in the CPM response. The neurotransmitters serotonin, dopamine, and norepinephrine are involved both in CPM, as well as personality traits such as harm avoidance (HA), novelty seeking (NS), and reward dependence (RD), which can be obtained by the Tridimensional Personality Questionnaire (TPQ). However, the associations between these traits (HA, NS, and RD) with endogenous analgesia revealed by CPM have not yet been explored. Healthy middle-age subjects (n = 28) completed the TPQ, Spielberger's State Anxiety Inventory, and the Pain Catastrophizing Scale and were assessed for CPM paradigms using thermal phasic temporal summation as the "test stimulus" and hand immersion into hot water bath (CPM water) or contact heat (CPM contact) for "conditioning stimulus." Higher levels of HA were associated with less-efficient CPM responses obtained by both paradigms: CPM water (r = 0.418, P = 0.027) and CPM contact (r = 0.374, P = 0.050). However, NS and RD were not associated with the other measurements. No significant relationship was observed between state anxiety and pain catastrophizing levels and the CPM responses. The relationship between the capacity of endogenous analgesia and the tendency to avoid aversive experience can be explained by mutual mechanisms involving similar neurotransmitters or brain areas. These findings illuminate the key role of harm avoidance obtained by the TPQ in determining the characteristics of pain modulation profile. © 2014 World Institute of Pain.

  15. Long-Term Satisfaction and Body Image After Contralateral Prophylactic Mastectomy

    Science.gov (United States)

    Anderson, Chelsea; Islam, Jessica Y.; Hodgson, M. Elizabeth; Sabatino, Susan A.; Rodriguez, Juan L.; Lee, Clara N.; Sandler, Dale P.; Nichols, Hazel B.

    2017-01-01

    Background Contralateral prophylactic mastectomy (CPM) rates have been increasing in the U.S. Though some studies have reported high overall satisfaction among women who undergo CPM, it is unclear how long-term satisfaction differs from that of women who undergo unilateral mastectomy (UM). Furthermore, few studies have assessed whether the effects of CPM on body image differ from those of breast conserving surgery (BCS) or UM. Methods We analyzed responses from a survey of women with both a personal and family history of breast cancer who were enrolled in the Sister Study (n=1176). Among women who underwent mastectomy, satisfaction with mastectomy decision and reconstruction was compared between women who underwent CPM and UM. We also evaluated responses on 5 items related to body image according to surgery type (BCS, UM without reconstruction, CPM without reconstruction, UM with reconstruction, and CPM with reconstruction). Results Participants were, on average, 60.8 years old at diagnosis (SD=8.7) and 3.6 years post-diagnosis at the time of survey (SD=1.7). BCS was the most common surgical treatment reported (63%), followed by CPM (22%) and UM (15%). Satisfaction with mastectomy decision was reported by 97% of women who underwent CPM and 89% of those who underwent UM. Compared to other surgery types, women who underwent CPM without reconstruction reported feeling more self-conscious, less feminine, less whole, and less satisfied with the appearance of their breasts. Body image was consistently highest among women who underwent BCS. Conclusions In our sample of women with both a personal and family history of breast cancer, most were highly satisfied with their mastectomy decision, including those who elected to undergo CPM. However, body image was lowest among women who underwent CPM without reconstruction. Our findings may inform decisions among women considering various courses of surgical treatment. PMID:28058563

  16. Contralateral prophylactic mastectomy rate and predictive factors among patients with breast cancer who underwent multigene panel testing for hereditary cancer.

    Science.gov (United States)

    Elsayegh, Nisreen; Webster, Rachel D; Gutierrez Barrera, Angelica M; Lin, Heather; Kuerer, Henry M; Litton, Jennifer K; Bedrosian, Isabelle; Arun, Banu K

    2018-05-07

    Although multigene panel testing is increasingly common in patients with cancer, the relationship between its use among breast cancer patients with non-BRCA mutations or variants of uncertain significance (VUS) and disease management decisions has not been well described. This study evaluated the rate and predictive factors of CPM patients who underwent multigene panel testing. Three hundred and fourteen patients with breast cancer who underwent multigene panel testing between 2014 and 2017 were included in the analysis. Of the 314 patients, 70 elected CPM. Election of CPM by gene status was as follows: BRCA carriers (42.3%), non-BRCA carriers (30.1%), and VUS (10.6%). CPM election rates did not differ between non-BRCA carriers and BRCA carriers (P = 0.6205). Among non-BRCA carriers, negative hormone receptor status was associated with CPM (P = 0.0115). For those with a VUS, hormone receptor status was not associated with CPM (P = 0.1879). Although the rate of CPM between BRCA carriers and non-BRCA carriers was not significantly different, the predictors of CPM were different in each group. Our analyses shed the light on the increasing use of CPM among patients who are non-BRCA carriers as well those with a VUS. Our study elucidates the differing predictive factors of CPM election among BRCA carriers, non-BRCA carries, and those with a VUS. Our findings reveal the need for providers to be cognizant that non-BRCA genes and VUS drive women to elect CPM despite the lack of data for contralateral breast cancer risk associated with these genes. © 2018 The Authors. Cancer Medicine published by John Wiley & Sons Ltd.

  17. Shortest triplet clustering: reconstructing large phylogenies using representative sets

    Directory of Open Access Journals (Sweden)

    Sy Vinh Le

    2005-04-01

    Full Text Available Abstract Background Understanding the evolutionary relationships among species based on their genetic information is one of the primary objectives in phylogenetic analysis. Reconstructing phylogenies for large data sets is still a challenging task in Bioinformatics. Results We propose a new distance-based clustering method, the shortest triplet clustering algorithm (STC, to reconstruct phylogenies. The main idea is the introduction of a natural definition of so-called k-representative sets. Based on k-representative sets, shortest triplets are reconstructed and serve as building blocks for the STC algorithm to agglomerate sequences for tree reconstruction in O(n2 time for n sequences. Simulations show that STC gives better topological accuracy than other tested methods that also build a first starting tree. STC appears as a very good method to start the tree reconstruction. However, all tested methods give similar results if balanced nearest neighbor interchange (BNNI is applied as a post-processing step. BNNI leads to an improvement in all instances. The program is available at http://www.bi.uni-duesseldorf.de/software/stc/. Conclusion The results demonstrate that the new approach efficiently reconstructs phylogenies for large data sets. We found that BNNI boosts the topological accuracy of all methods including STC, therefore, one should use BNNI as a post-processing step to get better topological accuracy.

  18. Analysis of sensitivity to different parameterization schemes for a subtropical cyclone

    Science.gov (United States)

    Quitián-Hernández, L.; Fernández-González, S.; González-Alemán, J. J.; Valero, F.; Martín, M. L.

    2018-05-01

    A sensitivity analysis to diverse WRF model physical parameterization schemes is carried out during the lifecycle of a Subtropical cyclone (STC). STCs are low-pressure systems that share tropical and extratropical characteristics, with hybrid thermal structures. In October 2014, a STC made landfall in the Canary Islands, causing widespread damage from strong winds and precipitation there. The system began to develop on October 18 and its effects lasted until October 21. Accurate simulation of this type of cyclone continues to be a major challenge because of its rapid intensification and unique characteristics. In the present study, several numerical simulations were performed using the WRF model to do a sensitivity analysis of its various parameterization schemes for the development and intensification of the STC. The combination of parameterization schemes that best simulated this type of phenomenon was thereby determined. In particular, the parameterization combinations that included the Tiedtke cumulus schemes had the most positive effects on model results. Moreover, concerning STC track validation, optimal results were attained when the STC was fully formed and all convective processes stabilized. Furthermore, to obtain the parameterization schemes that optimally categorize STC structure, a verification using Cyclone Phase Space is assessed. Consequently, the combination of parameterizations including the Tiedtke cumulus schemes were again the best in categorizing the cyclone's subtropical structure. For strength validation, related atmospheric variables such as wind speed and precipitable water were analyzed. Finally, the effects of using a deterministic or probabilistic approach in simulating intense convective phenomena were evaluated.

  19. Rain from South and snow from North

    Energy Technology Data Exchange (ETDEWEB)

    Miyake, Y

    1954-12-01

    Detection of nuclear explosions by various methods including observations of fission product activity in the atmosphere is discussed. Deposition of 750 cpm on a vase-line coated paper (30 x 30 cm) on May 13 to 16, 1954 was recorded. Eighty-six thousand cpm/1 was observed in rain at Kyoto on May 14, apparently from the May 5 test at Bikini.

  20. Central pontine myelinolysis: clinical presentation and radiologic findings

    International Nuclear Information System (INIS)

    Laubenberger, J.; Schneider, B.; Ansorge, O.; Goetz, F.; Haeussinger, D.; Volk, B.; Langer, M.

    1996-01-01

    Central pontine myelinolysis (CPM) is a neurologic disorder once thought to be uniformly fatal. With the introduction of CT and MRI there was an increasing number of reports on nonfatal cases of CPM. Nearly all reports on nonfata cases describe severe clinical syndromes with tetraparesis, bulbar palsy, and coma. We reviewed nine patients with CPM and compared the size of the pontine lesion on MRI and CT with the severity of clinical presentation. Clinical presentation of CPM was highly variable: The symptoms ranged from severe neurologic disorders to mild neurologic disturbances only. Two of nine patients died from CPM. The size of the pontine lesion did not correlate with the severity of the neurologic illness or the final outcome. Mild forms of CPM might be difficult to diagnose clinically. This applies even more for patients with underlying diseases such as Wernicke's encephalopathy, which in itself might cause a clinical picture similar to that of CPM. Central Pontine Myelinolysis is a major differential diagnosis in acute neurologic deterioration indicating pontine damage. Magnetic resonance imaging is the decisive diagnostic tool for CPM. (orig.)

  1. A Time-Cost Management System for use in Educational Planning.

    Science.gov (United States)

    McIsaac, Donald N., Jr.; and Others

    Prepared specifically for the Denver Public Schools, this manual nevertheless provides some of the basic understanding required for the proper execution of educational planning based upon PERT/CPM techniques. The theory of PERT/CPM and the fundamental processes involved therein are elucidated in the first part of the manual while the operating…

  2. Effect of partial replacement of dietary maize with cassava peel meal ...

    African Journals Online (AJOL)

    Effect of dietary cassava peel meal (CPM) inclusion in partial replacement for maize on egg quality characteristics during storage was investigated in this study. In a completely randomized design, ISA brown pullets (n=3,000) aged 20-week were assigned to three dietary treatments. Diets A, B, C contained CPM at 0, 10 and ...

  3. 406 E Grand, October 2010, Lindsay Light Radiological Survey

    Science.gov (United States)

    The field gamma measurements within the excavation and the spoil materials generated during the excavation process did not exceed the respective threshold values previously stated and ranged from a minim um of 1, 120 cpm to a maxim um of 6,640 cpm.

  4. Charged Particle Monitor on the AstroSat Mission

    Indian Academy of Sciences (India)

    The ground calibration of CPM was done using gamma-rays from radioactive sources and protons from particle accelerators. Based on the ground calibration results, energy deposition above 1 MeV are accepted and particle counts are recorded. It is found that CPM counts are steady and the signal for the onset and exit of ...

  5. The Natural Carotenoid Crocetin and the Synthetic Tellurium Compound AS101 Protect the Ovary against Cyclophosphamide by Modulating SIRT1 and Mitochondrial Markers

    Directory of Open Access Journals (Sweden)

    Giovanna Di Emidio

    2017-01-01

    Full Text Available Cancer therapies are associated with increased infertility risk due to accelerated reproductive aging. Oxidative stress (OS is a potential mechanism behind ovarian toxicity by cyclophosphamide (CPM, the most ovotoxic anticancer drug. An important sensor of OS is SIRT1, a NAD+-dependent deacetylase which regulates cellular defence and cell fate. This study investigated whether the natural carotenoid crocetin and the synthetic compound AS101 protect the ovary against CPM by modulating SIRT1 and mitochondrial markers. We found that the number of primordial follicles of female CD1 mice receiving crocetin plus CPM increased when compared with CPM alone and similar to AS101, whose protective effects are known. SIRT1 increased in CPM mouse ovaries revealing the occurrence of OS. Similarly, mitochondrial SIRT3 rose, whilst SOD2 and the mitochondrial biogenesis activator PGC1-α decreased, suggesting the occurrence of mitochondrial damage. Crocetin and AS101 administration prevented SIRT1 burst suggesting that preservation of redox balance can help the ovary to counteract ovarian damage by CPM. Decreased SIRT3 and increased SOD2 and PGC1-α in mice receiving crocetin or AS101 prior to CPM provide evidence for mitochondrial protection. Present results improve the knowledge of ovarian damage by CPM and may help to develop interventions for preserving fertility in cancer patients.

  6. Kinetic equations for the collisional plasma model

    International Nuclear Information System (INIS)

    Rij, W.I. Van; Meier, H.K.; Beasley, C.O. Jr.; McCune, J.E.

    1977-01-01

    Using the Collisional Plasma Model (CPM) representation, expressions are derived for the Vlasov operator, both in its general form and in the drift-kinetic approximation following the recursive derivation by Hazeltine. The expressions for the operators give easily calculated couplings between neighbouring components of the CPM representation. Expressions for various macroscopic observables in the drift-kinetics approximation are also given. (author)

  7. Growth Performance, Haematological Indices and Cost Benefits of ...

    African Journals Online (AJOL)

    Lenovo pc

    Effect of replacing dietary maize with cassava peel meal (CPM) supplemented with Allzyme® SSF (SSF) on the growth performance, haematological indices and cost benefits of growing pigs was investigated. Chemical composition of CPM and diets used were determined using standard procedures. Twenty-four growing ...

  8. Application of a new approach for study of virulence variation in cucurbit powdery mildew populations

    Science.gov (United States)

    Cucurbit powdery mildew (CPM) is caused by two obligate ectoparasites, Golovinomyces orontii s.l. (Go) and Podosphaera xanthii (Px), that are highly variable in virulence. Various systems of CPM race determination and denomination were used (Lebeda et al. 2011). We developed new tools to enhance res...

  9. Effect of supplementation of cassava peel meal based diet with ...

    African Journals Online (AJOL)

    A four-week experiment was conducted to investigate the effect of Maxigrain® enzyme supplementation on performance, nutrient digestibility and economic indices of broiler finishers fed soaked and sun-dried cassava peel meal (CPM) based diet. CPM was included in the diets replacing maize at 0%, 25%, 50% and 75% ...

  10. 401 N. Lakeshore Dr - DuSable Bike Trail, Lindsay Light Radiological Survey

    Science.gov (United States)

    Field gamma measurements within the remaining excavation areas, and for the spoil removed duringthe excavation process, did not exceed the instrument thresholds previously stated and ranged from aminimum of 1,300 cpm to a maximum of 4,400 cpm shielded.

  11. Why fishing boats were contaminated by radiation. [In Japanese

    Energy Technology Data Exchange (ETDEWEB)

    Tajima, E

    1954-12-01

    Many Japanese fishing boats were examined with a G-M counter following the Bikini test of 1954. Decks and other washable parts were weakly irradiated. Directional relationships of contaminants on individual ships coincided with those of the prevailing winds. Ships to the west of Bikini averaged 123 cpm; those to the east 1800 cpm.

  12. Initiative for international cooperation of researchers and breeders related to determination and denomination of cucurbit powdery mildew races

    Science.gov (United States)

    Cucurbit powdery mildew (CPM) is caused most frequently by two obligate erysiphaceous ectoparasites, Golovinomyces orontii s.l. and Podosphaera xanthii, that are highly variable in virulence. Various independent systems of CPM race determination and denomination cause a chaotic situation in cucurbit...

  13. Critical path method applied to research project planning: Fire Economics Evaluation System (FEES)

    Science.gov (United States)

    Earl B. Anderson; R. Stanton Hales

    1986-01-01

    The critical path method (CPM) of network analysis (a) depicts precedence among the many activities in a project by a network diagram; (b) identifies critical activities by calculating their starting, finishing, and float times; and (c) displays possible schedules by constructing time charts. CPM was applied to the development of the Forest Service's Fire...

  14. Comparative CT study on cavitary pulmonary metastases from squamous cell carcinoma and adenocarcinoma

    International Nuclear Information System (INIS)

    Xiong Yongsheng; Yu Xiaoping; Tang Li

    2007-01-01

    Objective: To explore the difference of CT features of cavitary pulmonary metastases(CPM)from squamous cell carcinoma (SCCCPM)and CPM from adenocarcinoma(ACCPM). Methods: CT findings of 61 CPM nodules in 13 patients with SCCCPM and 60 CPM nodules in 22 patients with ACCPM were retrospectively analyzed. Results: SCCCPM presented as bubble (n=13), irregular (n=9), cystic (n=26) or small circular (n=13) cavities. ACCPM presented as bubble (n=21), irregular (n=21) or small circular (n=18) cavities. No cystic cavity was found in ACCPM. The thickness of cavity wall was even in 57 CPM including 39 SCCCPM and 18 ACCPM. Of the 64 CPM with uneven cavity wall thickness, 22 were SCCCPM and 42 were ACCPM. Between SCCCPM and ACCPM, no statistically significant difference was found in the site, size and cavity wall thickness of CPM, cystic cavity and even cavity wall thickness were found much more in SCCCPM than ACCPM, which has statistically significant difference. Conclusion: Both SCCCPM and ACCPM had their own CT characteristics which was likely to predict the histological type of primary malignancy of CPM. (authors)

  15. Resource-Efficient Digital Communications: Research and Testbed Development in Support of Future Force Warrior and Joint Tactical Radio Systems

    National Research Council Canada - National Science Library

    Fuja, Thomas; Collins, Oliver; Costello, Daniel; Huang, Yih-Fang

    2007-01-01

    .... The result is compared with another using continuous phase modulation (CPM). It is shown that the amplifier backoff required for QAM puts it at a disadvantage to CPM at spectral efficiencies where both are feasible - below 2.0 bits/sec/Hz...

  16. T Cell Lipid Rafts and Complement Ligands for Diagnosis and Monitoring of SLE

    Science.gov (United States)

    2011-05-01

    Pittsburgh Medical Center. A total of 114 healthy individuals were recruited through local advertisements posted around the University of Pittsburgh...were recruited through local advertisements posted around the University of Pittsburgh campus. Characteristics of these study participants have been...proliferation index = counts per minute ( cpm ) of cells cultured in the presence of antibodies/ cpm of cells cultured in medium alone. 19

  17. Mixed Methodology to Predict Social Meaning for Decision Support

    Science.gov (United States)

    2013-09-01

    centered on the appearance of advertisements for pornography on the HoodUp Web site. As with the informational threads, gang affiliation carries...ARMY CERDEC CP&I (PDFs) ATTN RDER- CPM -IM R SCHULTZ ATTN RDER- CPM -IM T TRUONG 2 US ARMY RESEARCH LAB (PDFs) ARO RESEARCH TRIANGLE PARK ATTN

  18. Endotracheal tube cuff pressure management in adult critical care ...

    African Journals Online (AJOL)

    of respondents performed cuff pressure measurements every 6 - 12 hours; 32% reported ... effectively when performing ETT cuff pressure management, to reduce practice variance, ... questionnaires were distributed to professional nurses working in .... MOV, CPM and the palpation method.3 No advantage of CPM over.

  19. Fuel transfer system ALARA design review - Project A.15

    International Nuclear Information System (INIS)

    KUEBERTH, L.R.

    2001-01-01

    One mission of the Spent Nuclear Fuel (SNF) Project is to move the SNF from the K Basins in the Hanford 100K Area to an interim dry storage at the Canister Storage Building (CSB) in the Hanford 200 East Area. The Fuel Transfer System (FTS) is a subproject that will move the SNF from the 105K East (KE) Facility to the 105K West (KW) Facility. The SNF will be treated for shipment to the Cold Vacuum Drying (CVD) facility at the KW Basin. The SNF canisters will be loaded underwater into a Shielded Transfer Cask (STC) in the KE Basin. The fully loaded STC will be brought out of the water and placed into a Cask Transfer Overpack (CTO) by the STC Straddle Carrier. As the STC is removed from the water, it will be washed down with demineralized water by an manual rinse system. The CTO with the STC inside will be placed on a transport trailer and transferred to the KW Basin as an intra-facility transfer. The CTO will be unloaded from the shipping trailer at the KW Basin and the STC will be removed from the CTO. The STC will then be lowered into the KW Basin water and the fuel will be removed. The SNF will then be processed for shipment to the CVD. As soon as all of the fuel has been removed from the STC, the cask will be removed from the KW Basin water and placed into the CTO. The CTO will again be placed on the trailer for transport back to the KE Basin where the entire cycle will be repeated approximately 400 times. This document records the As Low As Reasonably Achievable (ALARA) findings and design recommendations/requirements by the SNF Project noted during the Final Design Review of the STC, CTO, STC Transfer System, Annexes and Roadways for support of FTS. This document is structured so that all statements that include the word ''shall'' represent design features that have been or will be implemented within the project scope. Statements that include the words ''should'' or ''recommend'' represent ALARA design features to be evaluated for future implementation

  20. A novel paradigm to evaluate conditioned pain modulation in fibromyalgia

    Directory of Open Access Journals (Sweden)

    Schoen CJ

    2016-09-01

    Full Text Available Cynthia J Schoen,1,* Jacob N Ablin,2,* Eric Ichesco,1 Rupal J Bhavsar,3 Laura Kochlefl,1 Richard E Harris,1 Daniel J Clauw,1 Richard H Gracely,4 Steven E Harte1 1Department of Anesthesiology, Chronic Pain and Fatigue Research Center, University of Michigan, Ann Arbor, MI, USA; 2Institute of Rheumatology, Tel Aviv Suorasky Medical Center, and Sackler Faculty of Medicine, Tel Aviv University, Tel Aviv, Israel; 3Department of Neurology, University of Pennsylvania, Philadelphia, PA, 4Department of Endodontics, University of North Carolina – Chapel Hill, Chapel Hill, NC, USA *These authors contributed equally to this work Introduction: Application of noxious stimulation to one body area reduces pain sensitivity in a remote body area through activation of an endogenous pain-inhibitory network, a behavioral phenomenon referred to as conditioned pain modulation (CPM. The efficiency of CPM is predictive of a variety of health outcomes, while impaired CPM has been associated with various chronic pain conditions. Current methods used to assess CPM vary widely, and interest in CPM method development remains strong. Here, we evaluated a novel method for assessing CPM in healthy controls and fibromyalgia (FM patients using thumb pressure as both a test and conditioning stimulus.Methods: Sixteen female FM patients and 14 matched healthy controls underwent CPM testing with thumbnail pressure as the test stimulus, and either cold water or noxious pressure as the conditioning stimulus. CPM magnitude was evaluated as the difference in pain rating of the test stimulus applied before and during the conditioning stimulus.Results: In healthy controls, application of either pressure or cold water conditioning stimulation induced CPM as evidenced by a significant reduction in test stimulus pain rating during conditioning (P=0.007 and P=0.021, respectively. In contrast, in FM patients, neither conditioning stimulus induced a significant CPM effect P-values >0

  1. An empirical study using range of motion and pain score as determinants for continuous passive motion: outcomes following total knee replacement surgery in an adult population.

    Science.gov (United States)

    Tabor, Danielle

    2013-01-01

    The continuous passive motion (CPM) machine is one means by which to rehabilitate the knee after total knee replacement surgery. This study sought to determine which total knee replacement patients, if any, benefit from the use of the CPM machine. For the study period, most patients received active physical therapy. Patients were placed in the CPM machine if, on postoperative day 1, they had a range of motion less than or equal to 45° and/or pain score of 8 or greater on a numeric rating scale of 0-10, 0 being no pain and 10 being the worst pain. Both groups of patients healed at similar rates. The incidence of adverse events, length of stay, and functional outcomes was comparable between groups. Given the demonstrated lack of relative benefit to the patient and the cost of the CPM, this study supported discontinuing the routine use of the CPM.

  2. Conditioned pain modulation: a predictor for development and treatment of neuropathic pain.

    Science.gov (United States)

    Granovsky, Yelena

    2013-09-01

    Psychophysical evaluation of endogenous pain inhibition via conditioned pain modulation (CPM) represents a new generation of laboratory tests for pain assessment. In this review we discuss recent findings on CPM in neuropathic pain and refer to psychophysical, neurophysiological, and methodological aspects of its clinical implications. Typically, chronic neuropathic pain patients express less efficient CPM, to the extent that incidence of acquiring neuropathic pain (e.g. post-surgery) and its intensity can be predicted by a pre-surgery CPM assessment. Moreover, pre-treatment CPM evaluation may assist in the correct choice of serotonin-noradrenalin reuptake inhibitor analgesic agents for individual patients. Evaluation of pain modulation capabilities can serve as a step forward in individualizing pain medicine.

  3. A Case of Central Pontine Myelinolysis Caused by Hypophosphatemia Secondary to Refeeding Syndrome

    Directory of Open Access Journals (Sweden)

    Chikara Yamashita

    2015-10-01

    Full Text Available Central pontine myelinolysis (CPM, which was originally considered to be the result of rapid correction of chronic hyponatremia, is not necessarily accompanied by hyponatremia or drastic changes in serum sodium level. Here, we report a case of an anorexic 55-year-old male with a history of pharyngo-laryngo-esophagogastrectomy, initially hospitalized with status epilepticus. Although his consciousness gradually recovered as we were controlling his convulsion, it deteriorated again with new onset of anisocoria, and magnetic resonance imaging (MRI at this point revealed CPM. Rapid change of serum sodium or osmolarity, which is often associated with CPM, had not been apparent throughout his hospitalization. Instead, a review of the serum biochemistry test results showed that serum phosphate had drastically declined the day before the MRI first detected CPM. In this case, we suspect that hypophosphatemia induced by refeeding syndrome greatly contributed to the occurrence of CPM.

  4. A Case of Central Pontine Myelinolysis Caused by Hypophosphatemia Secondary to Refeeding Syndrome.

    Science.gov (United States)

    Yamashita, Chikara; Shigeto, Hiroshi; Maeda, Norihisa; Torii, Takako; Ohyagi, Yasumasa; Kira, Jun-Ichi

    2015-01-01

    Central pontine myelinolysis (CPM), which was originally considered to be the result of rapid correction of chronic hyponatremia, is not necessarily accompanied by hyponatremia or drastic changes in serum sodium level. Here, we report a case of an anorexic 55-year-old male with a history of pharyngo-laryngo-esophagogastrectomy, initially hospitalized with status epilepticus. Although his consciousness gradually recovered as we were controlling his convulsion, it deteriorated again with new onset of anisocoria, and magnetic resonance imaging (MRI) at this point revealed CPM. Rapid change of serum sodium or osmolarity, which is often associated with CPM, had not been apparent throughout his hospitalization. Instead, a review of the serum biochemistry test results showed that serum phosphate had drastically declined the day before the MRI first detected CPM. In this case, we suspect that hypophosphatemia induced by refeeding syndrome greatly contributed to the occurrence of CPM.

  5. Dynamics of coarse particulate matter in the turbidity maximum zone of the Gironde Estuary

    Science.gov (United States)

    Fuentes-Cid, Ana; Etcheber, Henri; Schmidt, Sabine; Abril, Gwenaël; De-Oliveira, Eric; Lepage, Mario; Sottolichio, Aldo

    2014-01-01

    There is a lack of studies devoted to coarse particulate matter (CPM) in estuaries, although this fraction can disturb activities that filter large volumes of water, such as industrial or fishery activities. In the macrotidal and highly-turbid Gironde Estuary, a monthly sampling of CPM was performed in 2011 and 2013 at two stations in the Turbidity Maximum Zone (TMZ) to understand its seasonal, tidal and hydrological dynamics. Regardless of the season and station, low quantities of CPM (few g m-3) were observed in comparison with suspended particulate matter (several 103 g m-3). The highest concentrations were consistently recorded in bottom waters and at the upstream station. Whereas there is no clear link between the CPM present in the column water and spring or neap tides, an increase in the CPM size has been identified at the two stations after a flood event, fact potentially critical regarding filtering functioning of estuarine activities.

  6. The Effect of Music Listening on Pain, Heart Rate Variability, and Range of Motion in Older Adults After Total Knee Replacement.

    Science.gov (United States)

    Hsu, Chih-Chung; Chen, Su-Ru; Lee, Pi-Hsia; Lin, Pi-Chu

    2017-12-01

    The purpose of this study was to investigate the effects that listening and not listening to music had on pain relief, heart rate variability (HRV), and knee range of motion in total knee replacement (TKR) patients who underwent continuous passive motion (CPM) rehabilitation. We adopted a single-group quasi-experimental design. A sample of 49 TKR patients listened to music for 25 min during one session of CPM and no music during another session of CPM the same day for a total of 2 days. Results indicated that during CPM, patients exhibited a significant decrease in the pain level ( p listening to music compared with no music. This study demonstrated that listening to music can effectively decrease pain during CPM rehabilitation and improve the joint range of motion in patients who underwent TKR surgery.

  7. Central pontine myelinolysis presenting as isolated sixth nerve palsy in third trimester of pregnancy

    Directory of Open Access Journals (Sweden)

    Tushar Divakar Gosavi

    2015-01-01

    Full Text Available A 30-year-old primigravida presented with isolated left sixth nerve palsy at 38 weeks gestation. Her MRI showed a lesion consistent with central pontine myelinolysis (CPM. Extensive investigations did not reveal any secondary cause for the CPM. She recovered spontaneously in 2 weeks with complete resolution of her MRI changes. To our knowledge, this is the first report of CPM occurring in third trimester in the absence of identifiable secondary causes and of CPM presenting as an isolated sixth nerve palsy. We discuss the reported causes of CPM in pregnancy, possible pathophysiologic mechanisms involved and the anatomic basis of the unique clinical presentation of sixth nerve palsy in our case.

  8. Central pontine myelinolysis with a hyperintense lesion in diffusion weighted MRI: overview by means of a case report

    International Nuclear Information System (INIS)

    Kuhn, J.; Bewermeyer, H.; Harzheim, A.

    2005-01-01

    Central pontine myelinolysis (CPM) is a demyelinating disease of the pons often associated with demyelination of other areas of the central nervous system (CNS). The etiology and pathogenesis of this disorder are still not fully understood. However, almost all cases of CPM are related to severe diseases or chronic alcoholism and occur in the setting of rapidly corrected serum hyponatremia and hypotonicity respectively. Depending on the involvement of other CNS structures, the clinical picture can vary considerably. Magnetic resonance imaging is the most sensitive investigation for the antemortem diagnosis of CPM, although the radiological findings lag behind and do not necessarily correlate with the clinical picture. Quite obviously diffusion-weighted imaging can be useful in the rapid diagnosis of CPM. This short review summarizes the current knowledge on the pathogenesis, clinical presentation, radiological findings, prognosis and therapeutic approaches of CPM. Characteristical clinical features and MR-findings including hyperintensity on diffusion-weighted images are illustrated by a typical case. (orig.)

  9. Central pontine myelinolysis with a hyperintense lesion in diffusion weighted MRI: overview by means of a case report; Zentrale pontine Myelinolyse mit hyperintenser Laesion im diffusionsgewichteten MRT: Uebersicht anhand eines Fallberichtes

    Energy Technology Data Exchange (ETDEWEB)

    Kuhn, J.; Bewermeyer, H. [Neurologische Klinik, Kliniken der Stadt Koeln gGmbH, Krankenhaus Merheim, Koeln (Germany); Harzheim, A. [Radiologische Klinik, Kliniken der Stadt Koeln gGmbH, Krankenhaus Merheim, Koeln (Germany)

    2005-07-01

    Central pontine myelinolysis (CPM) is a demyelinating disease of the pons often associated with demyelination of other areas of the central nervous system (CNS). The etiology and pathogenesis of this disorder are still not fully understood. However, almost all cases of CPM are related to severe diseases or chronic alcoholism and occur in the setting of rapidly corrected serum hyponatremia and hypotonicity respectively. Depending on the involvement of other CNS structures, the clinical picture can vary considerably. Magnetic resonance imaging is the most sensitive investigation for the antemortem diagnosis of CPM, although the radiological findings lag behind and do not necessarily correlate with the clinical picture. Quite obviously diffusion-weighted imaging can be useful in the rapid diagnosis of CPM. This short review summarizes the current knowledge on the pathogenesis, clinical presentation, radiological findings, prognosis and therapeutic approaches of CPM. Characteristical clinical features and MR-findings including hyperintensity on diffusion-weighted images are illustrated by a typical case. (orig.)

  10. Conditioned pain modulation predicts duloxetine efficacy in painful diabetic neuropathy.

    Science.gov (United States)

    Yarnitsky, David; Granot, Michal; Nahman-Averbuch, Hadas; Khamaisi, Mogher; Granovsky, Yelena

    2012-06-01

    This study aims to individualize the selection of drugs for neuropathic pain by examining the potential coupling of a given drug's mechanism of action with the patient's pain modulation pattern. The latter is assessed by the conditioned pain modulation (CPM) and temporal summation (TS) protocols. We hypothesized that patients with a malfunctioning pain modulation pattern, such as less efficient CPM, would benefit more from drugs augmenting descending inhibitory pain control than would patients with a normal modulation pattern of efficient CPM. Thirty patients with painful diabetic neuropathy received 1 week of placebo, 1 week of 30 mg/d duloxetine, and 4 weeks of 60 mg/d duloxetine. Pain modulation was assessed psychophysically, both before and at the end of treatment. Patient assessment of drug efficacy, assessed weekly, was the study's primary outcome. Baseline CPM was found to be correlated with duloxetine efficacy (r=0.628, P<.001, efficient CPM is marked negative), such that less efficient CPM predicted efficacious use of duloxetine. Regression analysis (R(2)=0.673; P=.012) showed that drug efficacy was predicted only by CPM (P=.001) and not by pretreatment pain levels, neuropathy severity, depression level, or patient assessment of improvement by placebo. Furthermore, beyond its predictive value, the treatment-induced improvement in CPM was correlated with drug efficacy (r=-0.411, P=.033). However, this improvement occurred only in patients with less efficient CPM (16.8±16.0 to -1.1±15.5, P<.050). No predictive role was found for TS. In conclusion, the coupling of CPM and duloxetine efficacy highlights the importance of pain pathophysiology in the clinical decision-making process. This evaluative approach promotes personalized pain therapy. Copyright © 2012 International Association for the Study of Pain. Published by Elsevier B.V. All rights reserved.

  11. The Responses of Ozone Density to Solar Activity in the Mesopause Region and the Mutual Relationship Based on SABER Measurements During 2002-2016

    Science.gov (United States)

    Tang, Chaoli; Wu, Bo; Wei, Yuanyuan; Qing, Chun; Dai, Congming; Li, Jianyu; Wei, Heli

    2018-04-01

    This paper is aimed to investigate the mutual relationship between ozone-density at cold-point mesopause (O3-CPM) and solar activity globally using Sounding of the Atmosphere using Broadband Emission Radiometry (SABER) measurements and the 10.7 cm-solar-radio-flux (F10.7) data set. For this purpose, the global latitude regions are divided into 16 latitude bins. The global changes of O3-CPM are presented in mesopause region during 2002-2016. SABER has documented dramatic variability in O3-CPM on time scale of the 11-year solar cycle. The observed changes in the global O3-CPM correlate well with the changes in solar activity during 2002-2016 with correlation coefficient of 0.92, and the global solar response of O3-CPM is (20.18 ± 2.24)%/100 solar flux units in mesopause. Then, the latitudinal distribution of O3-CPM and its solar cycle dependence are presented for 16 latitude bins. The latitudinal correlation analysis shows that the O3-CPM is significantly correlated to the solar cycle at or above the 95% confidence level for each latitude bin from 84°S to 70°N, and the correlation coefficients are remarkably higher in the southern hemisphere than for corresponding latitudes in the northern hemisphere. The latitudinal distribution of O3-CPM takes on a W shape on a global scale, and the distribution of solar response of O3-CPM is seen in a strong south-north asymmetry between the two hemispheres. The solar response of O3-CPM in latitudinal distribution decreases gradually from the southern hemisphere to the northern hemisphere, and the standard deviation of solar response increases gradually from the equator to the pole in each hemisphere.

  12. Conditioned pain modulation is minimally influenced by cognitive evaluation or imagery of the conditioning stimulus

    Directory of Open Access Journals (Sweden)

    Bernaba M

    2014-11-01

    Full Text Available Mario Bernaba, Kevin A Johnson, Jiang-Ti Kong, Sean MackeyStanford Systems Neuroscience and Pain Laboratory, Department of Anesthesiology, Perioperative and Pain Medicine, Stanford University School of Medicine, Stanford, CA, USAPurpose: Conditioned pain modulation (CPM is an experimental approach for probing endogenous analgesia by which one painful stimulus (the conditioning stimulus may inhibit the perceived pain of a subsequent stimulus (the test stimulus. Animal studies suggest that CPM is mediated by a spino–bulbo–spinal loop using objective measures such as neuronal firing. In humans, pain ratings are often used as the end point. Because pain self-reports are subject to cognitive influences, we tested whether cognitive factors would impact on CPM results in healthy humans.Methods: We conducted a within-subject, crossover study of healthy adults to determine the extent to which CPM is affected by 1 threatening and reassuring evaluation and 2 imagery alone of a cold conditioning stimulus. We used a heat stimulus individualized to 5/10 on a visual analog scale as the testing stimulus and computed the magnitude of CPM by subtracting the postconditioning rating from the baseline pain rating of the heat stimulus.Results: We found that although evaluation can increase the pain rating of the conditioning stimulus, it did not significantly alter the magnitude of CPM. We also found that imagery of cold pain alone did not result in statistically significant CPM effect.Conclusion: Our results suggest that CPM is primarily dependent on sensory input, and that the cortical processes of evaluation and imagery have little impact on CPM. These findings lend support for CPM as a useful tool for probing endogenous analgesia through subcortical mechanisms.Keywords: conditioned pain modulation, endogenous analgesia, evaluation, imagery, cold presser test, CHEPS, contact heat-evoked potential stimulator

  13. A Preclinical Assessment of Early Continuous Passive Motion and Treadmill Therapeutic Exercises for Generating Chondroprotective Effects After Anterior Cruciate Ligament Rupture.

    Science.gov (United States)

    Chang, Nai-Jen; Lee, Kuan-Wei; Chu, Chih-Jou; Shie, Ming-You; Chou, Pei-Hsi; Lin, Chih-Chan; Liang, Peir-In

    2017-08-01

    Anterior cruciate ligament (ACL) injury is a well-known risk factor for the development of posttraumatic osteoarthritis (PTOA). However, whether using continuous passive motion (CPM) with or without additional treadmill exercise (TRE) in early ACL injury might provide chondroprotective effects and further decrease the risk of PTOA has yet to be determined. CPM may offer an enhanced chondroprotective effect, but TRE may attenuate that effect due to the mechanical stress on the joint and inflammatory cytokines in the joint. Controlled laboratory study. Thirty adult New Zealand White male rabbits were randomly allocated to sedentary (SED), CPM, TRE, or CPM+TRE groups. Each rabbit underwent an ACL transection (ACLT) on the right knee, with the contralateral knee used as an internal control (sham). The 4 joint surfaces (ie, medial and lateral femoral condyles and tibial plateaus) were evaluated 4 weeks after surgery for gross appearance, histological characteristics, and quantitative osteoarthritis (OA) scores. Overall, at the end of testing, the CPM group experienced the best protective therapeutic effects in all compartments. In gross appearance, CPM resulted in normal articular surfaces, while the TRE and SED groups exhibited surface abrasion. Histological analysis showed significant differences in articular cartilage status. The CPM group had significantly better histological OA scores ( P CPM+TRE group displayed visible pathological changes in the superficial cartilage, indicating that early loading exercise may contribute to osteoarthritis. The sham treatment showed no difference in the changes in all compartments between groups. Immediate CPM therapy produces a superior in situ microenvironment for reducing the occurrence of PTOA after ACL injury without reconstruction in rabbits. These data suggest that immediate application of CPM therapy may be necessary to create a sound microenvironment in joints and possibly to decrease the risk of PTOA without or while

  14. Stepwise threshold clustering: a new method for genotyping MHC loci using next-generation sequencing technology.

    Directory of Open Access Journals (Sweden)

    William E Stutz

    Full Text Available Genes of the vertebrate major histocompatibility complex (MHC are of great interest to biologists because of their important role in immunity and disease, and their extremely high levels of genetic diversity. Next generation sequencing (NGS technologies are quickly becoming the method of choice for high-throughput genotyping of multi-locus templates like MHC in non-model organisms. Previous approaches to genotyping MHC genes using NGS technologies suffer from two problems:1 a "gray zone" where low frequency alleles and high frequency artifacts can be difficult to disentangle and 2 a similar sequence problem, where very similar alleles can be difficult to distinguish as two distinct alleles. Here were present a new method for genotyping MHC loci--Stepwise Threshold Clustering (STC--that addresses these problems by taking full advantage of the increase in sequence data provided by NGS technologies. Unlike previous approaches for genotyping MHC with NGS data that attempt to classify individual sequences as alleles or artifacts, STC uses a quasi-Dirichlet clustering algorithm to cluster similar sequences at increasing levels of sequence similarity. By applying frequency and similarity based criteria to clusters rather than individual sequences, STC is able to successfully identify clusters of sequences that correspond to individual or similar alleles present in the genomes of individual samples. Furthermore, STC does not require duplicate runs of all samples, increasing the number of samples that can be genotyped in a given project. We show how the STC method works using a single sample library. We then apply STC to 295 threespine stickleback (Gasterosteus aculeatus samples from four populations and show that neighboring populations differ significantly in MHC allele pools. We show that STC is a reliable, accurate, efficient, and flexible method for genotyping MHC that will be of use to biologists interested in a variety of downstream applications.

  15. Expression of stanniocalcin 1 in thyroid side population cells and thyroid cancer cells.

    Science.gov (United States)

    Hayase, Suguru; Sasaki, Yoshihito; Matsubara, Tsutomu; Seo, Daekwan; Miyakoshi, Masaaki; Murata, Tsubasa; Ozaki, Takashi; Kakudo, Kennichi; Kumamoto, Kensuke; Ylaya, Kris; Cheng, Sheue-yann; Thorgeirsson, Snorri S; Hewitt, Stephen M; Ward, Jerrold M; Kimura, Shioko

    2015-04-01

    Mouse thyroid side population (SP) cells consist of a minor population of mouse thyroid cells that may have multipotent thyroid stem cell characteristics. However the nature of thyroid SP cells remains elusive, particularly in relation to thyroid cancer. Stanniocalcin (STC) 1 and 2 are secreted glycoproteins known to regulate serum calcium and phosphate homeostasis. In recent years, the relationship of STC1/2 expression to cancer has been described in various tissues. Microarray analysis was carried out to determine genes up- and down-regulated in thyroid SP cells as compared with non-SP cells. Among genes up-regulated, stanniocalcin 1 (STC1) was chosen for study because of its expression in various thyroid cells by Western blotting and immunohistochemistry. Gene expression analysis revealed that genes known to be highly expressed in cancer cells and/or involved in cancer invasion/metastasis were markedly up-regulated in SP cells from both intact as well as partial thyroidectomized thyroids. Among these genes, expression of STC1 was found in five human thyroid carcinoma-derived cell lines as revealed by analysis of mRNA and protein, and its expression was inversely correlated with the differentiation status of the cells. Immunohistochemical analysis demonstrated higher expression of STC1 in the thyroid tumor cell line and thyroid tumor tissues from humans and mice. These results suggest that SP cells contain a population of cells that express genes also highly expressed in cancer cells including Stc1, which warrants further study on the role of SP cells and/or STC1 expression in thyroid cancer.

  16. Characterization of the periplasmic redox network that sustains the versatile anaerobic metabolism of Shewanella oneidensis MR-1

    Directory of Open Access Journals (Sweden)

    Mónica N. Alves

    2015-06-01

    Full Text Available The versatile anaerobic metabolism of the Gram-negative bacterium Shewanella oneidensis MR-1 (SOMR-1 relies on a multitude of redox proteins found in its periplasm. Most are multiheme cytochromes that carry electrons to terminal reductases of insoluble electron acceptors located at the cell surface, or bona fide terminal reductases of soluble electron acceptors. In this study, the interaction network of several multiheme cytochromes was explored by a combination of NMR spectroscopy, activity assays followed by UV-visible spectroscopy and comparison of surface electrostatic potentials. From these data the small tetraheme cytochrome (STC emerges as the main periplasmic redox shuttle in SOMR-1. It accepts electrons from CymA and distributes them to a number of terminal oxidoreductases involved in the respiration of various compounds. STC is also involved in the electron transfer pathway to reduce nitrite by interaction with the octaheme tetrathionate reductase (OTR, but not with cytochrome c nitrite reductase (ccNiR. In the main pathway leading the metal respiration STC pairs with flavocytochrome c (FccA, the other major periplasmic cytochrome, which provides redundancy in this important pathway. The data reveals that the two proteins compete for the binding site at the surface of MtrA, the decaheme cytochrome inserted on the periplasmic side of the MtrCAB-OmcA outer-membrane complex. However, this is not observed for the MtrA homologues. Indeed, neither STC nor FccA interact with MtrD, the best replacement for MtrA, and only STC is able to interact with the decaheme cytochrome DmsE of the outer-membrane complex DmsEFABGH. Overall, these results shown that STC plays a central role in the anaerobic respiratory metabolism of SOMR-1. Nonetheless, the trans-periplasmic electron transfer chain is functionally resilient as a consequence of redundancies that arise from the presence of alternative pathways that bypass/compete with STC.

  17. Acceptable short-term outcome of laparoscopic subtotal colectomy for inflammatory bowel disease.

    Science.gov (United States)

    Frid, Natalie Lassen; Bulut, Orhan; Pachler, Jørn

    2013-06-01

    Laparoscopic colectomy for both benign and malignant disease, including inflammatory bowel disease (IBD), has recently been shown to have many advantages compared with open surgery. This study aimed to compare the effect of laparoscopic versus open subtotal colectomy (STC) for IBD on overall morbidity. A total of 99 patients undergoing STC for IBD at our institution from 2007 through 2011 were identified. Patients undergoing open STC were compared with patients undergoing laparoscopic STC. Outcomes included 30-day morbidity, conversion to laparotomy, intraoperative blood loss, operative time, admission time, late onset complications and 30-day mortality. Results are presented as median values. A total of 57 patients underwent open STC (Group 1) and 42 patients laparoscopic STC (Group 2). Group 1 comprised 26 males and 31 females, with a median age of 35 years and a body mass index (BMI) of 23.2 kg/m2. Group 2 comprised 18 males and 24 females, with a median age of 34 years and a BMI of 23.5 kg/m2. Group 2 had less morbidity (42.9% versus 75.4%, p < 0.002), reduced blood loss (100 ml versus 200 ml, p < 0.001), longer operative time (193.5 min. versus 128 min., p < 0.001), shorter length of hospital stay (six days versus 16 days, p < 0.001) than Group 1. One patient died (Group 1). There was no difference in late onset complications and no conversions to laparotomy in the laparoscopic group. Laparoscopic STC has a longer operative time, but improves short-term outcomes compared with open surgery. not relevant. not relevant.

  18. Surgeon Influence on Variation in Receipt of Contralateral Prophylactic Mastectomy for Women With Breast Cancer.

    Science.gov (United States)

    Katz, Steven J; Hawley, Sarah T; Hamilton, Ann S; Ward, Kevin C; Morrow, Monica; Jagsi, Reshma; Hofer, Timothy P

    2018-01-01

    Rates of contralateral prophylactic mastectomy (CPM) have markedly increased but we know little about the influence of surgeons on variability of the procedure in the community. To quantify the influence of the attending surgeon on rates of CPM and clinician attitudes that explained it. In this population-based survey study, we identified 7810 women with stages 0 to II breast cancer treated in 2013 to 2015 through the Surveillance, Epidemiology, and End Results registries of Georgia and Los Angeles County. Surveys were sent approximately 2 months after surgery. Surveys were also sent to 488 attending surgeons identified by the patients. We conducted multilevel analyses to examine the impact of surgeon influence on variations in patient receipt of CPM using information from patient and surgeon surveys merged to Surveillance, Epidemiology, and End Results data. A total of 5080 women responded to the survey (70% response rate), and 377 surgeons responded (77% response rate). The mean (SD) age of responding women was 61.9 (11) years; 28% had an increased risk of second primary cancer, and 16% received CPM. Half of surgeons (52%) practiced for more than 20 years and 30% treated more than 50 new patients with breast cancer annually. Attending surgeon explained a large amount (20%) of the variation in CPM, controlling for patient factors. The odds of a patient receiving CPM increased almost 3-fold (odds ratio, 2.8; 95% CI, 2.1-3.4) if she saw a surgeon with a practice approach 1 SD above a surgeon with the mean CPM rate (independent of age, diagnosis date, BRCA status, and risk of second primary). One-quarter (25%) of the surgeon influence was explained by attending attitudes about initial recommendations for surgery and responses to patient requests for CPM. The estimated rate of CPM was 34% for surgeons who least favored initial breast conservation and were least reluctant to perform CPM vs 4% for surgeons who most favored initial breast conservation and were most

  19. Surgeon influence on receipt of contralateral prophylactic mastectomy: Does it matter who you see for breast cancer surgery?

    Science.gov (United States)

    Katz, Steven J.; Hawley, Sarah T.; Hamilton, Ann S.; Ward, Kevin C.; Morrow, Monica; Jagsi, Reshma; Hofer, Timothy P.

    2018-01-01

    Importance Rates of contralateral prophylactic mastectomy (CPM) have markedly increased but we know little about the influence of surgeons on variability of the procedure in the community. Objective To quantify the influence of attending surgeon on rates of CPM and clinician attitudes that explained it. Design and Setting Population-based survey study in Georgia and Los Angeles County. Participants We identified 7810 women with stages 0-II breast cancer treated in 2013–15 through the Surveillance, Epidemiology, and End Results (SEER) registries of Georgia and Los Angeles County. Surveys were sent approximately 2 months after surgery, (70% response rate, n=5080). Surveys were also sent to 488 attending surgeons identified by the patients, of whom 377 responded (77% response rate). Main Outcomes and Measures We conducted multilevel analyses to examine the impact of surgeon influence on variations in patient receipt of CPM using information from patient and surgeon surveys merged to SEER data. Results The patient mean age was 62; 30% had an increased risk of 2nd primary cancer, and 16% received CPM. Half of surgeons (52%) practiced for >20 years and 30% treated >50 new breast cancer patients annually. Attending surgeon explained a large amount (20%) of the variation in CPM controlling for patient factors. The odds of a patient receiving CPM increased almost 3-fold (OR 2.8, 95% CI 2.1,3.4) if she saw a surgeon with a practice approach one standard deviation above a surgeon with the average CPM rate (independent of age, diagnosis date, BRCA status and risk of 2nd primary). One quarter (25%) of the surgeon influence was explained by attending attitudes about initial recommendations for surgery and responses to patient requests for CPM. The estimated rate of CPM was 34% for surgeons who least favored initial breast conservation and were least reluctant to perform CPM vs 4% for surgeons who most favored initial breast conservation and were most reluctant to perform CPM

  20. Patient Reactions to Surgeon Recommendations About Contralateral Prophylactic Mastectomy for Treatment of Breast Cancer.

    Science.gov (United States)

    Katz, Steven J; Janz, Nancy K; Abrahamse, Paul; Wallner, Lauren P; Hawley, Sarah T; An, Lawrence C; Ward, Kevin C; Hamilton, Ann S; Morrow, Monica; Jagsi, Reshma

    2017-07-01

    Guidelines assert that contralateral prophylactic mastectomy (CPM) should be discouraged in patients without an elevated risk for a second primary breast cancer. However, little is known about the impact of surgeons discouraging CPM on patient care satisfaction or decisions to seek treatment from another clinician. To examine the association between patient report of first-surgeon recommendation against CPM and the extent of discussion about it with 3 outcomes: patient satisfaction with surgery decisions, receipt of a second opinion, and receipt of surgery by a second surgeon. This population-based survey study was conducted in Georgia and California. We identified 3880 women with stages 0 to II breast cancer treated in 2013-2014 through the Surveillance, Epidemiology, and End Results registries of Georgia and Los Angeles County. Surveys were sent approximately 2 months after surgery (71% response rate, n = 2578). In this analysis conducted from February to May 2016, we included patients with unilateral breast cancer who considered CPM (n = 1140). Patients were selected between July 2013 and September 2014. We examined report of surgeon recommendations, level of discussion about CPM, satisfaction with surgical decision making, receipt of second surgical opinion, and surgery from a second surgeon. The mean (SD) age of patients included in this study was 56 (10.6) years. About one-quarter of patients (26.7%; n = 304) reported that their first surgeon recommended against CPM and 30.1% (n = 343) reported no substantial discussion about CPM. Dissatisfaction with surgery decision was uncommon (7.6%; n = 130), controlling for clinical and demographic characteristics. One-fifth of patients (20.6%; n = 304) had a second opinion about surgical options and 9.8% (n = 158) had surgery performed by a second surgeon. Dissatisfaction was very low (3.9%; n = 42) among patients who reported that their surgeon did not recommend against CPM but

  1. Laparoscopic and open subtotal colectomies have similar short-term results.

    Science.gov (United States)

    Hoogenboom, Froukje J; Bosker, Robbert J I; Groen, Henk; Meijerink, Wilhelmus J H J; Lamme, Bas; Pierie, Jean Pierre E N

    2013-01-01

    Laparoscopic subtotal colectomy (STC) is a complex procedure. It is possible that short-term benefits for segmental resections cannot be attributed to this complex procedure. This study aims to assess differences in short-term results for laparoscopic versus open STC during a 15-year single-institute experience. We reviewed consecutive patients undergoing laparoscopic or open elective or subacute STC from January 1997 to December 2012. Fifty-six laparoscopic and 50 open STCs were performed. The operation time was significantly longer in the laparoscopic group, median 266 min (range 121-420 min), compared to 153 min (range 90-408 min) in the open group (p < 0.001). Median hospital stay showed no statistical difference, 14 days (range 1-129 days) in the laparoscopic and 13 days (range 1-85 days) in the open group. Between-group postoperative complications were not statistically different. Laparoscopic STC has short-term results similar to the open procedure, except for a longer operation time. The laparoscopic approach for STC is therefore only advisable in selected patients combined with extensive preoperative counseling. Copyright © 2013 S. Karger AG, Basel.

  2. Bioleaching of two different genetic types of chalcopyrite and their comparative mineralogical assessment.

    Science.gov (United States)

    Deng, Sha; Gu, Guohua; Ji, Jing; Xu, Baoke

    2018-02-01

    The bioleaching of two different genetic types of chalcopyrite by the moderate thermophile Sulfobacillus thermosulfidooxidans was investigated by leaching behaviors elucidation and their comparative mineralogical assessment. The leaching experiment showed that the skarn-type chalcopyrite (STC) revealed a much faster leaching rate with 33.34% copper extracted finally, while only 23.53% copper was bioleached for the porphyry-type chalcopyrite (PTC). The mineralogical properties were analyzed by XRD, SEM, XPS, and Fermi energy calculation. XRD indicated that the unit cell volume of STC was a little larger than that of PTC. SEM indicated that the surface of STC had more steps and ridges. XPS spectra showed that Cu(I) was the dominant species of copper on the surfaces of the two chalcopyrite samples, and STC had much more copper with lower Cu 2p 3/2 binding energy. Additionally, the Fermi energy of STC was much higher than that of PTC. These mineralogical differences were in good agreement with the bioleaching behaviors of chalcopyrite. This study will provide some new information for evaluating the oxidation kinetics of chalcopyrite.

  3. Stanniocalcin-1 protects retinal ganglion cells by inhibiting apoptosis and oxidative damage.

    Directory of Open Access Journals (Sweden)

    Sang Jin Kim

    Full Text Available Optic neuropathy including glaucoma is one of the leading causes of irreversible vision loss, and there are currently no effective therapies. The hallmark of pathophysiology of optic neuropathy is oxidative stress and apoptotic death of retinal ganglion cells (RGCs, a population of neurons in the central nervous system with their soma in the inner retina and axons in the optic nerve. We here tested that an anti-apoptotic protein stanniocalcin-1 (STC-1 can prevent loss of RGCs in the rat retina with optic nerve transection (ONT and in cultures of RGC-5 cells with CoCl2 injury. We found that intravitreal injection of STC-1 increased the number of RGCs in the retina at days 7 and 14 after ONT, and decreased apoptosis and oxidative damage. In cultures, treatment with STC-1 dose-dependently increased cell viability, and decreased apoptosis and levels of reactive oxygen species in RGC-5 cells that were exposed to CoCl2. The expression of HIF-1α that was up-regulated by injury was significantly suppressed in the retina and in RGC-5 cells by STC-1 treatment. The results suggested that intravitreal injection of STC-1 might be a useful therapy for optic nerve diseases in which RGCs undergo apoptosis through oxidative stress.

  4. Analisis Potensi Daerah Melalui Metode Document Clustering Laporan Pelaksanaan Kegiatan Kuliah Kerja Nyata-Pembelajaran Pemberdayaan Masyarakat

    Directory of Open Access Journals (Sweden)

    Dyah Mustika

    2015-05-01

    Full Text Available Kuliah Kerja Nyata Pembelajaran Pemberdayaan Masyarakat (KKN-PPM adalah salah satu bentuk pengabdian UGM yang dilakukan oleh mahasiswanya kepada masyarakat secara langsung. Selama melaksanakan KKN, mahasiswa menyusun dan melaksanakan program kegiatan yang berguna bagi pemberdayaan masyarakat. Setelah selesai, mahasiswa diwajibkan membuat laporan tentang pelaksanaan kegiatan yang telah dilakukan. Dokumen laporan pelaksanaan kegiatan KKN yang terkumpul sudah sangat banyak tetapi belum dimanfaatkan secara maksimal. Laporan ini sebenarnya dapat menjadi sebuah sumber infromasi. Salah satu informasi yang bisa digali dari dokumen laporan tersebut adalah informasi tentang potensi daerah lokasi KKN. Penambangan informasi dari dokumen dapat dilakukan dengan text mining. Penelitian ini bertujuan untuk menambang informasi tentang potensi daerah dari dokumen laporan pelaksanaan kegiatan KKN-PPM menggunakan salah satu metode pada text mining, yaitu document clustering. Clustering dilakukan dengan dua pendekatan yaitu, STC dan LINGO, menggunakan Carrot2 Workbench. Penggunaan dua algoritma ini dimaksudkan untuk memperoleh perbandingan algoritma yang memberikan hasil lebih baik dalam penggambaran potensi daerah lokasi KKN-PPM UGM. Hasil dari penelitian ini menunjukkan bahwa algoritma LINGO lebih baik dalam memberikan gambaran tentang potensi daerah dibandingkan algoritma STC. LINGO memunculkan label klaster yang bertema potensi daerah lebih banyak dibanding STC. Dari evaluasi pada penelitian ini, LINGO menghasilkan nilai F-Measure 70%, dua kali lebih tinggi daripada STC yang hanya 33%. Kata Kunci— KKN-PPM UGM, document clustering, STC, LINGO, Carrot2

  5. Development from childhood to adulthood increases morphological and functional inter-individual variability in the right superior temporal cortex.

    Science.gov (United States)

    Bonte, Milene; Frost, Martin A; Rutten, Sanne; Ley, Anke; Formisano, Elia; Goebel, Rainer

    2013-12-01

    We study the developmental trajectory of morphology and function of the superior temporal cortex (STC) in children (8-9 years), adolescents (14-15 years) and young adults. We analyze cortical surface landmarks and functional MRI (fMRI) responses to voices, other natural categories and tones and examine how hemispheric asymmetry and inter-subject variability change across age. Our results show stable morphological asymmetries across age groups, including a larger left planum temporale and a deeper right superior temporal sulcus. fMRI analyses show that a rightward lateralization for voice-selective responses is present in all groups but decreases with age. Furthermore, STC responses to voices change from being less selective and more spatially diffuse in children to highly selective and focal in adults. Interestingly, the analysis of morphological landmarks reveals that inter-subject variability increases during development in the right--but not in the left--STC. Similarly, inter-subject variability of cortically-realigned functional responses to voices, other categories and tones increases with age in the right STC. Our findings reveal asymmetric developmental changes in brain regions crucial for auditory and voice perception. The age-related increase of inter-subject variability in right STC suggests that anatomy and function of this region are shaped by unique individual developmental experiences. © 2013.

  6. Efficacy of proximal colectomy for surgical management of right-sided first colorectal cancer in Lynch Syndrome mutation carriers.

    Science.gov (United States)

    Hiatt, Molly J; Casey, Murray Joseph; Lynch, Henry T; Snyder, Carrie L; Stacey, Mark; Walters, Ryan W

    2017-11-08

    This study analyzes the occurrence of colorectal cancer (CRC) in Lynch syndrome (LS) mutation carriers, interval until diagnosis of metachronous CRC, and survival after proximal colectomy (PC) compared with total (TC) and subtotal colectomy (STC) for right-sided first CRC in LS mutation carriers. Sixty-four LS mutation carriers with right-sided first CRC treated with PC or TC + STC were confirmed by clinical records. Bivariate analyses were examined for significance and life tables were generated for risk of metachronous CRC and survival estimates following surgery. One of 16 (6.3%) mutation carriers treated with TC + STC developed subsequent CRC compared with 13/48 (27%) treated by PC. There was no significant difference in survival estimates between PC compared with TC + STC through 25 years after surgery. Risk of subsequent CRC and survival estimates following PC and TC + STC should be considered in surgical management of right-sided first CRC in LS mutation carriers. Lynch syndrome mutation carriers are still at 27% risk for metachronous colorectal cancer after proximal colectomy for right-sided first colorectal cancers, but this study found no difference in survival through 25 years follow-up compared with those treated with total and subtotal colectomy. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Characteristics and synergistic effects of co-combustion of carbonaceous wastes with coal.

    Science.gov (United States)

    Onenc, Sermin; Retschitzegger, Stefan; Evic, Nikola; Kienzl, Norbert; Yanik, Jale

    2018-01-01

    This study presents combustion behavior and emission results obtained for different fuels: poultry litter (PL) and its char (PLC), scrap tires (ST) and its char (STC) and blends of char/lignite (PLC/LIG and STC/LIG). The combustion parameters and emissions were investigated via a non-isothermal thermogravimetric method and experiments in a lab-scale reactor. Fuel indexes were used for the prediction of high temperature corrosion risks and slagging potentials of the fuels used. The addition of chars to lignite caused a lowering of the combustion reactivity (anti-synergistic effect). There was a linear correlation between the NO x emissions and the N content of the fuel. The form of S and the concentrations of alkali metals in the fuel had a strong effect on the extent of SO 2 emissions. The use of PL and PLC in blends reduced SO 2 emissions and sulphur compounds in the fly ash. The 2S/Cl ratio in the fuel showed that only PLC and STC/PLC would show a risk of corrosion during combustion. The ratio of basic to acidic oxides in fuel indicated that ST, STC and STC/LIG have low slagging potential. The molar (Si+P+K)/(Ca+Mg) ratio, which was used for PL, PLC and PLC containing blends, showed that the ash melting temperatures of these fuels would be higher than 1000 °C. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Examining the interrelationships between social anxiety, smoking to cope, and cigarette craving.

    Science.gov (United States)

    Watson, Noreen L; VanderVeen, Joseph W; Cohen, Lee M; DeMarree, Kenneth G; Morrell, Holly E R

    2012-08-01

    Smokers with symptoms of social anxiety often report smoking as a way to cope with negative affect. These individuals have lower success rates when attempting cessation compared with the general population. However, there is a paucity of research examining the role of social anxiety in nicotine dependence. The present study explored the relationships between symptoms of social anxiety, smoking to cope with these symptoms during social situations (STC), and cigarette craving. Thirty-eight participants completed measures of social anxiety and STC at baseline. Cigarette craving was subsequently assessed pre and post exposure to smoking-related images during periods of nicotine satiation and deprivation. Regression analyses revealed that greater symptoms of social anxiety predicted the frequency of STC behaviors and the number of cigarettes participants thought they would need in order to feel more comfortable in social situations. Symptoms of social anxiety and several behaviors associated with STC (e.g., avoiding social situations in which smoking is not permitted) predicted increases in craving during nicotine deprivation, but not satiation. These findings suggest that symptoms of social anxiety and STC behaviors may play a role in the maintenance of smoking behaviors. Further, targeting symptoms of social anxiety within the context of smoking cessation treatment may be particularly helpful and may improve the rates of smoking cessation among individuals with symptoms of social anxiety. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. Changes in Pain Modulation Occur Soon After Whiplash Trauma but are not Related to Altered Perception of Distorted Visual Feedback.

    Science.gov (United States)

    Daenen, Liesbeth; Nijs, Jo; Cras, Patrick; Wouters, Kristien; Roussel, Nathalie

    2014-09-01

    Widespread sensory hypersensitivity has been observed in acute whiplash associated disorders (WAD). Changes in descending pain modulation take part in central sensitization. However, endogenous pain modulation has never been investigated in acute WAD. Altered perception of distorted visual feedback has been observed in WAD. Both mechanisms (ie, pain modulation and perception of distorted visual feedback) may be different components of one integrated system orchestrated by the brain. This study evaluated conditioned pain modulation (CPM) in acute WAD. Secondly, we investigated whether changes in CPM are associated with altered perception of distorted visual feedback. Thirty patients with acute WAD, 35 patients with chronic WAD and 31 controls were subjected to an experiment evaluating CPM and a coordination task inducing visual mediated changes between sensory feedback and motor output. A significant CPM effect was observed in acute WAD (P = 0.012 and P = 0.006), which was significantly lower compared to controls (P = 0.004 and P = 0.020). No obvious differences in CPM were found between acute and chronic WAD (P = 0.098 and P = 0.041). Changes in CPM were unrelated to altered perception of distorted visual feedback (P > 0.01). Changes in CPM were observed in acute WAD, suggesting less efficient pain modulation. The results suggest that central pain and sensorimotor processing underlie distinctive mechanisms. © 2013 World Institute of Pain.

  10. Lean mass predicts conditioned pain modulation in adolescents across weight status.

    Science.gov (United States)

    Stolzman, S; Hoeger Bement, M

    2016-07-01

    There is a wide continuum of conditioned pain modulation (CPM) in adults with older adults experiencing an attenuated CPM response compared with younger adults. Less is known for adolescents and the role of anthropometrics. Fifty-six adolescents (15.1 ± 1.8 years; 32 normal weight and 24 overweight/obese; 27 boys) completed in a CPM session that included anthropometric testing. Pressure pain thresholds were measured at the nailbed and deltoid muscle (test stimuli) with the foot submerged in a cool or ice water bath (conditioning stimulus). Weight status, body composition (Dual-energy X-ray absorptiometry scan), physical activity levels and clinical pain were also evaluated. The CPM response in adolescents was similar across sites (nailbed vs. deltoid), weight status (normal vs. overweight/obese) and sex. CPM measured at the deltoid muscle was positively associated with left arm lean mass but not fat mass; lean mass of the arm uniquely predicted 10% of the CPM magnitude. CPM measured at the nailbed was positively correlated with physical activity levels. These results suggest that lean mass and physical activity levels may contribute to endogenous pain inhibition in adolescents across weight status. © 2016 European Pain Federation - EFIC®

  11. Impacts of a care process model and inpatient electrophysiology service on cardiovascular implantable electronic device infections: a preliminary evaluation.

    Science.gov (United States)

    Tan, Eugene M; Nagpal, Avish; DeSimone, Daniel C; Anderson, Brenda; Linderbaum, Jane; De Ziel, Thomas; Li, Zhuo; Sohail, Muhammad R; Cha, Yong-Mei; Loomis, Erica; Espinosa, Raul; Friedman, Paul A; Greason, Kevin; Schiller, Henry; Virk, Abinash; Wilson, Walter R; Steckelberg, James M; Baddour, Larry M

    2017-10-01

    Cardiovascular implantable electronic device infection (CIEDI) rates are rising. To improve outcomes, our institution developed an online care process model (CPM) and a specialized inpatient heart rhythm service (HRS). This retrospective review compared hospital length of stay (LOS), mortality, and times to subspecialty consultation and procedures before and after CPM and HRS availability. CPM use was associated with shortened time to surgical consultation (median 2 days post-CPM vs. 3 days pre-CPM, p = 0.0152), pocket closure (median 4 vs. 5 days, p < 0.0001), and days to new CIED implant (median 7 vs. 8 days, p = 0.0126). Post-HRS patients were more likely to have a surgical consultation (OR 7.01, 95% CI 1.56-31.5, p = 0.011) and shortened time to pocket closure (coefficient - 2.21 days, 95% CI - 3.33 to - 1.09, p < 0.001), compared to pre-HRS. The CPM and HRS were associated with favorable outcomes, but further integration of CPM features into hospital workflow is needed.

  12. Predictors of contralateral prophylactic mastectomy and the impact on breast reconstruction.

    Science.gov (United States)

    Pinell-White, Ximena A; Kolegraff, Keli; Carlson, Grant W

    2014-01-01

    Contralateral prophylactic mastectomy (CPM) is being performed with increased frequency. Predictors of CPM and their impact on breast reconstruction are examined. A retrospective review of a dually trained oncologic and plastic surgeon's experience with patients undergoing total mastectomy from 2002 to 2012 was performed. Patients who underwent bilateral therapeutic mastectomies or who had previous contralateral mastectomy were excluded from this series. Four hundred forty-six patients were treated with total mastectomy and 174 (39%) underwent CPM. The incidence of CPM nearly tripled over the period studied. Compared to women treated with unilateral mastectomy, women who elected for CPM were younger (mean age, 50.4 vs 56.8 years, P mastectomy. Incidental contralateral cancers were discovered in 4% of women who underwent CPM (n = 7), lobular carcinoma in situ in 2.3% (n = 4), and atypical lesions in an additional 11.6% (n = 20). Women who underwent CPM favored reconstruction with breast implants (60.9% vs 17.3%), whereas the transverse rectus abdominis musculocutaneous flap predominated among their unilateral counterparts (38.6% vs 15.5%). Among women who underwent immediate breast reconstruction, the addition of a contralateral procedure expectedly increased breast complication rates (50.3% vs 35.0%, P = 0.007), especially the more severe complications that required hospitalization or reoperation (18.6% vs 5.0%, P procedure is significant.

  13. Biofeedback relaxation for pain associated with continuous passive motion in Taiwanese patients after total knee arthroplasty.

    Science.gov (United States)

    Wang, Tsae-Jyy; Chang, Ching-Fen; Lou, Meei-Fang; Ao, Man-Kuan; Liu, Chiung-Chen; Liang, Shu-Yuan; Wu, Shu-Fang Vivienne; Tung, Heng-Hsing

    2015-02-01

    Effective pain management is crucial for patient recovery after total knee arthroplasty (TKA). Biofeedback therapy, which encourages relaxation and helps alleviate various conditions associated with stress, may help to decrease postoperative pain in patients undergoing TKA. A quasi- experimental design was used to investigate the efficacy of a biofeedback relaxation intervention in reducing pain associated with postoperative continuous passive motion (CPM) therapy. Sixty-six patients admitted to a general hospital in Taiwan for TKA were recruited and randomly assigned to the intervention or control group. The intervention group received biofeedback training twice daily for 5 days, concurrent with CPM therapy, whereas the control group did not receive the biofeedback intervention. Pain was measured using a numeric rating scale before and after each CPM therapy session on postoperative days 1 through 5. The CPM-elicited pain score was calculated by subtracting the pre-CPM pain score from the post-CPM pain score. Results of repeated-measures analysis of variance showed intervention group reported significantly less pain caused by CPM than did the control group (f = 29.70, p biofeedback relaxation, a non-invasive and non-pharmacological intervention, as a complementary treatment option for pain management in this population. © 2014 Wiley Periodicals, Inc.

  14. Short-term cortical plasticity induced by conditioning pain modulation

    DEFF Research Database (Denmark)

    Egsgaard, Line Lindhardt; Buchgreitz, Line; Wang, Li

    2012-01-01

    To investigate the effects of homotopic and heterotopic conditioning pain modulation (CPM) on short-term cortical plasticity. Glutamate (tonic pain) or isotonic saline (sham) was injected in the upper trapezius (homotopic) and in the thenar (heterotopic) muscles. Intramuscular electrical stimulat......To investigate the effects of homotopic and heterotopic conditioning pain modulation (CPM) on short-term cortical plasticity. Glutamate (tonic pain) or isotonic saline (sham) was injected in the upper trapezius (homotopic) and in the thenar (heterotopic) muscles. Intramuscular electrical......, and after homotopic and heterotopic CPM versus control. Peak latencies at N100, P200, and P300 were extracted and the location/strength of corresponding dipole current sources and multiple dipoles were estimated. Homotopic CPM caused hypoalgesia (P = 0.032, 30.6% compared to baseline) to electrical...... stimulation. No cortical changes were found for homotopic CPM. A positive correlation at P200 between electrical pain threshold after tonic pain and the z coordinate after tonic pain (P = 0.032) was found for homotopic CPM. For heterotopic CPM, no significant hypoalgesia was found and a dipole shift of the P...

  15. Physical Activity May Be Associated with Conditioned Pain Modulation in Women but Not Men among Healthy Individuals

    Directory of Open Access Journals (Sweden)

    Yukiko Shiro

    2017-01-01

    Full Text Available Background. Conditioned pain modulation (CPM, a phenomenon also known as diffuse noxious inhibitory control, is thought to be affected by various factors, including sex and level of physical activity. However, the involvement of these factors in CPM remains unclear. Methods. Eighty-six healthy young subjects (M/F, 43/43 participated in this study. Participants were assessed on the basis of their mechanical pressure pain threshold (PPT, CPM response, body mass index (BMI, basal metabolic rate (BMR, and duration of moderate-to-vigorous physical activity (MVPA over a week, using a motion counter. Response to CPM was evaluated as PPT during painful cold stimulation relative to baseline PPT. Results. Men showed significantly higher baseline PPT than women; however, this difference was no longer significant after controlling for confounders. Stepwise multiple linear regression analyses revealed BMR to be a significant contributor towards baseline PPT in the entire study population. In contrast, although there were no significant contributors to CPM response among men and in the overall study group, MVPA was positively associated with CPM response among women (β = 0.397. Conclusions. These results suggest that, among healthy young individuals, CPM response may be associated with moderate-to-vigorous physical activity in women but not in men.

  16. Imperfection of the radiation protection for thyroid

    International Nuclear Information System (INIS)

    Anon.

    2014-01-01

    The screening level of the body surface contamination at radiation emergency medicine is set to be 40 Bq/cm"2. This level corresponds to 10,000-13,000 cpm by standard GM survey meters with large aperture, and is regarded to be an index for iodine prophylaxis. Following this guideline, Nuclear Safety Commission of Japan (of those days) gave advice for the local headquarters to give iodine tablets to persons whose dose rate exceeded 10,000 cpm at the nuclear accident of Fukushima Daiichi Nuclear Power Plant. This advice, however, did not be transmitted to the scene, and, in addition, by reason of a shortage of the water for decontamination, Fukushima Prefecture raised the screening level up to 100,000 cpm. Decontamination by partial wipe out was intended for persons whose dose rates were between 13,000 cpm and 100,000 cpm, but it was only incompletely conducted. Nuclear Safety Commission also raised the screening level from 10,000 cpm up to 100,000 cpm, and gave no indication to take iodine tablets. (J.P.N.)

  17. Controlled parts management

    International Nuclear Information System (INIS)

    Boyle, C.M.; Hidalgo, S.P.; Martinez, B.J.

    2004-01-01

    The Controlled Parts Management (CPM) system is based on industry standard practices for managing inventory. CPM is designed to record the movement of any type of inventory in a defined region referred to as an Account or SubAccount. The system is used to track the receiving, processing, storing and transfer of inventory parts. CPM provides information on parts, quantity and the exact location of the inventory. CPM is a barcode-based-part tracking system currently used to track controlled parts that are used in the R and D and testing of weapons; this tracking helps maintain the part pedigree that is required for certification of a weapon or weapon test. CPM includes bar code data collection software programmed into portable bar code readers for automating physical inventory services and remote transaction capture. CPM interfaces to other Engineering systems and supports a 'material content' of a weapons test through the test Bill of Materials and assignment of a unique inventory part in CPM. Additional functionality includes the ability to group or join parts, logically or physically and temporary or permanent, to represent discrete parts, containers, subassemblies and assemblies, and groupings.

  18. Factors associated with the increasing trend of contralateral prophylactic mastectomy among patients with ductal carcinoma in situ: Analysis of Surveillance, Epidemiology, and End Results data.

    Science.gov (United States)

    You, Qiuting; Chen, Kai; Li, Yudong; Lai, Jianguo; Fang, Yichao; Shen, Shiyu; Liu, Yicheng; Su, Fengxi; Yu, Fengyan

    2018-05-22

    Our study aimed to investigate the factors influencing trends of contralateral prophylactic mastectomy (CPM) among patients with unilateral ductal carcinoma in situ (DCIS). We used the Surveillance, Epidemiology, and End Results (SEER) data to identify patients with unilateral DCIS diagnosed from 1998 to 2013. Patients were categorized as breast-conserving surgery (BCS), Unilateral Mastectomy and CPM group. Univariate and multivariate logistic regressions were applied to assess the factors associated with undergoing CPM among mastectomy patients. The trends of CPM among mastectomy patients through year were presented by different subgroups of sociodemographic and pathological characteristics. Of those, 105326 patients with DCIS were identified, and 6370 patients underwent CPM. The proportion of CPM was 6.05% for all surgically-treated patients and 21.09% for mastectomy patients, and it increased more than six-fold between 1998 and 2013 (from 1.74% to 10.89% for all surgically-treated patients and from 5.44% to 37.47% for mastectomy patients). Younger age, white race, married status, smaller tumor size, positive ER and PR status were significantly associated with higher CPM proportion among mastectomy patients. The proportion of CPM was increasing through year, and the increasing trends were obvious in the subgroups of younger, white, married, metropolitan, with higher bachelor degree and higher median family income patients, while there were no apparent differences in the trends between subgroups of pathological characteristics. The trends of CPM among mastectomy patients were increasing through years and influenced by patients' sociodemographic characteristics, but not pathological characteristics. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Disorder-induced microscopic magnetic memory

    International Nuclear Information System (INIS)

    Pierce, M.S.; Buechler, C.R.; Sorensen, L.B.; Turner, J.J.; Kevan, S.D.; Jagla, E.A.; Deutsch, J.M.; Mai, T.; Narayan, O.; Davies, J.E.; Liu, K.; Dunn, J. Hunter; Chesnel, K.M.; Kortright, J.B.; Hellwig, O.; Fullerton, E.E.

    2005-01-01

    Using coherent x-ray speckle metrology, we have measured the influence of disorder on major loop return point memory (RPM) and complementary point memory (CPM) for a series of perpendicular anisotropy Co/Pt multilayer films. In the low disorder limit, the domain structures show no memory with field cycling - no RPM and no CPM. With increasing disorder, we observe the onset and the saturation of both the RPM and the CPM. These results provide the first direct ensemble-sensitive experimental study of the effects of varying disorder on microscopic magnetic memory and are compared against the predictions of existing theories

  20. Vectorization and parallelization of a production reactor assembly code

    International Nuclear Information System (INIS)

    Vujic, J.L.; Martin, W.R.; Michigan Univ., Ann Arbor, MI

    1991-01-01

    In order to use efficiently the new features of supercomputers, production codes, usually written 10 -20 years ago, must be tailored for modern computer architectures. We have chosen to optimize the CPM-2 code, a production reactor assembly code based on the collision probability transport method. Substantial speedup in the execution times was obtained with the parallel/vector version of the CPM-2 code. In addition, we have developed a new transfer probability method, which removes some of the modelling limitations of the collision probability method encoded in the CPM-2 code, and can fully utilize the parallel/vector architecture of a multiprocessor IBM 3090. (author)

  1. PRACTICAL IMPLICATIONS OF LOCATION-BASED SCHEDULING

    DEFF Research Database (Denmark)

    Andersson, Niclas; Christensen, Knud

    2007-01-01

    The traditional method for planning, scheduling and controlling activities and resources in construction projects is the CPM-scheduling, which has been the predominant scheduling method since its introduction in the late 1950s. Over the years, CPM has proven to be a very powerful technique...... that will be used in this study. LBS is a scheduling method that rests upon the theories of line-of-balance and which uses the graphic representation of a flowline chart. As such, LBS is adapted for planning and management of workflows and, thus, may provide a solution to the identified shortcomings of CPM. Even...

  2. A systematic methodology for the design of continuous active pharmaceutical ingredient production processes

    DEFF Research Database (Denmark)

    Cervera Padrell, Albert Emili; Gani, Rafiqul; Kiil, Søren

    2011-01-01

    Continuous pharmaceutical manufacturing (CPM) has emerged as a powerful technology to obtain higher reaction yields and improved separation efficiencies, potentially leading to simplified process flowsheets, reduced total costs, lower environmental impacts, and safer and more flexible production...... and representation, as well as on how to employ this knowledge for process (re-)design. The aim of this paper is to introduce a methodology that systematically identifies already existing PSE methods and tools which can assist in the design of CPM processes. This methodology has been applied to a process...... for the production of an API developed by H. Lundbeck A/S, demonstrating the mentioned potential benefits that CPM can offer....

  3. Vectorization and parallelization of a production reactor assembly code

    International Nuclear Information System (INIS)

    Vujic, J.L.; Martin, W.R.

    1991-01-01

    In order to efficiently use new features of supercomputers, production codes, usually written 10 - 20 years ago, must be tailored for modern computer architectures. We have chosen to optimize the CPM-2 code, a production reactor assembly code based on the collision probability transport method. Substantial speedups in the execution times were obtained with the parallel/vector version of the CPM-2 code. In addition, we have developed a new transfer probability method, which removes some of the modelling limitations of the collision probability method encoded in the CPM-2 code, and can fully utilize parallel/vector architecture of a multiprocessor IBM 3090. (author)

  4. Asymptomatic pontine and extra-pontine lesions in a patient with end-stage renal disease

    Directory of Open Access Journals (Sweden)

    Raj Kanwar Yadav

    2016-01-01

    Full Text Available Osmotic demyelination syndrome leading to central pontine/extra-pontine myelinolysis (CPM/EPM occurs mainly in patients with history of alcohol abuse, malnourishment, following liver transplantation and less commonly, in association with other systemic diseases. Asymptomatic CPM/EPM is rare. Patients with end-stage renal disease (ESRD who develop CPM/EPM are usually symptomatic with florid neurologic manifestations. Herein, we present a patient with ESRD on maintenance hemodialysis who was incidentally detected to have pontine and extra-pontine lesions suggestive of myelinolysis without any neurologic signs or symptoms.

  5. Hypoalgesia after exercise and the cold pressor test is reduced in chronic musculuskeletal pain patients with high pain sensitivity

    DEFF Research Database (Denmark)

    Vægter, Henrik Bjarke; Handberg, Gitte; Graven-Nielsen, Thomas

    2016-01-01

    OBJECTIVES: In chronic pain patients, impaired conditioned pain modulation (CPM) and exercise-induced hypoalgesia (EIH) have been reported. No studies have compared CPM and EIH in chronic musculoskeletal pain patients with high pain sensitivity (HPS) and low pain sensitivity (LPS). MATERIALS.......005). Pain tolerance increased after the cold pressor test and exercise in both groups (PCPM and EIH were partly impaired in chronic pain patients with high versus less pain sensitivity, suggesting that the CPM and EIH responses depend on the degree of pain sensitivity. This has clinical...

  6. Exercise does not produce hypoalgesia when performed immediately after a painful stimulus.

    Science.gov (United States)

    Gajsar, Hannah; Nahrwold, Katharina; Titze, Christina; Hasenbring, Monika I; Vaegter, Henrik B

    2018-04-25

    Exercise-induced hypoalgesia (EIH) and conditioned pain modulation (CPM) are assumed to reflect descending pain inhibition. Potential interactions between EIH and CPM may be important in the therapy of chronic pain, as reduced CPM and increased pain after exercise are frequently observed. This study compared the EIH response after CPM was activated using a cold pressor task with the EIH response after a control condition. Thirty-one participants (age: 27.7±9.8; 15 female) completed two sessions: a cold pressor task (CPT) session, i.e. testing EIH with preceding CPM activation induced using a 2 min CPT at approximately 2°C, and a control session, i.e. testing EIH after a control condition (2 min of quiet rest). EIH was induced using a 15 min bicycling exercise at a target heart rate corresponding to 75% VO2 max. Repeated measures ANOVAs on pressure pain thresholds (PPTs) at the hand, back and leg were used to determine the effects of exercise after the cold pressor test and control condition. Furthermore, correlations between CPM and EIH, in the CPT session as well as control session, were calculated at each assessment site. A significant time x condition interaction (F(1, 30)=43.61, pCPM at the hand (r=0.37, p=0.043). There was a moderate negative correlation of EIH in the CPT session and CPM at the hand (r=-0.50, p=0.004), and smaller negative correlations at the back (r=-0.37, p=0.036) and at the leg (r=-0.35, p=0.054). Attenuated EIH after the CPM activation in comparison to a control condition suggests that EIH and CPM may share underlying pain inhibitory mechanisms on a systemic level. This assumption is further supported by the finding of small to moderate significant correlations between EIH and CPM at the hand. The attenuated EIH response furthermore suggests that these mechanisms are exhaustible, i.e. that its effects decline after a certain amount of inhibition. In patients with chronic pain, assessing the current capacity of the descending pain

  7. Conditioned pain modulation is affected by occlusion cuff conditioning stimulus intensity, but not duration.

    Science.gov (United States)

    Smith, A; Pedler, A

    2018-01-01

    Various conditioned pain modulation (CPM) methodologies have been used to investigate diffuse noxious inhibitory control pain mechanisms in healthy and clinical populations. Occlusion cuff parameters have been poorly studied. We aimed to investigate whether occlusion cuff intensity and/or duration influenced CPM magnitudes. We also investigated the role of physical activity levels on CPM magnitude. Two studies were performed to investigate the role of intensity and duration of occlusion cuff conditioning stimulus on test stimulus (tibialis anterior pressure pain thresholds). In Study 1, conditioning stimulus intensity of 2/10 or 5/10 (duration CPM magnitude. In Study 1, 27 healthy volunteers (mean ± SD: 24.9 years (±4.5); eight female) demonstrated that an occlusion cuff applied to the upper arm eliciting 5/10 local pain resulted in a significant (mean ± SD: 17% ± 46%) increase in CPM magnitude, when compared to 2/10 intensity (-3% ± 38%, p = 0.026), whereas in Study 2, 25 healthy volunteers (22.5 years (±2.7); 13 female) demonstrated that 3 min of 2/10 CS intensity did not result in a significant change in CPM (p = 0.21). There was no significant relationship between physical activity levels and CPM in either study (p > 0.22). This study demonstrated that an occlusion cuff of 5/10 conditioning stimulus intensity, when compared to 2/10, significantly increased CPM magnitude. Maintaining 2/10 conditioning stimulus for 3 min did not increase CPM magnitude. Dysfunctional conditioned pain modulation (CPM) has been associated with poor health outcomes. Various factors can influence CPM outcomes. The role of occlusion cuff conditioning stimulus intensity and duration has not been previously investigated. Intensity (5/10), but not duration of lower intensity (2/10) conditioning stimulus, affects CPM magnitude. © 2017 European Pain Federation - EFIC®.

  8. Soft tissue chondroma: a rare tumor presenting as a cutaneous nodule

    Directory of Open Access Journals (Sweden)

    Dibakar Podder

    2015-04-01

    Full Text Available Soft tissue chondroma (STC, also known as extraskeletal chondroma or chondroma of soft parts is a benign cartilaginous tumor which arise de novo from soft tissue. Also, it is an extremely rare entity predominantly involving extremities, especially fingers. A 26 year old male presented with 3 year history of swelling in left index finger. On local examination a hard 2 × 2 cm swelling was seen over the volar aspect of left 2nd proximal phalanx. Swelling was mobile on contraction of tendons. X-ray showed a soft tissue shadow on volar aspect of left second proximal phalanx. Histopathology showed a well encapsulated, hypo cellular nodule composed of benign chondrocytes surrounded by hyaline chondroid matrix. Nuclear pleomorphism, mitosis or necrosis was not seen. Based on radiological and histopathological findings a diagnosis of STC was made. STC should be considered in patients with slow growing, soft tissue masses.

  9. Adaptive Space–Time Coding Using ARQ

    KAUST Repository

    Makki, Behrooz

    2015-09-01

    We study the energy-limited outage probability of the block space-time coding (STC)-based systems utilizing automatic repeat request (ARQ) feedback and adaptive power allocation. Taking the ARQ feedback costs into account, we derive closed-form solutions for the energy-limited optimal power allocation and investigate the diversity gain of different STC-ARQ schemes. In addition, sufficient conditions are derived for the usefulness of ARQ in terms of energy-limited outage probability. The results show that, for a large range of feedback costs, the energy efficiency is substantially improved by the combination of ARQ and STC techniques if optimal power allocation is utilized. © 2014 IEEE.

  10. Knowledge acquisition with domain experts on the aspects of use of visual variables in the Space Time Cube

    DEFF Research Database (Denmark)

    Kveladze, Irma; Kraak, Menno-Jan

    2013-01-01

    participants are selected purposefully based on the specific criteria in order to say something on the topic that has to be discussed (Nielsen, 1993). Accordingly, the main objective for focus group interview was to discuss the use of the visual variables based on the cartographic design theory (Bertin, 1983......The Space – Time Cube (STC) is a visual representation developed at the end of the 20th century for understanding the spatio-temporal aspects in human’s everyday life (Hägerstrand, 1970). Since its introduction, it has been widely used in a various discipline (Kraak, 2003; Demšar and Virrantaus...... to other visual representations. However, the usability metrics of the cartographic design theory for the STC content still remain to be unexplored. Therefore, this study particularly focused on the evaluation of the cartographic design aspects into the STC. This study was conducted in two different...

  11. Performance Stabilization of CdTe PV Modules using Bias and Light

    Energy Technology Data Exchange (ETDEWEB)

    Silverman, T. J.; Deceglie, M. G.; Marion, B.; Kurtz, S. R.

    2014-07-01

    Reversible performance changes due to light exposure frustrate repeatable performance measurements on CdTe PV modules. It is common to use extended light-exposure to ensure that measurements are representative of outdoor performance. We quantify the extent to which such a light-exposed state depends on module temperature and consider bias in the dark to aid in stabilization. We evaluate the use of dark forward bias to bring about a performance state equivalent to that obtained with light exposure, and to maintain a light-exposed state prior to STC performance measurement. Our results indicate that the most promising method for measuring a light-exposed state is to use light exposure at controlled temperature followed by prompt STC measurement with a repeatable time interval between exposure and the STC measurement.

  12. Prognostic value of cerebral tissue oxygen saturation during neonatal extracorporeal membrane oxygenation.

    Directory of Open Access Journals (Sweden)

    Marie-Philippine Clair

    Full Text Available Extracorporeal membrane oxygenation support is indicated in severe and refractory respiratory or circulatory failures. Neurological complications are typically represented by acute ischemic or hemorrhagic lesions, which induce higher morbidity and mortality. The primary goal of this study was to assess the prognostic value of cerebral tissue oxygen saturation (StcO2 on mortality in neonates and young infants treated with ECMO. A secondary objective was to evaluate the association between StcO2 and the occurrence of cerebral lesions.This was a prospective study in infants < 3 months of age admitted to a pediatric intensive care unit and requiring ECMO support.The assessment of cerebral perfusion was made by continuous StcO2 monitoring using near-infrared spectroscopy (NIRS sensors placed on the two temporo-parietal regions. Neurological lesions were identified by MRI or transfontanellar echography.Thirty-four infants <3 months of age were included in the study over a period of 18 months. The ECMO duration was 10±7 days. The survival rate was 50% (17/34 patients, and the proportion of brain injuries was 20% (7/34 patients. The mean StcO2 during ECMO in the non-survivors was reduced in both hemispheres (p = 0.0008 right, p = 0.03 left compared to the survivors. StcO2 was also reduced in deceased or brain-injured patients compared to the survivors without brain injury (p = 0.002.StcO2 appears to be a strong prognostic factor of survival and of the presence of cerebral lesions in young infants during ECMO.

  13. Secondary tax and its effect on the cost of capital and shareholder value of South African JSE listed companies

    Directory of Open Access Journals (Sweden)

    J. H.v.H De Wet

    2008-12-01

    Full Text Available Background: The introduction of a secondary tax on companies (STC and the lowering of the normal income tax rate in 1993 constituted a dramatic change in the tax structure of South African organisations. The original intention of these changes was to encourage organisations to re-invest profits to make use of capital investment opportunities. It was also anticipated that these tax changes would lower the cost of capital of organisations. Problem investigated: Announcements during the 2007 budget again raised questions about how the proposed changes in STC would affect the value of organisations. The impact of these tax changes has been the topic of some speculation in the absence of concrete research results to date. Purpose: The purpose of this study was to investigate the effect of these tax changes and all subsequent changes since 1993 on the cost of capital and shareholder value. Approach: A model of a hypothetical company, representing the 'average' listed South African organisation was used to determine the effect of the introduction of STC and the changes to the STC and company tax rate on the cost of capital and the value of the organisation. Findings: The study found that, contrary to expectations, the tax changes actually caused the cost of capital to go up. Overall, the combined effect of the higher cost of capital and the lower company tax rate caused the theoretical value of organisations to increase, constituting an improvement of shareholder value. Value of research: It is the first local study that endeavoured to analyse and quantify the impact of the introduction of STC and the lowering of the company tax rate on the cost of capital and the value of organisations. Conclusion: The introduction of STC in and the lowering of the company tax rate in 1993, as well as changes to these two forms of taxes since then, seem to have been justified in terms of shareholder value creation.

  14. The effects of increasing levels of dietary garlic bulb on growth performance, systolic blood pressure, hematology, and ascites syndrome in broiler chickens.

    Science.gov (United States)

    Varmaghany, Saifali; Karimi Torshizi, Mohammad Amir; Rahimi, Shaban; Lotfollahian, Houshang; Hassanzadeh, Mohammad

    2015-08-01

    The effects of dietary garlic bulb were studied separately on hematological parameters, ascites incidence, and growth performance of an ascites susceptible broiler hybrid under both standard temperature conditions ( STC: ) and cold temperature conditions ( CTC: ). A total of 336 one-day-old male broiler chickens were allocated to 4 experimental groups with 4 replicates of 21 birds each under STC. In addition, the same grouping with another 336 birds was used for CTC. Under CTC, the birds were exposed to cold temperatures for induction of ascites. Experimental groups were defined by the inclusion of 0 (control), 5, 10 or 15 g/kg garlic bulbs in the diets under both STC and CTC. Growth performance, systolic blood pressure (as a measure of systemic arterial blood pressure), physiological and biochemical parameters, as well as ascites indices (right ventricle [ RV: ], total ventricle [ TV: ] weights, and RV/TV: ) were evaluated. Systolic blood pressure was determined using an indirect method with a sphygmomanometer, a pediatric cuff, and a Doppler device. The final body weight decreased quadratically (P = 0.003), with increasing garlic bulb levels in the diets under STC. The feed conversion ratio showed no significant differences among all groups under both STC and CTC. No significant differences were observed in total mortality and ascites-related mortality in all groups under STC, although total mortality (L: P = 0.01; Q: P = 0.001) and ascites-related mortality (L: P = 0.007; Q: P = 0.001) were significantly different among the diets under CTC. Under STC, the systolic blood pressure, packed cell volume, hemoglobin, RV, TV, and RV/TV did not vary significantly among the diets. However, red blood cell count and erythrocyte osmotic fragility decreased linearly (P garlic bulb levels in the diets under STC. Under CTC, the systolic blood pressure, packed cell volume, red blood cell count, and erythrocyte osmotic fragility decreased (P garlic levels. It is

  15. Continuing Development for Free-Piston Stirling Space Power Systems

    Science.gov (United States)

    Peterson, Allen A.; Qiu, Songgang; Redinger, Darin L.; Augenblick, John E.; Petersen, Stephen L.

    2004-02-01

    Long-life radioisotope power generators based on free-piston Stirling engines are an energy-conversion solution for future space applications. The high efficiency of Stirling machines makes them more attractive than the thermoelectric generators currently used in space. Stirling Technology Company (STC) has been developing free-piston Stirling machines for over 30 years, and its family of Stirling generators is ideally suited for reliable, maintenance-free operation. This paper describes recent progress and status of the STC RemoteGen™ 55 W-class Stirling generator (RG-55), presents an overview of recent testing, and discusses how the technology demonstration design has evolved toward space-qualified hardware.

  16. Laser characterisation of a 3D single-type column p-type prototype module read out with ATLAS SCT electronics

    International Nuclear Information System (INIS)

    Ehrich, T.; Kuehn, S.; Boscardin, M.; Dalla Betta, G.-F.; Eckert, S.; Jakobs, K.; Maassen, M.; Parzefall, U.; Piemonte, C.; Pozza, A.; Ronchin, S.; Zorzi, N.

    2007-01-01

    In this paper measurements of a 3D single-type column (3D-stc) microstrip silicon device are shown. The 3D-stc sensor has n-type columns in p-type substrate. It has been connected to an ATLAS SCT ABCD3T chip and is readout with ATLAS SCT electronics at 40 MHz. Spatial measurements were done with a laser setup to investigate the expected low field region in 3D devices. An influence of the p-stops on the collected charge has been observed

  17. Laser characterisation of a 3D single-type column p-type prototype module read out with ATLAS SCT electronics

    Energy Technology Data Exchange (ETDEWEB)

    Ehrich, T. [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder Str. 3, 79104 Freiburg (Germany); Kuehn, S. [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder Str. 3, 79104 Freiburg (Germany)], E-mail: susanne.kuehn@physik.uni-freiburg.de; Boscardin, M.; Dalla Betta, G.-F. [ITC-irst Trento, Microsystems Division, via Sommarive, 18 38050 Povo di Trento (Italy); Eckert, S.; Jakobs, K.; Maassen, M.; Parzefall, U. [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder Str. 3, 79104 Freiburg (Germany); Piemonte, C.; Pozza, A.; Ronchin, S.; Zorzi, N. [ITC-irst Trento, Microsystems Division, via Sommarive, 18 38050 Povo di Trento (Italy)

    2007-12-11

    In this paper measurements of a 3D single-type column (3D-stc) microstrip silicon device are shown. The 3D-stc sensor has n-type columns in p-type substrate. It has been connected to an ATLAS SCT ABCD3T chip and is readout with ATLAS SCT electronics at 40 MHz. Spatial measurements were done with a laser setup to investigate the expected low field region in 3D devices. An influence of the p-stops on the collected charge has been observed.

  18. Terapia manual en el síndrome del túnel carpiano

    OpenAIRE

    Zurrido Saiz, Rafael Gaia; Polanco Torrico, Juan

    2017-01-01

    El síndrome del túnel carpiano (STC) es la neuropatía periférica más común y supone el 90% de todas las neuropatías por atrapamiento. Actualmente El objetivo de la presente revisión es determinar la eficacia de la terapia manual (TM) en el tratamiento del STC. Para ello, se realizó una búsqueda bibliográfica en las bases de datos PubMed, PEDro, Cochrane, Scopus, Web of Knowledge y Scielo de ensayos clínicos aleatorizados (ECA) publicados hasta diciembre de 2016. Las palabras cl...

  19. Evaluation of Water Injection Effect on NO(x) Formation for a Staged Gas Turbine Combustor

    Science.gov (United States)

    Fan, L.; Yang, S. L.; Kundu, K. P.

    1996-01-01

    NO(x) emission control by water injection on a staged turbine combustor (STC) was modeled using the KIVA-2 code with modification. Water is injected into the rich-burn combustion zone of the combustor by a single nozzle. Parametric study for different water injection patterns was performed. Results show NO(x) emission will decrease after water being injected. Water nozzle location also has significant effect for NO formation and fuel ignition. The chemical kinetic model is also sensitive to the excess water. Through this study, a better understanding of the physics and chemical kinetics is obtained, this will enhance the STC design process.

  20. ·: ORIGINAL ARTICLES

    African Journals Online (AJOL)

    this figure is low compared with figures from other studies in .... a long summer period, high temperatures and wind are major factors contributing to the production of ..... Eragrostis grasses. Values shown are mean cpm of triplicate wells as.

  1. Download this PDF file

    African Journals Online (AJOL)

    abp

    2017-06-28

    Jun 28, 2017 ... the first 12 hours of life than CRP in this setting, however, its low specificity relative to .... (feeding intolerance, lethargy, temperature instability, tachypnea, .... example is the criteria based on tachypnea (rate >60 cpm), as most.

  2. Centropontine myelinolysis related to refeeding syndrome in an adolescent suffering from anorexia nervosa.

    Science.gov (United States)

    Leroy, Sandrine; Gout, Ariel; Husson, Beatrice; de Tournemire, Renault; Tardieu, Marc

    2012-06-01

    Centropontine myelinolysis (CPM) is a rare neurologic disorder defined by symmetric demyelination in the central pons, mostly due to alcoholism, malnutrition, or water-electrolyte abnormalities. We report an unusual case of CPM likely due to hypophosphatemia, related to a refeeding syndrome in the context of mental anorexia. A 15-year-old girl with mental anorexia presented with hypophosphatemia in the following days of enteral refeeding, and then suffered from confusion, neurological signs, and typical MRI lesions of CPM. Hypophosphoremia may be considered as a causative agent in CPM related to refeeding syndrome. This clinical observation also highlights the importance of recognizing patients at high risk of refeeding syndrome to initiate a balanced nutrition with careful monitoring. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  3. Neutron detection using Dy2O3 activation detectors

    International Nuclear Information System (INIS)

    Gomaa, M.A.; Mohamed, E.J.

    1979-01-01

    The aim of the present study is to examine the usefulness of Dy 2 O 3 not only as thermal neutron activation detector but also as a fast neutron detector. For thermal neutrons, the half life of 165 Dy is measured to be (141 +- 6) min, its response to thermal neutrons is (2.18 +- 0.01) cpm/ncm -2 s -1 for a 250 mg Dy 2 O 3 pellet. For fast neutrons the Dy 2 O 3 detector is placed within a 20 cm polyethylene sphere and its response is found to be (2.2 +- 0.1) cpm/ncm -2 s -1 for 4 MeV neutrons and (2.10 +- 0.04) cpm/ncm -2 s -1 for 14 MeV neutrons. For neutron dosimetry, its response is found to be (16.7 +- 0.4) cpm per mrem h -1 . (author)

  4. [Study on building index system of risk assessment of post-marketing Chinese patent medicine based on AHP-fuzzy neural network].

    Science.gov (United States)

    Li, Yuanyuan; Xie, Yanming; Fu, Yingkun

    2011-10-01

    Currently massive researches have been launched about the safety, efficiency and economy of post-marketing Chinese patent medicine (CPM) proprietary Chinese medicine, but it was lack of a comprehensive interpretation. Establishing the risk evaluation index system and risk assessment model of CPM is the key to solve drug safety problems and protect people's health. The clinical risk factors of CPM exist similarities with the Western medicine, can draw lessons from foreign experience, but also have itself multi-factor multivariate multi-level complex features. Drug safety risk assessment for the uncertainty and complexity, using analytic hierarchy process (AHP) to empower the index weights, AHP-based fuzzy neural network to build post-marketing CPM risk evaluation index system and risk assessment model and constantly improving the application of traditional Chinese medicine characteristic is accord with the road and feasible beneficial exploration.

  5. Experimental procedures for the calibration of scintillation cells used in the determination of radon gas concentrations

    International Nuclear Information System (INIS)

    Grenier, M; Bigu, J.

    1982-02-01

    Experimental and analytical procedures are described for the calibration of scintillation cells used for the determination of radon gas concentration. In-house designed and built scintillation cells, used routinely in the monitoring of radon gas in uranium mine underground environments and in the laboratory, were calibrated. The cells had a volume of approximately 158 cm 3 and an α-counting efficiency ranging from 50% to 64%. Calibration factors for the cells were determined. Values ranged approximately from 0.177 cpm/pCiL -1 (4.77 cpm/BqL -1 ) to 0.224 cpm/pCiL -1 (6.05 cpm/BqL -1 ). The calibration facilities at the Elliot Lake Laboratory are briefly described

  6. Photodegradation of lambda-cyhalothrin and cypermethrin in aqueous solution as affected by humic acid and/or copper: intermediates and degradation pathways.

    Science.gov (United States)

    Xie, Jimin; Wang, Pingli; Liu, Jun; Lv, Xiaomeng; Jiang, Deli; Sun, Cheng

    2011-11-01

    The influence of coexisting humic acids (HA) or Cu²⁺ on the photodegradation of pesticides lambda-cyhalothrin (λ-CHT) and cypermethrin (CPM) in aqueous solution was studied under xenon lamp irradiation. The removal efficiency of pesticides λ-CHT and CPM were enhanced in the presence of either Cu²⁺ or HA but restrained in the presence of both Cu²⁺ and HA. The photodegradation of λ-CHT and CPM followed first-order reaction kinetics. The photodegradation intermediates of λ-CHT and CPM were determined using gas chromatography/mass spectrometry. Possible photodegradation pathways included decarboxylation, ester bond cleavage, dechlorination, and phenyl group removal. Copyright © 2011 SETAC.

  7. Embedment of Chlorpheniramine Maleate in Directly Compressed ...

    African Journals Online (AJOL)

    chlorpheniramine maleate (CPM) from its matrix tablets prepared by direct compression. Methods: Different ratios of compritol and kollidon SR (containing 50 % matrix component) in 1:1, 1:2, ... Magnesium stearate and hydrochloric acid were.

  8. Urinary incontinence a first presentation of central pontine myelinolysis: a case report.

    Science.gov (United States)

    Syed, Asmah Hassan; Shak, Joanna; Alsawaf, Ali

    2015-09-01

    An 84-year-old lady was treated for hyperosmolar hyperglycaemia with IV insulin, fluids and catheterisation for fluid balance monitoring. Trial without catheter failed as the patient complained of new-onset urinary incontinence and lack of awareness of bladder filling. In light of her breast cancer history, we excluded cauda equina. Ultrasound KUB showed an enlarged bladder. Whole-body MRI revealed a lesion in the pons which was highly suggestive of central pontine myelinolysis (CPM). Her electrolytes were normal throughout her admission; thus, the rapid fluctuation in osmolality, secondary to her hyperglycaemic state, was the likely cause of CPM. CPM has been reported secondary to hyperglycaemia; however, this is the first reported case of CPM presenting as urinary incontinence and loss of bladder sensation. © The Author 2015. Published by Oxford University Press on behalf of the British Geriatrics Society. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Prevalence and predictors of hypoxaemia in hospitalised children at ...

    African Journals Online (AJOL)

    2016-08-23

    Aug 23, 2016 ... providing specialized pediatric care for the communities of Osun, Ondo, and Ekiti States ... and > 30cpm in those > 5 years); noisy breathing includ- ing grunting, wheezing and ..... Intensive Care Medicine. 2011; 12: 490 – 5. 3.

  10. Conditioned Pain Modulation and Pressure Pain Sensitivity in the Adult Danish General Population: The DanFunD Study

    DEFF Research Database (Denmark)

    Skovbjerg, Sine; Jørgensen, Torben; Arendt-Nielsen, Lars

    2017-01-01

    with cold pressor pain (hand) for 2 minutes. Conditioning pain intensity was assessed using a visual analog scale and questionnaire data were collected. Female sex (P stress......Increased pressure pain sensitivity and impaired descending pain control have been associated with chronic pain, but knowledge on the variability in the adult general population is lacking. Pressure pain thresholds (PPTs) and descending pain control assessed using conditioned pain modulation (CPM...... (P ≤ .02), and high visual analog scale score (P ≤ .02) were associated with a larger CPM response. PERSPECTIVE: Data from this large population-based study provide new insight into the gender and age variation in pain sensitivity and CPM response. Decreased CPM potency and increased pain sensitivity...

  11. Endodontic sealers: Intratubular penetration and permeability to Enterococcus faecalis

    Directory of Open Access Journals (Sweden)

    Bortolini Maria Cecilia

    2010-01-01

    Full Text Available Aim : Evaluate in vitro the intratubular penetration and permeability of endodontic sealers in teeth contaminated with Enterococcus faecalis. Materials and Methods : Human canines were filled with AHPlus ® , Endo CPM-sealer ® or EndoRez ® sealers. To evaluate permeability, the coronary portion of each tooth was contaminated with E. faecalis, then the apical portion was immersed in brain heart infusion (BHI broth, and medium turbidity was observed for thirty days. Scanning electron microscope (SEM was used to evaluate the intratubular penetration of each sealer at the cervical, middle, and apical thirds of the tooth. Results : Only one tooth from the Endo CPM-sealer ® group presented broth contamination. EndoRez ® showed increased intratubular penetration compared to AHPlus ® and Endo CPM-sealer ® . Conclusions : Endo CPM-sealer ® showed greater permeability to E. faecalis and EndoRez ® showed increased intratubular penetration.

  12. Aerobic exercise and cold pressor test induce hypoalgesia in active and inactive men and women

    DEFF Research Database (Denmark)

    Vægter, Henrik Bjarke; Handberg, Gitte; Jørgensen, Maria N.

    2015-01-01

    ). Conditioned pain modulation (CPM) was assessed by cold pressor testing. Exercise-induced hypoalgesia (EIH) was assessed after 15 minutes bicycling at a heart rate corresponding to 75% VO2max. A control session of 15 minutes quiet rest was also included. Pressure pain thresholds (PPTs) were recorded...... and after exercise, PPTs increased to the same degree in active and inactive subjects, and the CPM and EIH responses were correlated (P CPM response immediately after cold pressor test was maintained in women but not in men. CONCLUSIONS: Cold pressor stimulation and aerobic exercise caused...... comparable multisegmental increases in PPT in active and inactive men and women. The CPM and EIH responses were correlated, but they have different temporal manifestation of hypoalgesia....

  13. Similarities between exercise-induced hypoalgesia and conditioned pain modulation in humans

    DEFF Research Database (Denmark)

    Vægter, Henrik Bjarke; Handberg, Gitte; Graven-Nielsen, Thomas

    2014-01-01

    Pain inhibitory mechanisms are often assessed by paradigms of exercise-induced hypoalgesia (EIH) and conditioned pain modulation (CPM). In this study it was hypothesised that the spatial and temporal manifestations of EIH and CPM were comparable. Eighty healthy subjects (40 females), between 18......-65 years participated in this randomized repeated-measures crossover trial with data collection on two different days. CPM was assessed by two different cold pressor tests (hand,foot). EIH was assessed through two intensities of aerobic bicycling exercises and two intensities of isometric muscle...... tests and after all of the exercise conditions, except low intensity bicycling. EIH after bicycling was increased in women compared to men. CPM and the EIH response after isometric exercises were comparable in men and women and not affected by age. The EIH response was larger in the exercising body part...

  14. Space-Time Code Designs for Broadband Wireless Communications

    National Research Council Canada - National Science Library

    Xia, Xiang-Gen

    2005-01-01

    The goal of this research is to design new space AND time codes, such as complex orthogonal space AND time block codes with rate above 1/2 from complex orthogonal designs for QAM, PSK, and CPM signals...

  15. New proportional counter assembly in Gliwice 14C laboratory

    International Nuclear Information System (INIS)

    Moscicki, W.; Zastawny, A.

    1977-01-01

    The design and parameters are described of a proportional counter for low level counting. The cathode tube 80 mm in diameter and 30 cm in length is made of pure copper. The anode is a tungsten wire 0.05 mm in diameter. The cathode tube is surrounded by a cylindrical ring container with mercury. The total volume of the counter is 1.5 l and it is filled with carbon dioxide. At a pressure of 1 at of CO 2 the counter background is 4.20+-0.05 cpm and contemporary 14 C net effect 10.22+-0.10 cpm; at a pressure of 2 at of CO 2 the background is 4.40+-0.05 cpm and the contemporary 14 C net effect 20.53+-10 cpm. The efficiency of the proportional counter is 88% in both cases. (J.B.)

  16. Alpha particles emitted from the surface of granite, clay, and its fired products, 1

    International Nuclear Information System (INIS)

    Aratani, Michi; Otsuka, Hideko

    1975-01-01

    As a part of an investigation on ''the effect of long-time irradiation from a trace amount of radioisotopes'', the emitting rate of alpha particles per unit surface area (apparent) coming from natural alpha-particle emitters has been measured. The samples measured were granite and its weathered product; clay, especially potter's clay, and its fired product; pottery ware. The values obtained were 39.1 +-0.9--0.73+-0.08 cpm/100 cm 2 in granite, 16.8+-0.4--6.4+-0.2 cpm/100cm 2 in potter's clay, and 1.36+-0.04--0.82+-0.04 cpm/100cm 2 in pottery ware on substrate, and 1.33+-0.05--0.32+-0.02 cpm/100cm 2 on glazer. (auth.)

  17. Central Pontine Myelinolysis and Localized Fluorodeoxyglucose Uptake Seen on 18F-FDG PET/CT

    DEFF Research Database (Denmark)

    Rønne, Frederik; Tfelt-Hansen, Peer Carsten; Rørdam, Lene

    2017-01-01

    Case report describing the finding of central pontine myelinolysis (CPM) using combined fluorine-18 ( 18F)-fluorodeoxyglucose (FDG) positron emission tomography/computed tomography (PET/CT). The patient was a known alcoholic who, during admission was under treatment for hyponatremia, showed...... a significant decline in both motor and cognitive function. Combined 18F-FDG PET/CT showed localized FDG uptake in the pons, consistent with the finding of CPM observed on magnetic resonance imaging (MRI). CPM is a demyelinating lesion of the pons, resulting in several neurological symptoms. The exact cause...... of CPM is not clear, but a strong relations between loss of myelin and osmotic stress exists, especially during rapid correction of hyponatremia. The osmotic stress is thought to induce disruption of the blood-brain barrier, allowing access for inflammatory mediators in extravascular brain tissue, which...

  18. Cost effectiveness of the MDOT preventive maintenance program.

    Science.gov (United States)

    2013-04-01

    The Michigan Department of Transportations (MDOT) pavement preservation program dates back to 1992. MDOTs pavement preservation strategy is primarily implemented through its capital preventive maintenance (CPM) program, in which preventive main...

  19. Agile project portfolio management, new solutions and new challenges: preliminary findings from a case study of an agile organization

    DEFF Research Database (Denmark)

    Hansen, Lars Kristian; Svejvig, Per

    project management framework including two complementary perspectives. One perspective, denoted as classical project management (CPM), highlights key characteristics of traditional PPM practices. A second perspective, denoted as rethinking project management (RPM), highlights characteristics...... of progressive PPM practices. We investigate a large Danish company by applying the research question: “How does agile PPM manifests itself in a real organization and what are the observed pros and cons?” Surprisingly, when summa-rizing our results, we find some traits of concepts from the CPM perspective...... that are manifested in strict control of projects and programs. Furthermore, we find the traits of the RPM perspective more dominating than the CPM perspective, and these traits are mostly found to have desirable effects. CPM traits seem to improve the organi-zation’s ability to cope with uncertainty, a so...

  20. The Impact of Consumer Phase Models in Microbial Risk Analysis

    DEFF Research Database (Denmark)

    Nauta, Maarten; Christensen, Bjarke Bak

    2011-01-01

    In quantitative microbiological risk assessment (QMRA), the consumer phase model (CPM) describes the part of the food chain between purchase of the food product at retail and exposure. Construction of a CPM is complicated by the large variation in consumer food handling practices and a limited...... availability of data. Therefore, several subjective (simplifying) assumptions have to be made when a CPM is constructed, but with a single CPM their impact on the QMRA results is unclear. We therefore compared the performance of eight published CPMs for Campylobacter in broiler meat in an example of a QMRA......, where all the CPMs were analyzed using one single input distribution of concentrations at retail, and the same dose-response relationship. It was found that, between CPMs, there may be a considerable difference in the estimated probability of illness per serving. However, the estimated relative risk...

  1. Sex differences in the relationship between maternal fear of pain and children's conditioned pain modulation

    Directory of Open Access Journals (Sweden)

    Evans S

    2013-03-01

    Full Text Available Subhadra Evans, Laura C Seidman, Kirsten C Lung, Lonnie K Zeltzer, Jennie C TsaoPediatric Pain Program, Department of Pediatrics, David Geffen School of Medicine at UCLA, Los Angeles, CA, USABackground: Parental behaviors, emotions, and cognitions are known to influence children's response to pain. However, prior work has not tested the association between maternal psychological factors and children's responses to a conditioned pain modulation (CPM task. CPM refers to the reduction in perceived pain intensity for a test stimulus following application of a conditioning stimulus to a remote area of the body, and is thought to reflect the descending inhibition of nociceptive signals.Methods: The present study examined sex differences in the association between maternal anxiety about pain and children's CPM responses in 133 healthy children aged 8–17 years. Maternal pain anxiety was assessed using the Pain Anxiety Symptoms Scale-20. In addition to the magnitude of CPM, children's anticipatory anxiety and pain-related fear of the CPM task were measured.Results: Sequential multiple linear regression revealed that even after controlling for child age and general maternal psychological distress, greater maternal pain anxiety was significantly related to greater CPM anticipatory anxiety and pain-related fear in girls, and to less CPM (ie, less pain inhibition in boys.Conclusion: The findings indicate sex-specific relationships between maternal pain anxiety and children's responses to a CPM task over and above that accounted for by the age of the child and the mother's general psychological distress.Keywords: diffuse noxious inhibitory controls, pediatric pain, mother-child relationship, cold pressor, pressure pain, laboratory pain

  2. Genetically Modified Porcine Skin Grafts for Treatment of Severe Burn Injuries

    Science.gov (United States)

    2010-07-01

    skin treatment and storage Clinical and Histopathologic Data Confirmation of Preliminary Data and Reproducibility of Xenotransplantation Model...the counts per minute ( cpm ) for the responses at each of the time points, which have lower cpms (see red circles around cpm values on pgs. 49-50...although the blade was fresh for each animal. The skin grafts were kept moist and cold in a saline-filled Petri dish on ice while being trimmed to the

  3. Distinct brain mechanisms support spatial vs temporal filtering of nociceptive information.

    Science.gov (United States)

    Nahman-Averbuch, Hadas; Martucci, Katherine T; Granovsky, Yelena; Weissman-Fogel, Irit; Yarnitsky, David; Coghill, Robert C

    2014-12-01

    The role of endogenous analgesic mechanisms has largely been viewed in the context of gain modulation during nociceptive processing. However, these analgesic mechanisms may play critical roles in the extraction and subsequent utilization of information related to spatial and temporal features of nociceptive input. To date, it remains unknown if spatial and temporal filtering of nociceptive information is supported by similar analgesic mechanisms. To address this question, human volunteers were recruited to assess brain activation with functional magnetic resonance imaging during conditioned pain modulation (CPM) and offset analgesia (OA). CPM provides one paradigm for assessing spatial filtering of nociceptive information while OA provides a paradigm for assessing temporal filtering of nociceptive information. CPM and OA both produced statistically significant reductions in pain intensity. However, the magnitude of pain reduction elicited by CPM was not correlated with that elicited by OA across different individuals. Different patterns of brain activation were consistent with the psychophysical findings. CPM elicited widespread reductions in regions engaged in nociceptive processing such as the thalamus, insula, and secondary somatosensory cortex. OA produced reduced activity in the primary somatosensory cortex but was associated with greater activation in the anterior insula, dorsolateral prefrontal cortex, intraparietal sulcus, and inferior parietal lobule relative to CPM. In the brain stem, CPM consistently produced reductions in activity, while OA produced increases in activity. Conjunction analysis confirmed that CPM-related activity did not overlap with that of OA. Thus, dissociable mechanisms support inhibitory processes engaged during spatial vs temporal filtering of nociceptive information. Copyright © 2014 International Association for the Study of Pain. Published by Elsevier B.V. All rights reserved.

  4. Preoperative pain mechanisms assessed by cuff algometry are associated with chronic postoperative pain relief after total knee replacement.

    Science.gov (United States)

    Petersen, Kristian Kjær; Graven-Nielsen, Thomas; Simonsen, Ole; Laursen, Mogens Berg; Arendt-Nielsen, Lars

    2016-07-01

    Chronic postoperative pain after total knee replacement (TKR) in knee osteoarthritis (KOA) implies clinical challenges. Widespread hyperalgesia, facilitated temporal summation of pain (TSP), and impaired conditioned pain modulation (CPM) have been found in painful KOA. This exploratory study investigated postoperative pain relief 12 months after TKR in 4 subgroups of patients preoperatively profiled by mechanistic quantitative sensory testing. In 103 patients with KOA, pressure pain detection threshold (PDT) and tolerance thresholds (PTT) were assessed at the lower leg using cuff algometry. Temporal summation of pain was measured as an increase in pain intensity scores during 10 repeated (2 seconds intervals) painful cuff stimuli. Conditioned pain modulation was calculated as the relative increase in PDT during painful conditioning stimulation. The grand averages of TSP and CPM were calculated and values below or above were used for subgrouping: facilitated TSP/impaired CPM (group A, N = 16), facilitated TSP/normal CPM (group B, N = 15), normal TSP/impaired CPM (group C, N = 44), and normal TSP/normal CPM (group D, N = 28). Clinical VAS pain intensity scores were collected before and 12 months after TKR surgery and the pain relief calculated. Less pain relief was found in group A (52.0% ± 14.0% pain relief) than in group B (81.1% ± 3.5%, P = 0.023) and group C (79.6% ± 4.4%, P = 0.007), but not group D (69.4% ± 7.9%, P = 0.087). Low preoperative PDT was associated with a less postoperative pain relief (R = -0.222, P = 0.034), whereas TSP or CPM alone showed no associations with postoperative pain relief. This explorative study indicated that patients with osteoarthritis with facilitated TSP together with impaired CPM are more vulnerable to experience less pain relief after TKR.

  5. Ultrasound and Histologic Examination after Subcutaneous Injection of Two Volumizing Hyaluronic Acid Fillers: A Preliminary Study

    Science.gov (United States)

    Besse, Stéphanie; Sarazin, Didier; Quinodoz, Pierre; Elias, Badwi; Safa, Marva; Vandeputte, Joan

    2017-01-01

    Background: This study examined the influence of hyaluronic acid (HA) crosslinking technology on the ultrasound and histologic behavior of HA fillers designed for subcutaneous injection. Methods: One subject received subcutaneous injections of 0.25 ml Cohesive Polydensified Matrix (CPM) and Vycross volumizing HA in tissue scheduled for abdominoplasty by bolus and retrograde fanning techniques. Ultrasound analyses were performed on days 0 and 8 and histologic analyses on days 0 and 21 after injection. A series of simple rheologic tests was also performed. Results: Day 0 ultrasound images after bolus injection showed CPM and Vycross as hypoechogenic papules in the hypodermis. CPM appeared little changed after gentle massage, whereas Vycross appeared more hyperechogenic and diminished in size. Ultrasound images at day 8 were similar. On day 0, both gels appeared less hypoechogenic after retrograde fanning than after bolus injection. Vycross was interspersed with hyperechogenic areas (fibrous septa from the fat network structure) and unlike CPM became almost completely invisible after gentle massage. On day 8, CPM appeared as a hypoechogenic pool and Vycross as a long, thin rod. Day 0 histologic findings confirmed ultrasound results. Day 21 CPM histologic findings showed a discrete inflammatory reaction along the injection row after retrograde fanning. Vycross had a more pronounced inflammatory reaction, particularly after retrograde fanning, with macrophages and giant cells surrounding the implant. Rheologic tests showed CPM to have greater cohesivity and resistance to traction forces than Vycross. Conclusions: CPM HA volumizer appears to maintain greater tissue integrity than Vycross after subcutaneous injection with less inflammatory activity. PMID:28280664

  6. The Measurements of Calcification Rates in Reef Corals Using Radioisotope 45Ca at Pongok Sea, South Bangka

    International Nuclear Information System (INIS)

    Diansyah, G.; Ulqodry, T.Z.; Rasyid, M.; Djawanas, A.

    2011-01-01

    Coral reef ecosystem is one of the most important ecological systems in the Indonesian coastal zone. The aim of this study which was undertaken between August - October 2006, is to measure the calcification of corals in a reef coral in the Pongok Sea, South Bangka using 45 Ca. The steps in conducting this study were surveying of the site, preparation, transplanting, incubation in the 45 Ca - solution, and analysis of the coral fragments. The results showed that at the depth of 5 m different counts per minute (cpm) trend occurred. For the samples taken from the transplantation of the Artificial Colony (Ac) the cpm showed that with the progress of time the cpm declined, reaching its lowest cpm at 5 hours after retransplanting of the coral fragments. On the other hand the samples obtained from the natural (Nc) colony showed that the cpm increased with time progress. At the 10 m depth where only the coral fragment of the natural colony (Nc) was observed a different pattern showed up. Here with the progress of time up to 3 hours the cpm increased and after that it declined to reach a low cpm at 5 hours of observation. The cpm values were then transformed to disintegrations per minute (dpm), μCi and at the end to 45 Ca content. The same trend is shown for dpm, μCi/0.5 g sample and μg Ca/0.5 g sample. The 45 Ca content (μg/0.5 g sample) were used to show the calcification rates of coral fragments. It showed clearly that 45 Ca could be used to calculate the magnitude of calcification. (author)

  7. Radioimmunoassay for the determination of low insulin levels

    International Nuclear Information System (INIS)

    Toledo e Souza, I.T. de; Wajchenberg, B.L.; Okada, H.

    1988-08-01

    The assay system was set up in such a way as to increase the sensitivity of the reaction, reducing the tracer concentration from the usual 1.000 cpm/ml to 500 cpm/ml levels of radioactivity (specific activity aproximately 200 mCi/mg) and/or increasing the antiserum dilution by one thirty of the usual values in the assay of the final volume of incubation of 2,5 ml. (author) [pt

  8. Methylphenidate Modulates Functional Network Connectivity to Enhance Attention

    OpenAIRE

    Rosenberg, Monica D.; Zhang, Sheng; Hsu, Wei-Ting; Scheinost, Dustin; Finn, Emily S.; Shen, Xilin; Constable, R. Todd; Li, Chiang-Shan R.; Chun, Marvin M.

    2016-01-01

    Recent work has demonstrated that human whole-brain functional connectivity patterns measured with fMRI contain information about cognitive abilities, including sustained attention. To derive behavioral predictions from connectivity patterns, our group developed a connectome-based predictive modeling (CPM) approach (Finn et al., 2015; Rosenberg et al., 2016). Previously using CPM, we defined a high-attention network, comprising connections positively correlated with performance on a sustained...

  9. Biological response of Sr-containing coating with various surface treatments on titanium substrate for medical applications

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Shih-Ping [Department of Materials Science and Engineering, National Cheng Kung University, Tainan, Taiwan (China); Lee, Tzer-Min, E-mail: tmlee@mail.ncku.edu.tw [Institute of Oral Medicine, National Cheng Kung University, Tainan, Taiwan (China); School of Dentistry, Kaohsiung Medical University, Kaohsiung, Taiwan (China); Lui, Truan-Sheng [Department of Materials Science and Engineering, National Cheng Kung University, Tainan, Taiwan (China)

    2015-08-15

    Graphical abstract: - Highlights: • Sr-containing coating prepared by plasma spraying and micro-arc oxidation process, respectively. • MAO coating stimulated high ECM-like structures of cells on early stage. • Sr-containing specimens had high cell responses on late stage. • Sr-MAO coating is a desirable implant surface treatment for clinical applications. - Abstract: An implant requires a suitable surface to trigger osteointegration. The surface characteristics and chemical composition are important factors in this process. Plasma spraying and micro-arc oxidation can be used to fabricate rough and porous structures for medical applications. Strontium (Sr) has been shown to prevent osteoporosis in vitro and in vivo. However, few scientists have evaluated the biological response of Sr-containing coatings on different surface treatments. In this study, a sand-blasted (SB) surface (as the control), plasma-sprayed hydroxyapatite (HA) and Sr-substituted HA coatings (HAPS and SrHAPS, respectively), calcium phosphate and Sr-containing calcium phosphate micro-arc oxidation surface (CPM and SrCPM, respectively) were analyzed in terms of human osteoblastic cell (MG63) response. Sr was confirmed to be incorporated into the surface. SrHAPS and SrCPM specimens had higher cell responses than those of the HAPS and CPM groups, respectively. The cells cultured on SrCPM and SrHAPS specimens exhibited high proliferation and differentiation. However, CPM and SrCPM specimens stimulated more ECM-like structures than other specimens. The results show that Sr-containing coatings have good characteristics that enhance cell response. The SrCPM coating is a suitable implant surface treatment for clinical applications.

  10. Biological response of Sr-containing coating with various surface treatments on titanium substrate for medical applications

    International Nuclear Information System (INIS)

    Yang, Shih-Ping; Lee, Tzer-Min; Lui, Truan-Sheng

    2015-01-01

    Graphical abstract: - Highlights: • Sr-containing coating prepared by plasma spraying and micro-arc oxidation process, respectively. • MAO coating stimulated high ECM-like structures of cells on early stage. • Sr-containing specimens had high cell responses on late stage. • Sr-MAO coating is a desirable implant surface treatment for clinical applications. - Abstract: An implant requires a suitable surface to trigger osteointegration. The surface characteristics and chemical composition are important factors in this process. Plasma spraying and micro-arc oxidation can be used to fabricate rough and porous structures for medical applications. Strontium (Sr) has been shown to prevent osteoporosis in vitro and in vivo. However, few scientists have evaluated the biological response of Sr-containing coatings on different surface treatments. In this study, a sand-blasted (SB) surface (as the control), plasma-sprayed hydroxyapatite (HA) and Sr-substituted HA coatings (HAPS and SrHAPS, respectively), calcium phosphate and Sr-containing calcium phosphate micro-arc oxidation surface (CPM and SrCPM, respectively) were analyzed in terms of human osteoblastic cell (MG63) response. Sr was confirmed to be incorporated into the surface. SrHAPS and SrCPM specimens had higher cell responses than those of the HAPS and CPM groups, respectively. The cells cultured on SrCPM and SrHAPS specimens exhibited high proliferation and differentiation. However, CPM and SrCPM specimens stimulated more ECM-like structures than other specimens. The results show that Sr-containing coatings have good characteristics that enhance cell response. The SrCPM coating is a suitable implant surface treatment for clinical applications

  11. Outcome of infants operated on for congenital pulmonary malformations.

    Science.gov (United States)

    Calzolari, Flaminia; Braguglia, Annabella; Valfrè, Laura; Dotta, Andrea; Bagolan, Pietro; Morini, Francesco

    2016-12-01

    Patients operated on for congenital pulmonary malformations (CPM) have excellent survival rates, but little is known about long-term morbidity. Our aim is to report the sequelae in patients operated on for CPM in infancy and to define factors that may influence their outcome. All patients operated on for major congenital anomalies are followed in a dedicated outpatient program and evaluated at 6, 24, and 48 months of life (corrected for gestational age) and at school age at 4, 6, 8, and 12 years of life. The data are prospectively collected. Patients operated on for CPM and enrolled in the follow-up clinic between January 2004 and December 2010 are compared with a control group of term infants operated on for inguinal hernia, without other major congenital or acquired abnormalities. The two groups were compared for auxological, respiratory, and orthopedic outcome. In the study period, 76 consecutive patients with CPM attended our dedicated follow-up clinic. Eight non-operated patients were excluded from the study. Age at follow-up was 82.0 (56.1-103.7) months in CPM patients and 83.5 (75.2-90.4) months in controls (P = 0.79). Fifty-three patients with CPM (78%) had one or more clinical or radiological abnormality versus six (16%) control patients (OR [95%CI] 16.5 [5.8-47.2]; P malformation. Therefore, long-term follow-up of patients operated on for CPM is recommended. Further studies are needed to define if, in asymptomatic patients, surgery may modify the natural history of CPM. Pediatr Pulmonol. 2016;51:1367-1372. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  12. Magma mixing and the generation of isotopically juvenile silicic magma at Yellowstone caldera inferred from coupling 238U–230Th ages with trace elements and Hf and O isotopes in zircon and Pb isotopes in sanidine

    Science.gov (United States)

    Stelten, Mark E.; Cooper, Kari M.; Vazquez, Jorge A.; Reid, Mary R.; Barfod, Gry H.; Wimpenny, Josh; Yin, Qing-Zhu

    2013-01-01

    The nature of compositional heterogeneity within large silicic magma bodies has important implications for how silicic reservoirs are assembled and evolve through time. We examine compositional heterogeneity in the youngest (~170 to 70 ka) post-caldera volcanism at Yellowstone caldera, the Central Plateau Member (CPM) rhyolites, as a case study. We compare 238U–230Th age, trace-element, and Hf isotopic data from zircons, and major-element, Ba, and Pb isotopic data from sanidines hosted in two CPM rhyolites (Hayden Valley and Solfatara Plateau flows) and one extracaldera rhyolite (Gibbon River flow), all of which erupted near the caldera margin ca. 100 ka. The Hayden Valley flow hosts two zircon populations and one sanidine population that are consistent with residence in the CPM reservoir. The Gibbon River flow hosts one zircon population that is compositionally distinct from Hayden Valley flow zircons. The Solfatara Plateau flow contains multiple sanidine populations and all three zircon populations found in the Hayden Valley and Gibbon River flows, demonstrating that the Solfatara Plateau flow formed by mixing extracaldera magma with the margin of the CPM reservoir. This process highlights the dynamic nature of magmatic interactions at the margins of large silicic reservoirs. More generally, Hf isotopic data from the CPM zircons provide the first direct evidence for isotopically juvenile magmas contributing mass to the youngest post-caldera magmatic system and demonstrate that the sources contributing magma to the CPM reservoir were heterogeneous in 176Hf/177Hf at ca. 100 ka. Thus, the limited compositional variability of CPM glasses reflects homogenization occurring within the CPM reservoir, not a homogeneous source.

  13. Conditioned pain modulation dampens the thermal grill illusion.

    Science.gov (United States)

    Harper, D E; Hollins, M

    2017-10-01

    The thermal grill illusion (TGI) refers to the perception of burning heat and often pain that arises from simultaneous cutaneous application of innocuous warm and cool stimuli. This study utilized conditioned pain modulation (CPM) to help elucidate the TGI's underlying neural mechanisms, including the debated role of ascending nociceptive signals in generating the illusion. To trigger CPM, subjects placed the left hand in noxious cold (6 °C) water before placing the right volar forearm onto a thermal grill. Lower pain and unpleasantness ratings of the grill in this CPM run compared to those in a control run (i.e. 33 °C water) were taken as evidence of CPM. To determine whether CPM reduces noxious heat pain and illusory heat pain equally, an experimental group of subjects rated pain and unpleasantness of a grill consisting of innocuous alternating warm (42 °C) and cool (18 °C) bars, while a control group rated a grill with all bars controlled to a noxious temperature (45 °C). CPM produced significant and comparable reductions in pain, unpleasantness and perceived heat of both noxious heat and the TGI. This result suggests that the TGI results from signals in nociceptive dorsal horn convergent neurons, since CPM involves descending inhibition with high selectivity for this neuronal population. More broadly, CPM's ability to produce a shift in perceived thermal sensation of both noxious heat and the TGI from 'hot' to 'warm' implies that nociceptive signals generated by a cutaneous stimulus can contribute to its perceived thermal intensity. Conditioned pain modulation reduces the perceived painfulness, unpleasantness and heat of the thermal grill illusion and noxious heat similarly. The results have important theoretical implications for both types of pain. © 2017 European Pain Federation - EFIC®.

  14. An Initial Look at Adjacent Band Interference Between Aeronautical Mobile Telemetry and Long-Term Evolution Wireless Service

    Science.gov (United States)

    2016-07-04

    required analysis, and further testing. 15. SUBJECT TERMS Adjacent Channel Interference, ACI, LTE -A, LTE , PCM/FM, SOQPSK-TG, ARTM CPM, AWS-3, User...Interference, ACI, LTE -A, LTE , PCM/FM, SOQPSK-TG, ARTM CPM, AWS-3, User Equipment, UE, Evolved Node B, eNodeB, Resource Blocks INTRODUCTION “On...these questions make necessary an improved understanding of the interferers that can be obtained only by hands-on measurements . This work will

  15. Chirp of monolithic colliding pulse mode-locked diode lasers

    DEFF Research Database (Denmark)

    Hofmann, M.; Bischoff, S.; Franck, Thorkild

    1997-01-01

    Spectrally resolved streak camera measurements of picosecond pulses emitted by hybridly colliding pulse mode-locked (CPM) laser diodes are presented in this letter. Depending on the modulation frequency both blue-chirped (upchirped) and red-chirped (downchirped) pulses can be observed. The two...... different regimes and the transition between them are characterized experimentally and the behavior is explained on the basis of our model for the CPM laser dynamics. (C) 1997 American Institute of Physics....

  16. Short-term myeloid growth factor mediated expansion of bone marrow haemopoiesis studied by localized magnetic resonance proton spectroscopy

    DEFF Research Database (Denmark)

    Jensen, K E; Hansen, P B; Larsen, V A

    1994-01-01

    -density cell proliferation rate in marrow samples increased from median 21.9 (range 4.5-31) x 10(3) cpm to 54.7 (range 13.9-94) x 10(3) cpm and the total number of myeloid progenitors enumerated as day 7/14 GM-CFUs per volume aspirated marrow increased from median 11/8 x 10(3) (range 4.0-87.5/2.2-103.0) to 64...

  17. Modulation of itch by conditioning itch and pain stimulation in healthy humans

    DEFF Research Database (Denmark)

    Andersen, Hjalte Holm; van Laarhoven, Antoinette I. M.; Elberling, Jesper

    2017-01-01

    Little is known about endogenous descending control of itch. In chronic pain, descending pain inhibition is reduced as signified by lowered conditioned pain modulation (CPM). There are indications that patients with chronic itch may also exhibit reduced endogenous descending inhibition of itch......-evoked itch, while the test stimuli were electrical stimulation paradigms designed to evoke itch or pain. Pain was significantly reduced (CPM-effect) by the conditioning pain stimulus (p

  18. Towards rethinking Project portfolio management

    DEFF Research Database (Denmark)

    Hansen, Lars Kristian; Svejvig, Per

    the last five years. Utilizing the theoretical lens proposed by Svejvig and Andersen (2015), we apply two complementary analytical perspectives to classify and analyze the stocks. One perspective, denoted as classical project management (CPM), highlights key characteristics of conventional research....... A second perspective, denoted as rethinking project management (RPM), highlights characteristics of progressive research. Not surprisingly, characteristics from CPM are very dominant in the stock of most cited publications of all years — instrumentality and controllability in particular. In the newest...

  19. Measurement of Software Project Management Effectiveness

    Science.gov (United States)

    2008-12-01

    factors such as advertisement of project mission, top management support, client consultation, personnel issues, client acceptance, etc. Trouble...and PERT (Program/Project Evaluation and Review Technique) and CPM (Critical Path Analysis) charts are process models, and the development of Gantt...models (such as Gantt, PERT and CPM ) got wide-acceptance in industry, as Fuggetta (2000) pointed out few (if any) of the proposed PMLs and related

  20. Setting Priorities in the Age of Austerity: British, French, and German Experiences

    Science.gov (United States)

    2013-01-01

    overseas—it raises the cost of recruitment by an unknown amount, as the military will have to raise salaries and spend money on advertising and various...Mechanized Infantry Division: The Division in Eastern Germany],” in Heeresführungskommando, Sankt Augustin: CPM Communication Presse, 2009, p. 57...Sankt Augustin: CPM Communication Presse, 2009, p. 44. 76 Timo Noetzel and Martin Zapfe, “Force Structure Requirements for Complex and Conventional

  1. Host Immune Response to Bacterial Cyclic Diguanylic Acid (c-di-GMP)

    Science.gov (United States)

    2009-07-01

    charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. 1 This work...thymidine incorporation by an automatic beta counter. Tests were per- formed in triplicates, and results were expressed as the mean cpm . Flow cytometry...thymidine was added and allowed to incubate for an additional 18 h. T cell proliferation was measured by [3H]thymidine uptake ( cpm ). , p 0.01, as

  2. Crosstalk: The Journal of Defense Software Engineering. Volume 22, Number 4

    Science.gov (United States)

    2009-06-01

    to measure impacted functions not covered by the International Function Point User’s Group (IFPUG) Counting Practices Manual ( CPM ) 4.2. If you are...foggy on the ins and outs of IFPUG or CPM 4.2, or just want a refresher, Total Metrics has simplified the concepts down to an easily under- stood two...information from your organization’s perspective with the software defense industry. • Dedicated space in each issue. • Advertisements ranging from a full

  3. Battlefield-Acquired Immunogenicity to Metals Affects Orthopaedic Implant Outcome

    Science.gov (United States)

    2012-10-01

    Attending Physician #N/A Control cpm 1308.0 Positive control (PHA) cpm 38247.3 29.2 Mildly Reactive 2 to 4 Reactive 4 to 8 Highly Reactive above 8...Kyron, The Veterans Health Administration has to follow Handbook 1200.05, which states: VHA HANDBOOK 1200.05 October 15, 2010 n. Advertising ...The facility Director is responsible for ensuring that recruiting documents, flyers, and advertisements for non-VA research are not posted within or

  4. The Cost-Effectiveness of Military Advertising: Evidence from 2002-2004

    Science.gov (United States)

    2009-01-01

    real dollars, the budgets were adjusted for CPM (cost per 1,000 advertising impressions, or audience exposures) inflation. These costs for network...budgets have doubled. During the 1990s, real spending on advertising was signifi- cantly lower. 1 CPM actually incurred by the Services (computed by...TITLE AND SUBTITLE The Cost-Effectiveness of Military Advertising : Evidence from 2002?2004 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT

  5. A Qualitative Review on the Pharmacokinetics of Antibiotics in Saliva: Implications on Clinical Pharmacokinetic Monitoring in Humans.

    Science.gov (United States)

    Kiang, Tony K L; Ensom, Mary H H

    2016-03-01

    We conducted a systematic search to describe the current state of knowledge regarding the utility of saliva for clinical pharmacokinetic monitoring (CPM) of antibiotics. Although the majority of identified studies lacked sufficient pharmacokinetic data needed to assign an appropriate suitability classification, most aminoglycosides, fluoroquinolones, macrolides, penicillins/cephalosporins, and tetracyclines are likely not suitable for CPM in saliva. No clear pattern of correlation was observed between physiochemical properties that favor drug distribution into saliva and the likelihood of the antibiotic being classified as suitable for CPM in saliva (and vice versa). Insufficient data were available to determine if pathophysiological conditions affected salivary distribution of antibiotics. Additional confirmatory data are required for drugs (especially in patients) that are deemed likely suitable for CPM in saliva because only a few studies were available and many focused only on healthy subjects. All studies identified had relatively small sample sizes and exhibited large variability. Very few studies reported salivary collection parameters (e.g., salivary flow, pH) that could potentially have some impact on drug distribution into saliva. The available data are heavily weighted on healthy subjects, and insufficient data were available to determine if pathophysiology had effects on saliva drug distribution. Some studies also lacked assay sensitivity for detecting antibiotics in saliva. Overall, this review can be useful to clinicians who desire an overview on the suitability of saliva for conducting CPM of specific antibiotics, or for researchers who wish to fill the identified knowledge gaps to move the science of salivary CPM further.

  6. Incidence and mechanism of central pontine myelinolysis based on analysis of MRI images and risk factors

    Energy Technology Data Exchange (ETDEWEB)

    Kondo, Masato [Akita Univ. (Japan). School of Medicine

    2000-02-01

    In this study, the incidence of central pontine myelinolysis (CPM)-like lesions on MRI images was studied in 1917 subjects, 1,500 of which were psychiatric patients and 417 were patients attending a brain health examination. The CPM-like lesions were first classified into four groups based on the characteristics of their MRI images: group 1 showed symmetrical lesions on both T1 low and T2 high images and were considered to be typical CPM; group 2 showed symmetrical high intensity lesions only on T2 images; group 3 had asymmetrical lesions only on T2 images; and group 4 had asymmetrical lesions on both T1 low and T2 high images. Furthermore, the relationships of each group with particular risk factors, such as alcoholism, hypertension, hyperlipidemia were statistically analysed. The cause of CPM-like features in the MRI images were discussed. Among our subjects, the incidence of CPM-like lesions was 3.8%, and that of group 1 was 1.2%. Significant correlations between group 1 and alcoholism, and group 3 and 4 with brain ischemic lesions were observed. A previous hypothesis that group 2 may be a premature state of CPM is not supported by our results. (author)

  7. Gastric emptying patterns of a liquid meal in newborn infants, measured by epigastric impedance

    DEFF Research Database (Denmark)

    Lange, Aksel; Funch-Jensen, Peter; Thommesen, Peter

    1997-01-01

    time (T50) was calculated. For mature infants it was found to be 6.9 mins. For a second meal given within an hour after the first meal the half emptying time was 5.5 mins (p times were not significant different from mature infants, but the number examined was small......  Epigastric impedance was used to measure patterns of the gastric emptying of a liquid non-caloric meal (5 ml water/kg) in newborn infants. The emptying patterns consisted of two components, theemptying signal - the DC component - and a phasic 3 cycle per minutes (CPM) signal - the AC component.......A periodic change of the impedance signal, the phasic 3 CPM signal, was observed after a meal in 24 of the infants. The median frequency was 3.03 CPM in 20 mature and 2.93 CPM in 4 preterminfants. In 9 infants a phasic 3 CPM signal was observed during fasting state. The median frequency was 2.9 CPM...

  8. Incidence and mechanism of central pontine myelinolysis based on analysis of MRI images and risk factors

    International Nuclear Information System (INIS)

    Kondo, Masato

    2000-01-01

    In this study, the incidence of central pontine myelinolysis (CPM)-like lesions on MRI images was studied in 1917 subjects, 1,500 of which were psychiatric patients and 417 were patients attending a brain health examination. The CPM-like lesions were first classified into four groups based on the characteristics of their MRI images: group 1 showed symmetrical lesions on both T1 low and T2 high images and were considered to be typical CPM; group 2 showed symmetrical high intensity lesions only on T2 images; group 3 had asymmetrical lesions only on T2 images; and group 4 had asymmetrical lesions on both T1 low and T2 high images. Furthermore, the relationships of each group with particular risk factors, such as alcoholism, hypertension, hyperlipidemia were statistically analysed. The cause of CPM-like features in the MRI images were discussed. Among our subjects, the incidence of CPM-like lesions was 3.8%, and that of group 1 was 1.2%. Significant correlations between group 1 and alcoholism, and group 3 and 4 with brain ischemic lesions were observed. A previous hypothesis that group 2 may be a premature state of CPM is not supported by our results. (author)

  9. Nutrition of the anterior cruciate ligament. Effects of continuous passive motion

    International Nuclear Information System (INIS)

    Skyhar, M.J.; Danzig, L.A.; Hargens, A.R.; Akeson, W.H.

    1985-01-01

    Twelve freshly killed mature male rabbits were used to study the effects of continuous passive motion (CPM) on regional and overall nonvascular nutritional pathways of the anterior cruciate ligament (ACL). One hundred fifty microcuries of 35 S-sulfate was injected intraarticularly into each knee joint. The right knee underwent CPM for 1 hour, while the left knee remained immobilized. Both knee joints were then isolated and immediately frozen. The ACLs were removed while still mostly frozen, and sectioned into anterior, middle, and posterior thirds for the six rabbits in Group 1, and proximal, middle, and distal thirds for the six rabbits in Group 2. In addition, quadriceps tendon samples were harvested from each limb of three rabbits. After appropriate processing, all samples were counted in a scintillation counter, and counts per minute per milligram of tissue were calculated. There was significantly higher uptake in rest extremity ACLs compared to CPM extremity ACLs (P = 0.0001). No significant difference was demonstrated in regional uptake comparing respective thirds of the ACL in either Group 1 or Group 2. Quadriceps tendon uptake trended higher in the limbs exposed to CPM compared to those maintained at rest (P = 0.14). The ACL uses diffusion as a primary nutrient pathway. CPM does not increase nutrient uptake by the ACL in this avascular model, but CPM may facilitate transport of metabolites out of the joint. No regional differences in uptake within the ACL occurred in either group

  10. Short-term test-retest-reliability of conditioned pain modulation using the cold-heat-pain method in healthy subjects and its correlation to parameters of standardized quantitative sensory testing.

    Science.gov (United States)

    Gehling, Julia; Mainka, Tina; Vollert, Jan; Pogatzki-Zahn, Esther M; Maier, Christoph; Enax-Krumova, Elena K

    2016-08-05

    Conditioned Pain Modulation (CPM) is often used to assess human descending pain inhibition. Nine different studies on the test-retest-reliability of different CPM paradigms have been published, but none of them has investigated the commonly used heat-cold-pain method. The results vary widely and therefore, reliability measures cannot be extrapolated from one CPM paradigm to another. Aim of the present study was to analyse the test-retest-reliability of the common heat-cold-pain method and its correlation to pain thresholds. We tested the short-term test-retest-reliability within 40 ± 19.9 h using a cold-water immersion (10 °C, left hand) as conditioning stimulus (CS) and heat pain (43-49 °C, pain intensity 60 ± 5 on the 101-point numeric rating scale, right forearm) as test stimulus (TS) in 25 healthy right-handed subjects (12females, 31.6 ± 14.1 years). The TS was applied 30s before (TSbefore), during (TSduring) and after (TSafter) the 60s CS. The difference between the pain ratings for TSbefore and TSduring represents the early CPM-effect, between TSbefore and TSafter the late CPM-effect. Quantitative sensory testing (QST, DFNS protocol) was performed on both sessions before the CPM assessment. paired t-tests, Intraclass correlation coefficient (ICC), standard error of measurement (SEM), smallest real difference (SRD), Pearson's correlation, Bland-Altman analysis, significance level p Pain ratings during CPM correlated significantly (ICC: 0.411…0.962) between both days, though ratings for TSafter were lower on day 2 (p pain thresholds. The short-term test-retest-reliability of the early CPM-effect using the heat-cold-pain method in healthy subjects achieved satisfying results in terms of the ICC. The SRD of the early CPM effect showed that an individual change of > 20 NRS can be attributed to a real change rather than chance. The late CPM-effect was weaker and not reliable.

  11. Test-retest reproducibility of accommodative facility measures in primary school children.

    Science.gov (United States)

    Adler, Paul; Scally, Andrew J; Barrett, Brendan T

    2018-05-08

    To determine the test-retest reproducibility of accommodative facility (AF) measures in an unselected sample of UK primary school children. Using ±2.00 DS flippers and a viewing distance of 40 cm, AF was measured in 136 children (range 4-12 years, average 8.1 ± 2.1) by five testers on three occasions (average interval between successive tests: eight days, range 1-21 days). On each occasion, AF was measured monocularly and binocularly, for two minutes. Full datasets were obtained in 111 children (81.6 per cent). Intra-individual variation in AF was large (standard deviation [SD] = 3.8 cycles per minute [cpm]) and there was variation due to the identity of the tester (SD = 1.6 cpm). On average, AF was greater: (i) in monocular compared to binocular testing (by 1.4 cpm, p cpm, p cpm lower than in children ≥ 10 years old, p = 0.009); and (iv) on subsequent testing occasions (for example, visit-2 AF was 2.0 cpm higher than visit-1 AF, p cpm monocularly and ≥ 8 cpm binocularly), but this rose to 83.8 per cent after the third test. Using less stringent pass criteria (≥ 6 cpm monocularly and ≥ 3 cpm binocularly), the equivalent figures were 82.9 and 96.4 per cent, respectively. Reduced AF did not co-exist with abnormal near point of accommodation or reduced visual acuity. The results reveal considerable intra-individual variability in raw AF measures in children. When the results are considered as pass/fail, children who initially exhibit normal AF continued to do so on repeat testing. Conversely, the vast majority of children with initially reduced AF exhibit normal performance on repeat testing. Using established pass/fail criteria, the prevalence of persistently reduced AF in this sample is 3.6 per cent. © 2018 Optometry Australia.

  12. Difluoromethylornithine enhanced uptake of tritiated putrescine in 9L rat brain tumors

    International Nuclear Information System (INIS)

    Redgate, E.S.; Grudziak, A.G.; Deutsch, M.; Boggs, S.S.

    1997-01-01

    Difluoromethylornithine (DFMO) depletes endogenous putrescine and enhances the uptake of and retention of [ 3 H] putrescine in vitro. To determine if DFMO also enhances uptake of [ 3 H] putrescine in vivo, DFMO and trace doses of [ 3 H] putrescine, dissolved in artificial CSF, were infused into growing (6-9 day) 9L brain tumors by means of osmotic pumps. When 7-day osmotic pumps were loaded with 1 μCi [ 3 H] putrescine, with or without 10 or 100 mM DFMO, pumped at 1 μl/h, the mean uptake after 3 days was 168 ± 62 cpm/mg tumor (17 rats) without DFMO, 300 ± 197 cpm/mg tumor (11 rats) with 10 mM DFMO and 1088 ± 421 cpm/mg tumor (11 rats) with 100 mM DFMO (p ≤ 0.05 vs. control). Significantly less radioactivity was detected in the contralateral brain and in nonbrain tissues (0.5 ± 0.1 to 14 ± 5 cpm/mg). To measure the extent of [ 3 H] putrescine distribution in the tumor, the same dose of drugs was delivered for a longer period of time, using 14-day pumps to allow tumors to become large enough to be divided into 1.4 mm thick transections. The mean radioactivity in the sections from eight control rats receiving [ 3 H] putrescine without DFMO were not significantly different between the sections (174 ± 61 cpm/mg tumor for sections containing the cannulas, 273 ± 61 and 259 ± 91 cpm/mg for adjacent sections). In the six rats given 100 mM DFMO there was a significant increase in mean radioactivity in the cannula containing section (2251 ± 919 cpm/mg tumor). Mean counts from adjacent sections in these rats were 97 ± 44 and 33 ± 13 cpm/mg. Values for contralateral corpus striatum and nonbrain tissues ranged from 0.7 ± 0.3 to 4.3 ± 1.5 cpm/mg tissue. When DFMO was delivered directly to the tumors while [ 3 H] putrescine was infused intraperitoneally, the uptake in the tumor slices was low (5-10 cpm/mg in different slices). These results demonstrate that infusion of DFMO directly into growing 9L brain tumors can selectively enhance the uptake of exogenous [ 3 H

  13. Stereotactic Radiosurgical Treatment of Brain Metastases to the Choroid Plexus

    International Nuclear Information System (INIS)

    Siomin, Vitaly; Lin, Jennifer L.; Marko, Nicholas F.; Barnett, Gene H.; Toms, Steven A.; Chao, Samuel T.; Angelov, Lilyana; Vogelbaum, Michael A.; Navaratne, Kapila; Suh, John H.; Weil, Robert J.

    2011-01-01

    Purpose: Choroid plexus metastases (CPM) are uncommon lesions. Consequently, optimal management of CPM is uncertain. We summarize our experience with stereotactic radiosurgery (SRS) of CPM. Methods and Materials: Sixteen consecutive patients with presumed CPM treated with SRS between 1997 and 2007 were examined. Twelve were men with a median age at diagnosis of CPM of 61.9 ± 9.9 years; 14 had metastases from renal cell carcinoma (RCC). All patients had controlled primary disease at the time of treatment for CPM. Four patients with RCC and 1 with non-small-cell lung cancer had undergone whole-brain radiotherapy (WBRT) previously and 2 had received SRS to other brain metastases. The disease-free interval from the primary diagnosis to CPM diagnosis averaged 39.3 ± 46.2 months (range, 1.0-156.3). Five patients were asymptomatic; of the remaining 11, none had symptoms related to CPM. All presented with a single CPM. Results: Average maximum diameter of the CPMs was 2.0 ± 1.0 cm (range, 0.9-4.1 cm); mean volume was 2.4 ± 2.6 cm 3 (range, 0.2-9.3). Median SRS dose was 24 Gy to the 53% isodose line (range, 14-24 Gy). Survival after SRS to the CPM was 25.3 ± 23.4 months (range, 3.2-101.6). Patients in Recursive Partitioning Analysis (RPA) class I (n = 10) had improved survival compared to those in class II (n = 6), as did those with better GPA scores. There were no local failures. After SRS, 1 patient underwent WBRT, 3 patients had one, and another had two subsequent SRS treatments to other brain lesions. Of the 14 patients who have died, 11 succumbed to systemic disease progression, 2 to progressive, multifocal central nervous system disease, and 1 to systemic disease with concurrent, stable central nervous system disease. There were no complications related to SRS. Conclusions: Most CPMs are associated with RCC. SRS represents a safe and viable treatment option as primary modality for these metastases, with excellent outcomes.

  14. 77 FR 39733 - Proposed Information Collection; Comment Request: Appalachian Trail Management Partner Survey

    Science.gov (United States)

    2012-07-05

    ... DEPARTMENT OF THE INTERIOR National Park Service [WASO-NRSS-10750; 2490-STC] Proposed Information Collection; Comment Request: Appalachian Trail Management Partner Survey AGENCY: National Park Service (NPS), Interior. ACTION: Notice of an extension of a currently approved information collection (1024-0259...

  15. Engineering Technology Showcase to feature high-tech products from 18 companies

    OpenAIRE

    Gilbert, Karen

    2007-01-01

    The Student Technology Council (STC) at Virginia Tech is sponsoring an Engineering Technology Showcase on Tuesday, March 27. In addition to providing a platform for technology companies to show off their most recent innovations, technology presentations will be offered by Virginia Tech faculty and staff on topics ranging from a virtual greenhouse to the System X supercomputer.

  16. Of creation of up-to-date system for liquid radwaste management at Ukraine's NPPs. Problem statement

    International Nuclear Information System (INIS)

    Andronov, O.B.

    2015-01-01

    The main aspects are addressed of problems in the field of liquid radwaste (LRW) management for Ukrainian NPPs; approaches for its decision, and offers of NNEGC Energoatom SE STC specialists concerning the above issue. Conceptual principle of creation of up-to-date hi-tech complex for LRW management is considered

  17. Development, Implementation, and Analysis of an Environmental Simulation Information Reference Library and Archive (ESIRLA)

    National Research Council Canada - National Science Library

    Burgeson, John

    1997-01-01

    ...) conferences to facilitate the exchange of information on cloud modeling techniques and applications for the benefit of the DoD environmental science community. STC determined the detailed requirements for weather effects products and decision aids for specific Air Force operational electro-optical systems.

  18. 78 FR 14644 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2013-03-07

    ... support clamps installed within the left environmental control systems (ECS) bay, which could allow wiring... the installation of winglets per Supplemental Type Certificate (STC) ST00830SE ( http://rgl.faa.gov... Change the ``Parts Installation Prohibition'' Section Boeing requested the ``Parts Installation...

  19. Partners in Community Service: Making a Community Connection Is Part of "The Stafford Way" at Vermont's Stafford Technical Center

    Science.gov (United States)

    Lucci, William, Jr.

    2005-01-01

    The Stafford Technical Center (STC) in Rutland, Vermont, operates with a mission statement that proudly touts its desire to "create a learning environment that promotes pride in work, a sense of self-worth and the ability to respect others by developing effective communication and life skills." Stafford acknowledges that these learning…

  20. Is routine karyotyping required in prenatal samples with a molecular or metabolic referral?

    Directory of Open Access Journals (Sweden)

    Kooper Angelique JA

    2012-01-01

    Full Text Available Abstract As a routine, karyotyping of invasive prenatal samples is performed as an adjunct to referrals for DNA mutation detection and metabolic testing. We performed a retrospective study on 500 samples to assess the diagnostic value of this procedure. These samples included 454 (90.8% chorionic villus (CV and 46 (9.2% amniocenteses specimens. For CV samples karyotyping was based on analyses of both short-term culture (STC and long-term culture (LTC cells. Overall, 19 (3.8% abnormal karyotypes were denoted: four with a common aneuploidy (trisomy 21, 18 and 13, two with a sex chromosomal aneuploidy (Klinefelter syndrome, one with a sex chromosome mosaicism and twelve with various autosome mosaicisms. In four cases a second invasive test was performed because of an abnormal finding in the STC. Taken together, we conclude that STC and LTC karyotyping has resulted in a diagnostic yield of 19 (3.8% abnormal cases, including 12 cases (2.4% with an uncertain significance. From a diagnostic point of view, it is desirable to limit uncertain test results as secondary test findings. Therefore, we recommend a more targeted assay, such as e.g. QF-PCR, as a replacement of the STC and to provide parents the autonomy to choose between karyotyping and QF-PCR.

  1. The effect of Korean pine nut oil on in vitro CCK release, on appetite sensations and on gut hormones in post-menopausal overweight women

    NARCIS (Netherlands)

    Pasman, W.J.; Heimerikx, J.; Rubingh, C.M.; Berg, R. van den; O'Shea, M.; Gambelli, L.; Hendriks, H.F.J.; Einerhand, A.W.C.; Scott, C.; Keizer, H.G.; Mennen, L.I.

    2008-01-01

    Appetite suppressants may be one strategy in the fight against obesity. This study evaluated whether Korean pine nut free fatty acids (FFA) and triglycerides (TG) work as an appetite suppressant. Korean pine nut FFA were evaluated in STC-1 cell culture for their ability to increase cholecystokinin

  2. Indefensión producida por emplazamiento mediante edictos sin previo agotamiento de las vías ordinarias de comunicación personal

    OpenAIRE

    Vegas Torres, Jaime

    1994-01-01

    Al hilo del comentario de la STC 103/1993, se hace un completo repaso de los precedentes en la doctrina del TC sobre indefensión originada por actos de comunicación mediante edictos sin haber agotado antes las vías ordinarias de comunicación personal. Derecho Público II

  3. Evaluating standard airborne sound insulation measures in terms of annoyance, loudness, and audibility ratings.

    Science.gov (United States)

    Park, H K; Bradley, J S

    2009-07-01

    This paper reports the results of an evaluation of the merits of standard airborne sound insulation measures with respect to subjective ratings of the annoyance and loudness of transmitted sounds. Subjects listened to speech and music sounds modified to represent transmission through 20 different walls with sound transmission class (STC) ratings from 34 to 58. A number of variations in the standard measures were also considered. These included variations in the 8-dB rule for the maximum allowed deficiency in the STC measure as well as variations in the standard 32-dB total allowed deficiency. Several spectrum adaptation terms were considered in combination with weighted sound reduction index (R(w)) values as well as modifications to the range of included frequencies in the standard rating contour. A STC measure without an 8-dB rule and an R(w) rating with a new spectrum adaptation term were better predictors of annoyance and loudness ratings of speech sounds. R(w) ratings with one of two modified C(tr) spectrum adaptation terms were better predictors of annoyance and loudness ratings of transmitted music sounds. Although some measures were much better predictors of responses to one type of sound than were the standard STC and R(w) values, no measure was remarkably improved for predicting annoyance and loudness ratings of both music and speech sounds.

  4. In Pursuit of a Rewarding Career

    Science.gov (United States)

    Murphy, Avon J.

    2015-01-01

    Avon Murphy has been a college professor, a technical communications program director, a government technical writer, a freelancer, a contract editor at Microsoft and other firms, and owner of Murphy Editing and Writing Services. An STC (Society for Technical Communication) Fellow, he was for 17 years book review editor for "Technical…

  5. 77 FR 50159 - 60-Day Notice of Intention To Request Clearance of Collection of Information; Opportunity for...

    Science.gov (United States)

    2012-08-20

    ...). SUPPLEMENTARY INFORMATION: I. Abstract The purpose of this information collection is to assist the National Park... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-PCE-COR-10909; 2230-STC] 60-Day Notice...: National Park Service, Interior. ACTION: Notice; request for comments. SUMMARY: We (National Park Service...

  6. Technology Can Help Young Children Succeed. PACER Center ACTion Information Sheets: PHP-c70

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    Parents of young children with disabilities are discovering that carefully selected computer software and mobile apps can provide many benefits such as improved self-esteem, a longer attention span, and inclusion among family and other children that help their children succeed at home and in school. PACER's Simon Technology Center (STC) can help…

  7. Gas Chromatography-Mass Spectrometry for Metabolite Profiling of Japanese Black Cattle Naturally Contaminated with Zearalenone and Sterigmatocystin

    NARCIS (Netherlands)

    Toda, Katsuki; Kokushi, Emiko; Uno, Seiichi; Shiiba, Ayaka; Hasunuma, Hiroshi; Fushimi, Yasuo; Wijayagunawardane, Missaka P B; Zhang, Chunhua; Yamato, Osamu; Taniguchi, Masayasu; Fink-Gremmels, Johanna; Takagi, Mitsuhiro

    2017-01-01

    The objective of this study was to evaluate the metabolic profile of cattle fed with or without zearalenone (ZEN) and sterigmatocystin (STC)-contaminated diets using a gas chromatography-mass spectrometry metabolomics approach. Urinary samples were collected from individual animals (n = 6 per herd)

  8. AcEST: DK949756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available kinase D... 31 6.8 sp|P26372|KRUC_SHEEP Keratin, ultra high-sulfur matrix protein O... 31 6.8 sp|P40798|STC_DROME Protein shuttle cra...ft OS=Drosophila melanoga... 30 8.8 sp|Q0V8T4|CTP5C_RAT

  9. Acceptable short-term outcome of laparoscopic subtotal colectomy for inflammatory bowel disease

    DEFF Research Database (Denmark)

    Frid, Natalie Lassen; Bulut, Orhan; Pachler, Jørn

    2013-01-01

    Laparoscopic colectomy for both benign and malignant disease, including inflammatory bowel disease (IBD), has recently been shown to have many advantages compared with open surgery. This study aimed to compare the effect of laparoscopic versus open subtotal colectomy (STC) for IBD on overall...

  10. Stock-market efficiency in thin-trading markets : the case of the Vietnamese stock market

    NARCIS (Netherlands)

    Truong Dong Loc, [No Value; Lanjouw, Ger; Lensink, Robert

    2010-01-01

    This article reviews developments in the Stock Trading Centre (STC) in Ho Chi Minh City, Vietnam, the main stock market in the country, since its start in 2000. It presents information about developments in the number of stocks traded, trading activity and stock-price developments. This article

  11. Stock Market Efficiency in Thin Trading Markets: The Case of the Vietnamese Stock Market

    NARCIS (Netherlands)

    Dong Loc, T.; Lanjouw, G.; Lensink, B.W.

    2010-01-01

    This article reviews developments in the Stock Trading Centre (STC) in Ho Chi Minh City, Vietnam, the main stock market in the country, since its start in 2000. It presents information about developments in the number of stocks traded, trading activity and stock-price developments. This article

  12. Orthographic dependency in the neural correlates of reading: Evidence from audiovisual integration in English readers

    NARCIS (Netherlands)

    Holloway, I.; van Atteveldt, N.M.; Blomert, L.; Ansari, D.

    2015-01-01

    Reading skills are indispensible in modern technological societies. In transparent alphabetic orthographies, such as Dutch, reading skills build on associations between letters and speech sounds (LS pairs). Previously, we showed that the superior temporal cortex (STC) of Dutch readers is sensitive

  13. parameter extraction and estimation based on the pv panel outdoor

    African Journals Online (AJOL)

    userpc

    The five parameters in Equation (1) depend on the incident solar irradiance, the cell temperature, and on their reference values. These reference values are generally provided by manufacturers of PV modules for specified operating condition such as STC (Standard Test Conditions) for which the irradiance is 1000 and the.

  14. 75 FR 61655 - Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes

    Science.gov (United States)

    2010-10-06

    ...-1006; Directorate Identifier 2009-CE-057-AD] RIN 2120-AA64 Airworthiness Directives; Piper Aircraft... airworthiness directive (AD) for all Piper Aircraft, Inc. (Piper) Model PA-28-161 airplanes equipped with.... Piper Model PA-28-161 airplanes modified by STC No. SA03303AT have a similar unsafe design feature that...

  15. Best Practices in School-to-Careers: The Utilities Industry.

    Science.gov (United States)

    National Employer Leadership Council, Washington, DC.

    This document highlights the school-to-careers (STC) partnerships connecting workplace experiences to classroom learning to prepare students for successful employment in the utilities industry. First, the current state of the utilities industry and careers in the utilities industry are reviewed. Next, the following organizations and employers are…

  16. Best Practices in School-to-Careers: The Home Building Industry.

    Science.gov (United States)

    National Employer Leadership Council, Washington, DC.

    This document highlights the school-to-careers (STC) partnerships connecting workplace experiences to classroom learning to prepare students for successful employment in the home building industry. First, the current state of the home building industry is reviewed. Next, the following organizations and employers are profiled: (1) the National…

  17. 77 FR 27663 - Airworthiness Directives; Aeronautical Accessories, Inc. High Landing Gear Forward Crosstube...

    Science.gov (United States)

    2012-05-11

    ... under STC SR01052AT. This proposal would require creating a component history card or equivalent record...), creating a component history card or equivalent record for each affected crosstube, and determining and... multiplying the airframe hours TIS by a factor of 10. Continue to count and record the number of landings for...

  18. 78 FR 21702 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-04-11

    ... documents or comments received, go to http://www.regulations.gov at any time or to the Docket Management... airplanes operated as private use, not for hire, not for common carriage. Side-facing seats are to be installed by Greenpoint Technologies for the original supplemental type certificate (STC). The limitation is...

  19. 75 FR 4482 - Airworthiness Directives; Eurocopter France Model SE3160, SA315B, SA316B, SA316C, and SA319B...

    Science.gov (United States)

    2010-01-28

    ..., Part A, paragraph 2.a. through 2.e., of the SB. (1) If there is no void or paint crack in the root... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Part 39 [Docket No. FAA-2010... Parts Manufacturer Approval under Supplemental Type Certificate (STC) SH778GL. The AD requires...

  20. Texas Affordable Baccalaureate Program: A Collaboration between the Texas Higher Education Coordinating Board, South Texas College, and Texas A&M University-Commerce. CBE Case Study

    Science.gov (United States)

    Klein-Collins, Rebecca; Glancey, Kathleen

    2015-01-01

    This case study is part of a series on newer competency-based degree programs that have been emerging in recent years. In January 2014, the Texas Higher Education Coordinating Board (THECB), South Texas College (STC), and Texas A&M University-Commerce (A&M Commerce) launched the Texas Affordable Baccalaureate Program, the state's first…

  1. 77 FR 5580 - Notice of Intent To Seek Approval To Extend an Information Collection

    Science.gov (United States)

    2012-02-03

    ... society. STCs enable and foster excellent education, integrate research and education, and create bonds... activities; descriptions of significant advances and other outcomes of the STC effort. Part of this reporting..., electronic, mechanical, or other technological collection techniques or other forms of information technology...

  2. Multimodality Imaging of Calcinosis of Chronic Renal Failure

    OpenAIRE

    Loya, Raul; Beavers, Kimberly; Scherer, Kurt

    2017-01-01

    Secondary tumoral calcinosis (STC) refers to periarticular calcified masses associated with an identifiable condition. The most common of these identifiable conditions is a chronic renal failure. We present a unique case in which massive periarticular masses in a patient with calcinosis of chronic renal failure (CCRF) are demonstrated in the shoulder and hip on sonography, radiography and computed tomography (CT).

  3. Sponsorship and exhibitions at Nordic science centres and museums

    DEFF Research Database (Denmark)

    Davidsson, Eva; Sørensen, Helene

    2010-01-01

    Science and technology centres (STC) and science museums tend increasingly to rely on external economic support in order to create new exhibitions. But in what ways may the economic situation affect what is presented in their exhibitions? This article aims to explore how staff members consider...

  4. Direct verification of the lubrication force on a sphere travelling through a viscous film upon approach to a solid wall

    KAUST Repository

    Marston, Jeremy; Wang, Yong; Thoroddsen, Sigurdur T

    2010-01-01

    on the sphere, derived from lubrication theory. Using high-speed video imaging we show, for the first time, that the equations of motion based on the lubrication approximation correctly describe the deceleration of the sphere when St < Stc. Furthermore, we

  5. Cyclic changes of steroid production activity in the ovary and ...

    African Journals Online (AJOL)

    1986-07-25

    Jul 25, 1986 ... cells and estradiol-17~ concentration in the plasma reached a peak during exogenous vitellogenesis. .... 3~-HSD activity; ><205. 3(3-Hydroxy steroid dehydrogenase (3~-HSD) activity in the adrenal gland of the rat. B. Activity 1 (Act: 1) x205. Interstitial cells ([SC); special Iheca cells (STC); Stage ITT oocyte ...

  6. 78 FR 65155 - Special Conditions: Learjet Model 45 Series Airplanes; Isolation or Security Protection of the...

    Science.gov (United States)

    2013-10-31

    ... an association, business, labor union, etc.). DOT's complete Privacy Act Statement can be found in... supplemental type certificate (STC) change in the digital systems architecture in the Learjet Model 45 series... plus two crew members. The proposed Learjet Model 45 architecture is new and novel for commercial...

  7. PhySIC_IST: cleaning source trees to infer more informative supertrees.

    Science.gov (United States)

    Scornavacca, Celine; Berry, Vincent; Lefort, Vincent; Douzery, Emmanuel J P; Ranwez, Vincent

    2008-10-04

    Supertree methods combine phylogenies with overlapping sets of taxa into a larger one. Topological conflicts frequently arise among source trees for methodological or biological reasons, such as long branch attraction, lateral gene transfers, gene duplication/loss or deep gene coalescence. When topological conflicts occur among source trees, liberal methods infer supertrees containing the most frequent alternative, while veto methods infer supertrees not contradicting any source tree, i.e. discard all conflicting resolutions. When the source trees host a significant number of topological conflicts or have a small taxon overlap, supertree methods of both kinds can propose poorly resolved, hence uninformative, supertrees. To overcome this problem, we propose to infer non-plenary supertrees, i.e. supertrees that do not necessarily contain all the taxa present in the source trees, discarding those whose position greatly differs among source trees or for which insufficient information is provided. We detail a variant of the PhySIC veto method called PhySIC_IST that can infer non-plenary supertrees. PhySIC_IST aims at inferring supertrees that satisfy the same appealing theoretical properties as with PhySIC, while being as informative as possible under this constraint. The informativeness of a supertree is estimated using a variation of the CIC (Cladistic Information Content) criterion, that takes into account both the presence of multifurcations and the absence of some taxa. Additionally, we propose a statistical preprocessing step called STC (Source Trees Correction) to correct the source trees prior to the supertree inference. STC is a liberal step that removes the parts of each source tree that significantly conflict with other source trees. Combining STC with a veto method allows an explicit trade-off between veto and liberal approaches, tuned by a single parameter.Performing large-scale simulations, we observe that STC+PhySIC_IST infers much more informative

  8. Test results and commercialization plans for long life Stirling generators

    International Nuclear Information System (INIS)

    Erbeznik, R.M.; White, M.A.

    1996-01-01

    Many optimistic predictions regarding commercialization of Stirling engines have been announced over the years, but to date no real successes have emerged. STC is excited to announce the availability of beta prototypes for its RemoteGen trademark family of free-piston Stirling generators. STC is working with suppliers, manufacturers, and beta customers to commercialize the RemoteGen family of generators. STC is proving that these machines overcome previously inhibiting barriers by providing long life, high reliability, cost effective mass production, and market relevance. Stirling power generators are generally acknowledged to offer much higher conversion efficiencies than direct energy conversion systems. Life and reliability, on the other hand, are generally considered superior for direct conversion systems, as established by the exceptional endurance records (though with degradation) for thermoelectric (TE) and photovoltaic (PV) systems. STC's unique approaches combine dynamic system efficiency with static system reliability. The RemoteGen family presently includes a 10-watt RG-10, a 350-watt RG-350, and with 1-kW and 3-kW sizes planned for the future. They all use the same basic configuration with flexure bearings, clearance seals, and moving iron linear alternators. The third generation RG-10 has entered limited production with a radioisotope-fueled version, and a niche market for a propane-fueled version has been identified. Market analysis has led STC to focus on early commercial production of the RG-350. The linear alternator power module portion of the RG-350 is also used in its sister BeCool trademark family of coolers as the linear motor. By using a common power module, both programs will benefit by each other's commercialization efforts. The technology behind the RemoteGen generators, test results, and plans for commercialization are described in this paper

  9. Evolution of mitochondrial power in vertebrate metazoans.

    Directory of Open Access Journals (Sweden)

    Yasuhiro Kitazoe

    Full Text Available BACKGROUND: Basal metabolic rate (BMR has a very strong body-mass (M dependence in an individual animal group, and BMR per unit mass (msBMR converges on a markedly narrow range even across major taxonomic groups. However, it is here a basic question in metazoan biology how much BMR per unit mitochondrion (mtBMR changes, and then whether mtBMR can be related to the original molecular mechanism of action of mt-encoded membrane proteins (MMPs playing a central role in cellular energy production. METHODOLOGY/PRINCIPAL FINDINGS: Analyzing variations of amino-acid compositions of MMPs across 13 metazoan animal groups, incorporating 2022 sequences, we found a strong inverse correlation between Ser/Thr composition (STC and hydrophobicity (HYD. A majority of animal groups showed an evolutionary pathway of a gradual increase in HYD and decrease in STC, whereas only the deuterostome lineage revealed a rapid decrease in HYD and increase in STC. The strongest correlations appeared in 5 large subunits (ND4, ND5, ND2, CO1, and CO3 undergoing dynamic conformational changes for the proton-pumping function. The pathway of the majority groups is well understood as reflecting natural selection to reduce mtBMR, since simply raising HYD in MMPs (surrounded by the lipid bilayer weakens their mobility and strengthens their stability. On the other hand, the marked decrease in HYD of the deuterostome elevates mtBMR, but is accompanied with their instability heightening a turnover rate of mitochondria and then cells. Interestingly, cooperative networks of interhelical hydrogen-bonds between motifs involving Ser and Thr residues can enhance MMP stability. CONCLUSION/SIGNIFICANCE: This stability enhancement lowers turnover rates of mitochondria/cells and may prolong even longevity, and was indeed founded by strong positive correlations of STC with both mtBMR and longevity. The lowest HYD and highest STC in Aves and Mammals are congruent with their very high mtBMR and long

  10. Brain structural abnormalities and mental health sequelae in South Vietnamese ex-political detainees who survived traumatic head injury and torture.

    Science.gov (United States)

    Mollica, Richard F; Lyoo, In Kyoon; Chernoff, Miriam C; Bui, Hoan X; Lavelle, James; Yoon, Sujung J; Kim, Jieun E; Renshaw, Perry F

    2009-11-01

    A pilot study of South Vietnamese ex-political detainees who had been incarcerated in Vietnamese reeducation camps and resettled in the United States disclosed significant mental health problems associated with torture and traumatic head injury (THI). To identify structural brain alterations associated with THI and to investigate whether these deficits are associated with posttraumatic stress disorder and depression. Cross-sectional neuroimaging study. Massachusetts General Hospital and McLean Hospital. A subsample of Vietnamese ex-political detainees (n = 42) and comparison subjects (n = 16) selected from a community study of 337 ex-political detainees and 82 comparison subjects. Scores on the Vietnamese versions of the Hopkins Symptom Checklist-25 (HSCL) and Harvard Trauma Questionnaire for depression and posttraumatic stress disorder, respectively; cerebral regional cortical thickness; and manual volumetric morphometry of the amygdala, hippocampus, and thalamus. Ex-political detainees exposed to THI (n = 16) showed a higher rate of depression (odds ratio, 10.2; 95% confidence interval, 1.2-90.0) than those without THI exposure (n = 26). Ex-political detainees with THI had thinner prefrontotemporal cortices than those without THI exposure (P brain map) in the left dorsolateral prefrontal and bilateral superior temporal cortices, controlling for age, handedness, and number of trauma/torture events (left superior frontal cortex [SFC], P = .006; left middle frontal cortex, P = .01; left superior temporal cortex [STC], P = .007; right STC, P = .01). Trauma/torture events were associated with bilateral amygdala volume loss (left, P = .045; right, P = .003). Cortical thinning associated with THI in the left SFC and bilateral STC was related to HSCL depression scores in THI-exposed (vs non-THI-exposed) ex-political detainees (left SFC, P for interaction = .007; left STC, P for interaction = .03; right STC, P for interaction = .02). Structural deficits in

  11. Influences of tropical-extratropical interaction on the multidecadal AMOC variability in the NCEP climate forecast system

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Bohua; Schneider, Edwin K.; Klinger, Barry [Gorge Mason University, Department of Atmospheric, Oceanic, and Earth Sciences, College of Science, Fairfax, VA (United States); Institute of Global Environment and Society, Center for Ocean-Land-Atmosphere Studies, Calverton, MD (United States); Hu, Zeng-Zhen; Xue, Yan [National Centers for Environmental Prediction/NOAA, Climate Prediction Center, Camp Springs, MD (United States); Wu, Zhaohua [Florida State University, Department of Earth, Ocean, and Atmospheric Science, Center for Ocean-Atmospheric Prediction Studies, Tallahassee, FL (United States)

    2012-08-15

    We have examined the mechanisms of a multidecadal oscillation of the Atlantic Meridional Overturning Circulation (AMOC) in a 335-year simulation of the Climate Forecast System (CFS), the climate prediction model developed at the National Centers for Environmental Prediction (NCEP). Both the mean and seasonal cycle of the AMOC in the CFS are generally consistent with observation-based estimates with a maximum northward volume transport of 16 Sv (10{sup 6} m{sup 3}/s) near 35 N at 1.2 km. The annual mean AMOC shows an intermittent quasi 30-year oscillation. Its dominant structure includes a deep anomalous overturning cell (referred to as the anomalous AMOC) with amplitude of 0.6 Sv near 35 N and an anomalous subtropical cell (STC) of shallow overturning spanning across the equator. The mechanism for the oscillation includes a positive feedback between the anomalous AMOC and surface wind stress anomalies in mid-latitudes and a negative feedback between the anomalous STC and AMOC. A strong AMOC is associated with warm sea surface temperature anomaly (SSTA) centered near 45 N, which generates an anticyclonic easterly surface wind anomaly. This anticyclonic wind anomaly enhances the regional downwelling and reinforces the anomalous AMOC. In the mean time, a wind-evaporation-SST (WES) feedback extends the warm SSTA to the tropics and induces a cyclonic wind stress anomaly there, which drives a tropical upwelling and weakens the STC north of the equator. The STC anomaly, in turn, drives a cold upper ocean heat content anomaly (HCA) in the northern tropical Atlantic and weakens the meridional heat transport from the tropics to the mid-latitude through an anomalous southward western boundary current. The anomalous STC transports cold HCA from the subtropics to the mid-latitudes, weakening the mid-latitude deep overturning. (orig.)

  12. Outcomes of laryngohyoid suspension techniques in an ovine model of profound oropharyngeal dysphagia.

    Science.gov (United States)

    Johnson, Christopher M; Venkatesan, Naren N; Siddiqui, M Tausif; Cates, Daniel J; Kuhn, Maggie A; Postma, Gregory M; Belafsky, Peter C

    2017-12-01

    To evaluate the efficacy of various techniques of laryngohyoid suspension in the elimination of aspiration utilizing a cadaveric ovine model of profound oropharyngeal dysphagia. Animal study. The head and neck of a Dorper cross ewe was placed in the lateral fluoroscopic view. Five conditions were tested: baseline, thyroid cartilage to hyoid approximation (THA), thyroid cartilage to hyoid to mandible (laryngohyoid) suspension (LHS), LHS with cricopharyngeus muscle myotomy (LHS-CPM), and cricopharyngeus muscle myotomy (CPM) alone. Five 20-mL trials of barium sulfate were delivered into the oropharynx under fluoroscopy for each condition. Outcome measures included the penetration aspiration scale (PAS) and the National Institutes of Health (NIH) Swallow Safety Scale (NIH-SSS). Median baseline PAS and NIH-SSS scores were 8 and 6, respectively, indicating severe impairment. THA scores were not improved from baseline. LHS alone reduced the PAS to 1 (P = .025) and NIH-SSS to 2 (P = .025) from baseline. LHS-CPM reduced the PAS to 1 (P = .025) and NIH-SSS to 0 (P = .025) from baseline. CPM alone did not improve scores. LHS-CPM displayed improved NIH-SSS over LHS alone (P = .003). This cadaveric model represents end-stage profound oropharyngeal dysphagia such as what could result from severe neurological insult. CPM alone failed to improve fluoroscopic outcomes in this model. Thyrohyoid approximation also failed to improve outcomes. LHS significantly improved both PAS and NIH-SSS. The addition of CPM to LHS resulted in improvement over suspension alone. NA. Laryngoscope, 127:E422-E427, 2017. © 2017 The American Laryngological, Rhinological and Otological Society, Inc.

  13. Objectively measured active travel and uses of activity-friendly neighborhood resources: Does change in use relate to change in physical activity and BMI?

    Directory of Open Access Journals (Sweden)

    Barbara B. Brown

    2017-12-01

    Full Text Available Few studies examine how objectively measured use of local physical activity resources contributes to objectively-measured healthy physical activity and weight changes over time. We utilized objective measures to test whether changes in active travel and uses of three physical activity (PA resources–parks, recreation centers, and transit– related to changes in PA and BMI. Adults (n=536 in Salt Lake City, UT, wore accelerometer and GPS units in 2012 and 2013, before and after neighborhood rail completion. Regression outcomes included accelerometer counts per minute (cpm, MVPA (moderate-to-vigorous activity minutes/10h accelerometer wear and measured BMI; key predictors were changes in active travel and PA resource uses (former and new uses. Significant results (all p<0.05 showed that increased active travel related to increased total PA (59.86cpm and 8.50 MVPA; decreased active travel related to decreased MVPA (−3.01 MVPA. Poorer outcomes were seen after discontinuing use of parks (−36.29cpm, −5.73 MVPA, and +0.44 BMI points, recreation centers (−6.18 MVPA, and transit (−48.14cpm, −5.43 MVPA, and +0.66 BMI. Healthier outcomes were seen after commencing use of parks (29.83cpm, 5.25 MVPA, recreation centers (44.63cpm and transit (38.44cpm, 4.17 MVPA, and −0.56 BMI. Transit and park/recreational center uses were unrelated, although park users were more likely to be recreation center users. Active travel and use of three neighborhood PA resources relate to healthy activity and could be fostered by policy and design. Keywords: Recreation center, Accelerometry, Active transport, Built environment, Parks, Global positioning system

  14. Trajectories of mental health problems in children of parents with mental health problems: results of the BELLA study.

    Science.gov (United States)

    Plass-Christl, Angela; Otto, Christiane; Klasen, Fionna; Wiegand-Grefe, Silke; Barkmann, Claus; Hölling, Heike; Schulte-Markwort, Michael; Ravens-Sieberer, Ulrike

    2017-11-24

    Children of parents with mental health problems (CPM) have an increased risk for behavioral and psychological problems. This study investigated the age- and gender-specific course as well as predictors of mental health problems in CPM using the longitudinal data (baseline 1- and 2-year follow-ups) of a German general population sample from the BELLA study. Children and adolescents aged 11-17 years (at baseline) who had a parent with mental health problems (n = 325) were analyzed. The mental health problems of the children were assessed by the self-reported version of the strengths and difficulties questionnaire (SDQ). We used individual growth modeling to investigate the age- and gender-specific course, and the effects of risk as well as personal, familial and social protective factors on self-reported mental health problems in CPM. Additionally, data were examined differentiating internalizing and externalizing mental health problems in CPM. Results indicated that female compared to male CPM showed increasing mental health problems with increasing age. Mental health problems in CPM were associated with lower self-efficacy, worse family climate and less social competence over time. Internalizing problems were associated with lower self-efficacy, less social competence and more severe parental mental health problems. Externalizing problems were associated with lower self-efficacy, worse family climate and lower social competence. The main limitations of the study are the short time period (2 years) covered and the report of mental health problems by only one parent. Our findings should be considered in the development of treatment and prevention programs for mental health problems in CPM.

  15. Synthesis and Evaluation of A High Precision 3D-Printed Ti6Al4V Compliant Parallel Manipulator

    Science.gov (United States)

    Pham, Minh Tuan; Teo, Tat Joo; Huat Yeo, Song; Wang, Pan; Nai, Mui Ling Sharon

    2017-12-01

    A novel 3D printed compliant parallel manipulator (CPM) with θX - θX - Z motions is presented in this paper. This CPM is synthesized using the beam-based method, a new structural optimization approach, to achieve optimized stiffness properties with targeted dynamic behavior. The CPM performs high non-actuating stiffness based on the predicted stiffness ratios of about 3600 for translations and 570 for rotations, while the dynamic response is fast with the targeted first resonant mode of 100Hz. A prototype of the synthesized CPM is fabricated using the electron beam melting (EBM) technology with Ti6Al4V material. Driven by three voice-coil (VC) motors, the CPM demonstrated a positioning resolution of 50nm along the Z axis and an angular resolution of ~0.3 “about the X and Y axes, the positioning accuracy is also good with the measured values of ±25.2nm and ±0.17” for the translation and rotations respectively. Experimental investigation also shows that this large workspace CPM has a first resonant mode of 98Hz and the stiffness behavior matches the prediction with the highest deviation of 11.2%. Most importantly, the full workspace of 10° × 10° × 7mm of the proposed CPM can be achieved, that demonstrates 3D printed compliant mechanisms can perform large elastic deformation. The obtained results show that CPMs printed by EBM technology have predictable mechanical characteristics and are applicable in precise positioning systems.

  16. The Effects of Curcuma longa L., Purple Sweet Potato, and Mixtures of the Two on Immunomodulation in C57BL/6J Mice Infected with LP-BM5 Murine Leukemia Retrovirus.

    Science.gov (United States)

    Park, Soo-Jeung; Lee, Dasom; Lee, Minhee; Kwon, Han-Ol; Kim, Hyesook; Park, Jeongjin; Jeon, Woojin; Cha, Minseok; Jun, Suhwa; Park, Kwangjin; Lee, Jeongmin

    2018-06-04

    The immune response is stimulated to protect the body from external antigens and is controlled by several types of immune cells. In the present study, the immunomodulatory effects of Curcuma longa L., purple sweet potato, and mixtures of the two (CPM) were investigated in C57BL/6 mice infected with LP-BM5 murine leukemia virus (MuLV). Mice were divided into seven groups as follows: normal control, infected control (LP-BM5 MuLV infection), positive control (LP-BM5 MuLV infection+dietary supplement of red ginseng 300 mg/kg body weight), the original powder of C. longa L. (C; LP-BM5 MuLV infection+dietary supplement of C 189 mg/kg body weight), the original powder of purple sweet potato (P; LP-BM5 MuLV infection+dietary supplement of P 1811 mg/kg body weight), CPM Low (CPL; LP-BM5 MuLV infection+CPM 2 g/kg body weight), and CPM High (CPH; LP-BM5 MuLV infection+CPM 5 g/kg body weight). Dietary supplementation lasted for 12 weeks. Dietary supplementation of CPM inhibited LP-BM5 MuLV-induced lymphadenopathy and splenomegaly and inhibited reduction of messenger RNA (mRNA) expression of major histocompatibility complex (MHC) I and II. Moreover, CPM reduced the decrease in T- and B cell proliferation, reduced the population of CD4(+)/CD8(+) T cells, and remedied the unbalanced production of T helper-1 (Th1)/T helper-2 (Th2) cytokines in LP-BM5 MuLV-infected mice. In addition, CPM inhibited reduction of phagocytosis in peritoneal macrophages and decreased serum levels of immunoglobulin A (IgA), immunoglobulin E (IgE), and immunoglobulin G (IgG). These results suggest that CPM had a positive effect on immunomodulation in C57BL/6 mice induced by LP-BM5 leukemia retrovirus infection.

  17. Pilot study of sodium phenylbutyrate as adjuvant in cyclophosphamide-resistant endemic Burkitt's lymphoma.

    Science.gov (United States)

    Phillips, John A; Griffin, Beverly E

    2007-12-01

    Burkitt's lymphoma (BL) accounts for the majority of childhood malignancies seen in sub-Saharan Africa. In Malawi, cyclophosphamide (CPM), the mainstay of treatment for endemic BL, is effective in around 50% of cases. Evidence exists in support of an association between activation of replication of Epstein-Barr virus (EBV) in the tumour and response to this chemotheraupeutic agent. Phenylbutyrate (PB), approved for treatment of inborn errors of the urea cycle with minimal toxicity in children, induces EBV replication and cell lysis in BL-derived cell cultures. It has also shown some success as adjuvant in treatment of chronic leukaemia and lymphoma. We tested in African BL patients with CPM-resistant tumours, and thus unlikely to survive, the hypothesis that PB can reverse this resistance. A study of five patients showed PB before CPM to induce shrinkage of CPM-resistant tumours in two of them. Findings suggested that for this effect PB pre-treatment should be given for a week before CPM treatment. A larger study is indicated.

  18. Prediction of wall shear stresses in transitional boundary layers using near-wall mean velocity profiles

    International Nuclear Information System (INIS)

    Jeon, Woo Pyung; Shin, Sung Ho; Kang, Shin Hyoung

    2000-01-01

    The local wall shear stress in transitional boundary layer was estimated from the near-wall mean velocity data using the principle of Computational Preston tube Method(CPM). The previous DNS and experimental databases of transitional boundary layers were used to demonstrate the accuracy of the method and to provide the applicable range of wall unit y + . The skin friction coefficients predicted by the CPM agreed well with those from previous studies. To reexamine the applicability of the CPM, near-wall hot-wire measurements were conducted in developing transitional boundary layers on a flat plate with different freestream turbulence intensities. The intermittency profiles across the transitional boundary layers were reasonably obtained from the conditional sampling technique. An empirical correlation between the representative intermittency near the wall and the free parameter K 1 of the extended wall function of CPM has been newly proposed using the present and other experimental data. The CPM has been verified as a useful tool to measure the wall shear stress in transitional boundary layer with reasonable accuracy

  19. Deterioration of abstract reasoning ability in mild cognitive impairment and Alzheimer's disease: correlation with regional grey matter volume loss revealed by diffeomorphic anatomical registration through exponentiated lie algebra analysis

    Energy Technology Data Exchange (ETDEWEB)

    Yoshiura, Takashi; Hiwatashi, Akio; Yamashita, Koji; Takayama, Yukihisa; Kamano, Norihiro; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Ohyagi, Yasumasa; Kira, Jun-ichi [Kyushu University, Department of Neurology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Monji, Akira; Kawashima, Toshiro [Kyushu University, Department of Neuropsychiatry, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan)

    2011-02-15

    To determine which brain regions are relevant to deterioration in abstract reasoning as measured by Raven's Colored Progressive Matrices (CPM) in the context of dementia. MR images of 37 consecutive patients including 19 with Alzheimer's disease (AD) and 18 with amnestic mild cognitive impairment (aMCI) were retrospectively analyzed. All patients were administered the CPM. Regional grey matter (GM) volume was evaluated according to the regimens of voxel-based morphometry, during which a non-linear registration algorithm called Diffeomorphic Anatomical Registration Through Exponentiated Lie algebra was employed. Multiple regression analyses were used to map the regions where GM volumes were correlated with CPM scores. The strongest correlation with CPM scores was seen in the left middle frontal gyrus while a region with the largest volume was identified in the left superior temporal gyrus. Significant correlations were seen in 14 additional regions in the bilateral cerebral hemispheres and right cerebellum. Deterioration of abstract reasoning ability in AD and aMCI measured by CPM is related to GM loss in multiple regions, which is in close agreement with the results of previous activation studies. (orig.)

  20. Systematic Design Method and Experimental Validation of a 2-DOF Compliant Parallel Mechanism with Excellent Input and Output Decoupling Performances

    Directory of Open Access Journals (Sweden)

    Yao Jiang

    2017-06-01

    Full Text Available The output and input coupling characteristics of the compliant parallel mechanism (CPM bring difficulty in the motion control and challenge its high performance and operational safety. This paper presents a systematic design method for a 2-degrees-of-freedom (DOFs CPM with excellent decoupling performance. A symmetric kinematic structure can guarantee a CPM with a complete output decoupling characteristic; input coupling is reduced by resorting to a flexure-based decoupler. This work discusses the stiffness design requirement of the decoupler and proposes a compound flexure hinge as its basic structure. Analytical methods have been derived to assess the mechanical performances of the CPM in terms of input and output stiffness, motion stroke, input coupling degree, and natural frequency. The CPM’s geometric parameters were optimized to minimize the input coupling while ensuring key performance indicators at the same time. The optimized CPM’s performances were then evaluated by using a finite element analysis. Finally, a prototype was constructed and experimental validations were carried out to test the performance of the CPM and verify the effectiveness of the design method. The design procedure proposed in this paper is systematic and can be extended to design the CPMs with other types of motion.

  1. A quantitative analysis of Tl-201 myocardial perfusion image with special reference to circumferential profile method

    International Nuclear Information System (INIS)

    Miyanaga, Hajime

    1982-01-01

    A quantitative analysis of thallium-201 myocardial perfusion image (MPI) was attempted by using circumferential profile method (CPM) and the first purpose of this study is to assess the clinical utility of this method for the detection of myocardial ischemia. In patients with coronary artery disease, CPM analysis to exercise T1-MPI showed high sensitivity (9/12, 75%) and specificity (9/9, 100%), whereas exercise ECG showed high sensitivity (9/12, 75%), but relatively low specificity (7/9, 78%). In patients with myocardial infarction, CPM also showed high sensitivity (34/38, 89%) for the detection of myocardial necrosis, compared with visual interpretation (31/38, 81%) and with ECG (31/38, 81%). Defect score was correlated well with the number of abnormal Q waves. In exercise study, CPM was also sensitive to the change of perfusion defect in T1-MPI produced by exercise. So the results indicate that CPM is a good method not only quantitatively but also objectively to analyze T1-MPI. Although ECG is the most commonly used diagnostic tool for ischemic heart disease, several exercise induced ischemic changes in ECG have been still on discussion as criteria. So the second purpose of this study is to evaluate these ischemic ECG changes by exercise T1-MPI analized quantitatively. ST depression (ischemic 1 mm and junctional 2 mm or more), ST elevation (1 mm or more), and coronary T wave reversion in exercise ECG were though to be ischemic changes. (J.P.N.)

  2. Is the conditioned pain modulation paradigm reliable? A test-retest assessment using the nociceptive withdrawal reflex.

    Directory of Open Access Journals (Sweden)

    José A Biurrun Manresa

    Full Text Available The aim of this study was to determine the reliability of the conditioned pain modulation (CPM paradigm assessed by an objective electrophysiological method, the nociceptive withdrawal reflex (NWR, and psychophysical measures, using hypothetical sample sizes for future studies as analytical goals. Thirty-four healthy volunteers participated in two identical experimental sessions, separated by 1 to 3 weeks. In each session, the cold pressor test (CPT was used to induce CPM, and the NWR thresholds, electrical pain detection thresholds and pain intensity ratings after suprathreshold electrical stimulation were assessed before and during CPT. CPM was consistently detected by all methods, and the electrophysiological measures did not introduce additional variation to the assessment. In particular, 99% of the trials resulted in higher NWR thresholds during CPT, with an average increase of 3.4 mA (p<0.001. Similarly, 96% of the trials resulted in higher electrical pain detection thresholds during CPT, with an average increase of 2.2 mA (p<0.001. Pain intensity ratings after suprathreshold electrical stimulation were reduced during CPT in 84% of the trials, displaying an average decrease of 1.5 points in a numeric rating scale (p<0.001. Under these experimental conditions, CPM reliability was acceptable for all assessment methods in terms of sample sizes for potential experiments. The presented results are encouraging with regards to the use of the CPM as an assessment tool in experimental and clinical pain. Trial registration: Clinical Trials.gov NCT01636440.

  3. Optimization Design and Performance Analysis of a PM Brushless Rotor Claw Pole Motor with FEM

    Directory of Open Access Journals (Sweden)

    Zhenyang Zhang

    2016-07-01

    Full Text Available A new type of permanent magnet (PM brushless claw pole motor (CPM with soft magnetic composite (SMC core is designed and analyzed in this paper. The PMs are mounted on the claw pole surface, and the three-phase stator windings are fed by variable-frequency three-phase AC currents. The advantages of the proposed CPM are that the slip rings on the rotor are cast off and it can achieve the efficiency improvement and higher power density. The effects of the claw-pole structure parameters, the air-gap length, and the PM thinner parameter of the proposed CPM on the output torque are investigated by using three-dimensional time-stepping finite element method (3D TS-FEM. The optimal rotor structure of the proposed CPM is obtained by using the response surface methodology (RSM and the particle swarm optimization (PSO method and the comparison of full-load performances of the proposed CPM with different material cores (SMC and silicon steel is analyzed.

  4. Conditioned pain modulation in patients with nonspecific chronic back pain with chronic local pain, chronic widespread pain, and fibromyalgia.

    Science.gov (United States)

    Gerhardt, Andreas; Eich, Wolfgang; Treede, Rolf-Detlef; Tesarz, Jonas

    2017-03-01

    Findings considering conditioned pain modulation (CPM) in chronic back pain (CBP) are contradictory. This might be because many patients with CBP report pain in further areas of the body, and altered CPM might influence spatial extent of pain rather than CBP per se. Therefore, we compared CPM in patients with CBP with different pain extent. Patients with fibromyalgia syndrome (FMS), for whom CPM impairment is reported most consistently, were measured for comparison. Based on clinical evaluation and pain drawings, patients were categorized into chronic local back pain (CLP; n = 53), chronic widespread back pain (CWP; n = 32), and FMS (n = 92). Conditioned pain modulation was measured by the difference in pressure pain threshold (test stimuli) at the lower back before and after tonic heat pain (conditioning stimulus). We also measured psychosocial variables. Pressure pain threshold was significantly increased in CLP patients after tonic heat pain (P pain modulation in CLP was significantly higher than that in CWP and FMS (P painful areas (0-10) were associated with lower CPM (r = 0.346, P = 0.001) in CBP but not in FMS (r = -0.013, P = 0.903). Anxiety and depression were more pronounced in FMS than in CLP or CWP (P values pain inhibition seem to be more indicated the higher the pain extent.

  5. Effect of the high-pitch mode in dual-source computed tomography on the accuracy of three-dimensional volumetry of solid pulmonary nodules: A phantom study

    International Nuclear Information System (INIS)

    Hwang, Sung Ho; Oh, Yu Whan; Ham, Soo Youn; Kang, Eun Young; Lee, Ki Yeol

    2015-01-01

    To evaluate the influence of high-pitch mode (HPM) in dual-source computed tomography (DSCT) on the accuracy of three-dimensional (3D) volumetry for solid pulmonary nodules. A lung phantom implanted with 45 solid pulmonary nodules (n = 15 for each of 4-mm, 6-mm, and 8-mm in diameter) was scanned twice, first in conventional pitch mode (CPM) and then in HPM using DSCT. The relative percentage volume errors (RPEs) of 3D volumetry were compared between the HPM and CPM. In addition, the intermode volume variability (IVV) of 3D volumetry was calculated. In the measurement of the 6-mm and 8-mm nodules, there was no significant difference in RPE (p > 0.05, respectively) between the CPM and HPM (IVVs of 1.2 +/- 0.9%, and 1.7 +/- 1.5%, respectively). In the measurement of the 4-mm nodules, the mean RPE in the HPM (35.1 +/- 7.4%) was significantly greater (p < 0.01) than that in the CPM (18.4 +/- 5.3%), with an IVV of 13.1 +/- 6.6%. However, the IVVs were in an acceptable range (< 25%), regardless of nodule size. The accuracy of 3D volumetry with HPM for solid pulmonary nodule is comparable to that with CPM. However, the use of HPM may adversely affect the accuracy of 3D volumetry for smaller (< 5 mm in diameter) nodule.

  6. Effect of the high-pitch mode in dual-source computed tomography on the accuracy of three-dimensional volumetry of solid pulmonary nodules: A phantom study

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Sung Ho; Oh, Yu Whan; Ham, Soo Youn [Dept. of Radiology, Korea University Anam Hospital, Seoul (Korea, Republic of); Kang, Eun Young [Dept. of Radiology, Korea University Guro Hospital, Seoul (Korea, Republic of); Lee, Ki Yeol [Dept. of Radiology, Korea University Ansan Hospital, Ansan (Korea, Republic of)

    2015-06-15

    To evaluate the influence of high-pitch mode (HPM) in dual-source computed tomography (DSCT) on the accuracy of three-dimensional (3D) volumetry for solid pulmonary nodules. A lung phantom implanted with 45 solid pulmonary nodules (n = 15 for each of 4-mm, 6-mm, and 8-mm in diameter) was scanned twice, first in conventional pitch mode (CPM) and then in HPM using DSCT. The relative percentage volume errors (RPEs) of 3D volumetry were compared between the HPM and CPM. In addition, the intermode volume variability (IVV) of 3D volumetry was calculated. In the measurement of the 6-mm and 8-mm nodules, there was no significant difference in RPE (p > 0.05, respectively) between the CPM and HPM (IVVs of 1.2 +/- 0.9%, and 1.7 +/- 1.5%, respectively). In the measurement of the 4-mm nodules, the mean RPE in the HPM (35.1 +/- 7.4%) was significantly greater (p < 0.01) than that in the CPM (18.4 +/- 5.3%), with an IVV of 13.1 +/- 6.6%. However, the IVVs were in an acceptable range (< 25%), regardless of nodule size. The accuracy of 3D volumetry with HPM for solid pulmonary nodule is comparable to that with CPM. However, the use of HPM may adversely affect the accuracy of 3D volumetry for smaller (< 5 mm in diameter) nodule.

  7. Infant brain tumors: incidence, survival, and the role of radiation based on Surveillance, Epidemiology, and End Results (SEER) Data.

    Science.gov (United States)

    Bishop, Andrew J; McDonald, Mark W; Chang, Andrew L; Esiashvili, Natia

    2012-01-01

    To evaluate the incidence of infant brain tumors and survival outcomes by disease and treatment variables. The Surveillance, Epidemiology, and End Results (SEER) Program November 2008 submission database provided age-adjusted incidence rates and individual case information for primary brain tumors diagnosed between 1973 and 2006 in infants less than 12 months of age. Between 1973 and 1986, the incidence of infant brain tumors increased from 16 to 40 cases per million (CPM), and from 1986 to 2006, the annual incidence rate averaged 35 CPM. Leading histologies by annual incidence in CPM were gliomas (13.8), medulloblastoma and primitive neuroectodermal tumors (6.6), and ependymomas (3.6). The annual incidence was higher in whites than in blacks (35.0 vs. 21.3 CPM). Infants with low-grade gliomas had the highest observed survival, and those with atypical teratoid rhabdoid tumors (ATRTs) or primary rhabdoid tumors of the brain had the lowest. Between 1979 and 1993, the annual rate of cases treated with radiation within the first 4 months from diagnosis declined from 20.5 CPM to incidence of infant brain tumors has been stable since 1986. Survival outcomes varied markedly by histology. For infants with medulloblastoma and ATRTs, improved survival was observed in patients treated with both surgery and early radiation compared with those treated with surgery alone. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. Quantitative analysis of Tl-201 myocardial perfusion image with special reference to circumferential profile method

    Energy Technology Data Exchange (ETDEWEB)

    Miyanaga, Hajime [Kyoto Prefectural Univ. of Medicine (Japan)

    1982-08-01

    A quantitative analysis of thallium-201 myocardial perfusion image (MPI) was attempted by using circumferential profile method (CPM) and the first purpose of this study is to assess the clinical utility of this method for the detection of myocardial ischemia. In patients with coronary artery disease, CPM analysis to exercise T1-MPI showed high sensitivity (9/12, 75%) and specificity (9/9, 100%), whereas exercise ECG showed high sensitivity (9/12, 75%), but relatively low specificity (7/9, 78%). In patients with myocardial infarction, CPM also showed high sensitivity (34/38, 89%) for the detection of myocardial necrosis, compared with visual interpretation (31/38, 81%) and with ECG (31/38, 81%). Defect score was correlated well with the number of abnormal Q waves. In exercise study, CPM was also sensitive to the change of perfusion defect in T1-MPI produced by exercise. So the results indicate that CPM is a good method not only quantitatively but also objectively to analyze T1-MPI. Although ECG is the most commonly used diagnostic tool for ischemic heart disease, several exercise induced ischemic changes in ECG have been still on discussion as criteria. So the second purpose of this study is to evaluate these ischemic ECG changes by exercise T1-MPI analized quantitatively. ST depression (ischemic 1 mm and junctional 2 mm or more), ST elevation (1 mm or more), and coronary T wave reversion in exercise ECG were though to be ischemic changes.

  9. COMPARISONS BETWEEN AND COMBINATIONS OF DIFFERENT APPROACHES TO ACCELERATE ENGINEERING PROJECTS

    Directory of Open Access Journals (Sweden)

    H. Steyn

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: In this article, traditional project management methods such as PERT and CPM, as well as fast-tracking and systems approaches, viz. concurrent engineering and critical chain, are reviewed with specific reference to their contribution to reducing the duration of the execution phase of engineering projects. Each of these techniques has some role to play in the acceleration of project execution. Combinations of approaches are evaluated by considering the potential of sets consisting of two different approaches each. While PERT and CPM approaches have been combined for many years in a technique called PERT/CPM, new combinations of approaches are discussed. Certain assumptions inherent to PERT and often wrong are not made by the critical chain approach.

    AFRIKAANSE OPSOMMING: In hierdie artikel word tradisionele projekbestuurbenaderings soos PERT en CPM asook projekversnelling en stelselbenaderings, naamlik gelyktydige ingenieurswese, en kritiekeketting-ondersoek met betrekking tot die bydrae wat elk tot die versnelling van die uitvoeringsfase van ingenieursprojekte kan lewer. Elk van hierdie benaderings kan ‘n spesifieke bydrae tot die versnelling van projekte lewer. Kombinasies, elk bestaande uit twee verskillende benaderings, word geëvalueer. Terwyl PERT en CPM reeds baie jare lank in kombinasie gebruik word, word nuwe kombinasies ook hier bespreek. Sekere aannames inherent aan die PERT-benadering is dikwels foutief. Hierdie aannames word nie deur die kritieke-ketting-benadering gemaak nie.

  10. A Study on the Fuel Assembly Seismic Analysis without Holddown Springs

    International Nuclear Information System (INIS)

    Kwon, O Cheol; Ha, Dong Geun; Lee, Kyou Seok; Jeon, Sang Yoon; Suh, Jung Min

    2013-01-01

    In this study, the effect for the fuel assembly removed holddown spring under seismic event has been evaluated through the comparison with the seismic analysis result of fuel assembly with holddown spring. In order to compare each design, the simplified fuel assembly seismic analysis models have been established according to reference. The mid grid impact force, natural frequency, and top nozzle displacement for each fuel assembly model has been analyzed using ANSYS. The fuel assembly seismic analyses without holddown springs are performed and compared to the model with holddown springs. The grid impact forces of CPM 1 and CPM 2 are almost doubled in comparison with CPM 3 and almost tripled in comparison with CPM 4 so the grid impact forces depend on CPM types. The grid impact forces of the fuel assembly model without holddown springs have similar tendencies in comparison with fuel assembly with holddown springs. Moreover, the model without holddown springs analysis time is much longer than the model with holddown springs. Consequently, it is moderate that the fuel assembly analysis model with holddown springs would be used for effective analysis even though the actual model has no holddown springs

  11. A Study on the Fuel Assembly Seismic Analysis without Holddown Springs

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, O Cheol; Ha, Dong Geun; Lee, Kyou Seok; Jeon, Sang Yoon; Suh, Jung Min [KEPCO Nuclear Fuel, Daejeon (Korea, Republic of)

    2013-10-15

    In this study, the effect for the fuel assembly removed holddown spring under seismic event has been evaluated through the comparison with the seismic analysis result of fuel assembly with holddown spring. In order to compare each design, the simplified fuel assembly seismic analysis models have been established according to reference. The mid grid impact force, natural frequency, and top nozzle displacement for each fuel assembly model has been analyzed using ANSYS. The fuel assembly seismic analyses without holddown springs are performed and compared to the model with holddown springs. The grid impact forces of CPM{sub 1} and CPM{sub 2} are almost doubled in comparison with CPM{sub 3} and almost tripled in comparison with CPM{sub 4} so the grid impact forces depend on CPM types. The grid impact forces of the fuel assembly model without holddown springs have similar tendencies in comparison with fuel assembly with holddown springs. Moreover, the model without holddown springs analysis time is much longer than the model with holddown springs. Consequently, it is moderate that the fuel assembly analysis model with holddown springs would be used for effective analysis even though the actual model has no holddown springs.

  12. Deterioration of abstract reasoning ability in mild cognitive impairment and Alzheimer's disease: correlation with regional grey matter volume loss revealed by diffeomorphic anatomical registration through exponentiated lie algebra analysis

    International Nuclear Information System (INIS)

    Yoshiura, Takashi; Hiwatashi, Akio; Yamashita, Koji; Takayama, Yukihisa; Kamano, Norihiro; Honda, Hiroshi; Ohyagi, Yasumasa; Kira, Jun-ichi; Monji, Akira; Kawashima, Toshiro

    2011-01-01

    To determine which brain regions are relevant to deterioration in abstract reasoning as measured by Raven's Colored Progressive Matrices (CPM) in the context of dementia. MR images of 37 consecutive patients including 19 with Alzheimer's disease (AD) and 18 with amnestic mild cognitive impairment (aMCI) were retrospectively analyzed. All patients were administered the CPM. Regional grey matter (GM) volume was evaluated according to the regimens of voxel-based morphometry, during which a non-linear registration algorithm called Diffeomorphic Anatomical Registration Through Exponentiated Lie algebra was employed. Multiple regression analyses were used to map the regions where GM volumes were correlated with CPM scores. The strongest correlation with CPM scores was seen in the left middle frontal gyrus while a region with the largest volume was identified in the left superior temporal gyrus. Significant correlations were seen in 14 additional regions in the bilateral cerebral hemispheres and right cerebellum. Deterioration of abstract reasoning ability in AD and aMCI measured by CPM is related to GM loss in multiple regions, which is in close agreement with the results of previous activation studies. (orig.)

  13. Physical activity in adolescents – Accelerometer data reduction criteria

    DEFF Research Database (Denmark)

    Toftager, Mette; Breum, Lars; Kristensen, Peter Lund

    and PA outcomes (mean cpm). The following parameters in the data reduction analyses were fixed: 30sec epoch, 24h duration, first registration accepted after 4h, maximum value 20,000cpm, and two activity epochs permitted in blocks of non-wear. Results: Accelerometer data were obtained from a total of 1...... 1 valid day of 6h wear time using a 10min non-wear criterion. The corresponding numbers using a 90min non-wear criterion were 20.6% and 99.4%. Lengthening the non-wear period decreases PA level (mean cpm) substantially, e.g. average PA was 641 cpm (5 days of 10h) using the 10min non-wear criterion...... compared to 570 cpm using 90min non-wear. No systematic differences in PA outcomes were found when comparing the range of days and hours. Discussion: We used a systematic approach to illustrate that even small inconsistencies in accelerometer data reduction can have substantial impact on compliance and PA...

  14. Chinese proprietary medicine in Singapore: regulatory control of toxic heavy metals and undeclared drugs.

    Science.gov (United States)

    Koh, H L; Woo, S O

    2000-11-01

    Traditional Chinese medicine (TCM) is gaining popularity as a form of complementary and alternative medicine. Reports of efficacy of TCM are increasing in numbers. TCM includes both crude Chinese medicinal materials (plants, animal parts and minerals) and Chinese proprietary medicine (CPM) [final dosage forms]. Despite the belief that CPM and herbal remedies are of natural origin, unlike Western medicine, and are hence safe and without many adverse effects, there have been numerous reports of adverse effects associated with herbal remedies. Factors affecting the safety of herbal medicines include intrinsic toxicity, adulteration, substitution, contamination, misidentification, lack of standardisation, incorrect preparation and/or dosage and inappropriate labelling and/or advertising. Hence, new regulations on the control of CPM were enforced in Singapore with effect from 1 September 1999. These include licensing and labelling requirements, as well as control of microbial contamination. This article also reviews reports of excessive toxic heavy metals and undeclared drugs in CPM in Singapore between 1990 and 1997. The names, uses, toxic heavy metal or drug detected and the year of detection are tabulated. Information on the brand or manufacturer's name are provided whenever available. The public and healthcare professionals should be better informed of the basic concept of TCM and its usefulness, as well as the potential adverse effects associated with its use. Greater control over the safety and quality of CPM could be achieved through good manufacturing practice, regulatory control, research, education, reporting usage of Chinese medicine (as in drug history) as well as reporting of adverse events.

  15. Axonal degeneration in association with carpal tunnel syndrome Degeneração axonal na síndrome do túnel do carpo

    Directory of Open Access Journals (Sweden)

    Marcelo Ribeiro Caetano

    2003-03-01

    Full Text Available Median nerve entrapment in the palm to wrist segment is known as carpal tunnel syndrome (CTS. Electromyography is the best evaluation test to confirm the disease, as it shows a median reduced conduction velocity and/or conduction block; however, the usual CTS electrodiagnostic tests do not separate segmental demyelination alone from segmental demyelination plus secondary axonal degeneration. We studied 100 hands from CTS patients (classified as mild, moderate, and severe, and 50 hands from normal subjects. The median palmar sensory nerve action potential (SNAP amplitude was measured and compared between the two groups. It would be expected that SNAP was normal if no axonal degeneration had occurred. The results showed that in mild CTS group and part of moderate CTS group SNAP amplitude was normal, whereas in severe CTS group, and part of moderate group SNAP amplitude was reduced, proving that axonal degeneration was involved. As it is well stated that axonal lesions have worse prognosis than segmental demyelinating ones, this simple test may help to preditic the CTS outcome and treatment.A compressão do nervo mediano no segmento punho-palma produz uma entidade clínica conhecida como síndrome do túnel do carpo (STC. A eletroneuromiografia é o exame de escolha para o diagnóstico da STC, através da identificação de diminuição de velocidade e/ou bloqueio de condução quando estudamos a neurocondução do nervo mediano, no trecho do punho. Entretanto, as técnicas comumente usadas não conseguem separar a lesão em mielínica focal com ou sem degeneração axonal secundária. Avaliamos 100 mãos de pacientes com STC e comparamos com 50 mãos de um grupo controle. Medimos a amplitude do potencial de ação do nervo sensitivo do mediano, com estímulo na palma e captação no dedo, e comparamos entre os grupos controle e de pacientes (o grupo de STC foi subdividido em leve, moderado e grave. Era esperado que a amplitude do potencial

  16. Adsorption of lambda-cyhalothrin and cypermethrin on two typical Chinese soils as affected by copper.

    Science.gov (United States)

    Liu, Jun; Lü, Xiaomeng; Xie, Jimin; Chu, Yafei; Sun, Cheng; Wang, Qian

    2009-06-01

    Pesticides and heavy metals pollution in soil environment has become a serious problem in many countries including China. Repeated applications of bordeaux mixture (a blend of copper sulfate and calcium hydroxide) and pyrethroid (Pys) insecticides have led to elevated copper (Cu) and Pys concentrations in vineyard surface soils. However, few studies focused on the interaction of Pys and heavy metals in the soil environment. Our previous studies had indicated the combined effect of cypermethrin (CPM) and Cu on soil catalase activity. Also, we had suggested that the addition of Cu could catalyze photo-degradation of CPM and lambda-cyhalothrin (lambda-CHT) in aqueous solution and restrain their degradation in soil. To better understand the potential influence of Cu on the fate of Pys in the soil environment, the aim of the present work was to examine the effect of Cu on the adsorption of lambda-CHT and CPM on two typical Chinese soils with different soil characteristics, which was one of the key processes controlling the fate of Pys, and to provide more information about the potential ecological risk of chemicals on the soil ecosystem. Fourier transform infrared and point charges analysis using the MOPAC program of the Gaussian system were also used to reveal the probable adsorption mechanism of lambda-CHT and CPM on soils. Two vineyard soils with different properties were chosen as experimental samples. They were sampled from 0 to 10 cm, dried, and sieved to 2 mm. Each soil was spiked with copper sulfate solution to obtain the following total soil Cu concentrations: 100, 200, 400, 800, and 1,600 mg.kg(-1). The treated soils were incubated for 2 weeks and then dried at 20 degrees C. For each soil sample and at each soil Cu concentration, the adsorption of lambda-CHT and CPM was measured using a batch equilibrium method. The concentration of lambda-CHT was determined by HPLC, and the amount of lambda-CHT and CPM adsorbed by the soil sample at equilibrium was determined

  17. Comparative numerical and experimental study of two combined wind and wave energy concepts

    Directory of Open Access Journals (Sweden)

    Zhen Gao

    2016-01-01

    Full Text Available With a successful and rapid development of offshore wind industry and increased research activities on wave energy conversion in recent years, there is an interest in investigating the technological and economic feasibility of combining offshore wind turbines (WTs with wave energy converters (WECs. In the EU FP7 MARINA Platform project, three floating combined concepts, namely the spar torus combination (STC, the semi-submersible flap combination (SFC and the oscillating water column (OWC array with a wind turbine, were selected and studied in detail by numerical and experimental methods. This paper summarizes the numerical modeling and analysis of the two concepts: STC and SFC, the model tests at a 1:50 scale under simultaneous wave and wind excitation, as well as the comparison between the numerical and experimental results. Both operational and survival wind and wave conditions were considered. The numerical analysis was based on a time-domain global model using potential flow theory for hydrodynamics and blade element momentum theory (for SFC or simplified thrust force model (for STC for aerodynamics. Different techniques for model testing of combined wind and wave concepts were discussed with focus on modeling of wind turbines by disk or redesigned small-scale rotor and modeling of power take-off (PTO system for wave energy conversion by pneumatic damper or hydraulic rotary damper. In order to reduce the uncertainty due to scaling, the numerical analysis was performed at model scale and both the numerical and experimental results were then up-scaled to full scale for comparison. The comparison shows that the current numerical model can well predict the responses (motions, PTO forces, power production of the combined concepts for most of the cases. However, the linear hydrodynamic model is not adequate for the STC concept in extreme wave conditions with the torus fixed to the spar at the mean water level for which the wave slamming on the

  18. El Tribunal Constitucional como “supremo intérprete” de la Ley de Aguas

    Directory of Open Access Journals (Sweden)

    Francisco Balaguer Callejón

    2011-10-01

    Full Text Available In the STC 30/2011 nothing is as it should be, if viewed from a legal standpoint.The control of constitutionality over the Statute of Autonomy becomesa matter of plain legal control, twisting the line followed to date by theConstitutional Court to demarcate powers between State and autonomouscommunities. It also blurs the borders between material and formal controlof constitutionality. Material control is not justified by itself but by formalcontrol, which in turn refers ultimately to material control in a circular andtautologous argument lacking all real content. All this revolves around itsalleged connection with the Court’s earlier doctrine, especially with the STC227/1988, which becomes absolutely twisted both methodologically and substantively.The distortion results in a legal reasoning which, for all the continuousappeals of STC 227/1988 to the Statutes of Autonomy as referencestandards for constitutional interpretation as regards the demarcation ofpowers, is based solely on State water law and which, compared to constitutionallyacceptable range of criteria as in STC 227/1988, hinges only uponthat of watershed as established by State water law. The result is that theconstitutional status of the Autonomy Statute is downplayed, even furtherdown than the status of plain law, as derived from STC 31/2010, given thatit is subjected to the determinations of the “State water lawmaker” andgiven that the Constitutional Court is downplayed as well as “supreme interpreter”of Water Law, all this to settle a constitutional issue which, whicheverthe court decision may have been, should have been taken on parametersdifferent from the ones it was built on. The Court should haveconducted its own opinion on the constitutionality of art. 51 of the Statueof Autonomy according to the material criteria in Water Law -not becausethey were contained therein but because they were constitutionally permissible-and any others drawn from the Constitution and

  19. Cost-utility analysis of a one-time supervisor telephone contact at 6-weeks post-partum to prevent extended sick leave following maternity leave in The Netherlands: results of an economic evaluation alongside a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    van Poppel Mireille NM

    2011-01-01

    Full Text Available Abstract Background Working women of childbearing age are a vital part of the population. Following childbirth, this group of women can experience a myriad of physical and mental health problems that can interfere with their ability to work. Currently, there is little known about cost-effective post-partum interventions to prevent work disability. The purpose of the study was to evaluate whether supervisor telephone contact (STC during maternity leave is cost-effective from a societal perspective in reducing sick leave and improving quality-adjusted life years (QALYs compared to common practice (CP. Methods We conducted an economic evaluation alongside a randomized controlled trial. QALYs were measured by the EuroQol 5-D, and sick leave and presenteeism by the Health and work Performance Questionnaire. Resource use was collected by questionnaires. Data were analysed according to intention-to-treat. Missing data were imputed via multiple imputation. Uncertainty was estimated by 95% confidence intervals, cost-utility planes and curves, and sensitivity analyses. Results 541 working women from 15 companies participated. Response rates were above 85% at each measurement moment. At the end of the follow-up, no statistically significant between-group differences in QALYs, mean hours of sick leave or presenteeism or costs were observed. STC was found to be less effective and more costly. For willingness-to-pay levels from €0 through €50,000, the probability that STC was cost-effective compared to CP was 0.2. Overall resource use was low. Mean total costs were €3678 (95% CI: 3386; 3951. Productivity loss costs represented 37% of the total costs and of these costs, 48% was attributable to sick leave and 52% to work presenteeism. The cost analysis from a company's perspective indicated that there was a net cost associated with the STC intervention. Conclusions STC was not cost-effective compared to common practice for a healthy population of working

  20. Characterization of the early proliferative response of the rodent bladder to subtotal cystectomy: a unique model of mammalian organ regeneration.

    Directory of Open Access Journals (Sweden)

    Charles C Peyton

    Full Text Available Subtotal cystectomy (STC; surgical removal of ∼75% of the rat urinary bladder elicits a robust proliferative response resulting in complete structural and functional bladder regeneration within 8-weeks. The goal of these studies was to characterize the early cellular response that mediates this regenerative phenomenon, which is unique among mammalian organ systems. STC was performed on eighteen 12-week-old female Fischer F344 rats. At 1, 3, 5 and 7-days post-STC, the bladder was harvested 2-hours after intraperitoneal injection of bromodeoxyuridine (BrdU. Fluorescent BrdU labeling was quantified in cells within the urothelium, lamina propria (LP, muscularis propria (MP and serosa. Cell location was confirmed with fluorescently co-labeled cytokeratin, vimentin or smooth muscle actin (SMA, to identify urothelial, interstitial and smooth muscle cells, respectively. Expression of sonic hedgehog (Shh, Gli-1 and bone morphogenic factor-4 (BMP-4 were evaluated with immunochemistry. Three non-operated rats injected with BrdU served as controls. Less than 1% of cells in the bladder wall were labeled with BrdU in control bladders, but this percentage significantly increased by 5-8-fold at all time points post-STC. The spatiotemporal characteristics of the proliferative response were defined by a significantly higher percentage of BrdU-labeled cells within the urothelium at 1-day than in the MP and LP. A time-dependent shift at 3 and 5-days post-STC revealed significantly fewer BrdU-labeled cells in the MP than LP or urothelium. By 7-days the percentage of BrdU-labeled cells was similar among urothelium, LP and MP. STC also caused an increase in immunostaining for Shh, Gli-1 and BMP-4. In summary, the early stages of functional bladder regeneration are characterized by time-dependent changes in the location of the proliferating cell population, and expression of several evolutionarily conserved developmental signaling proteins. This report extends