International Nuclear Information System (INIS)
Sashidhar, R.B.; Selvi, S. Kalaignana; Vinod, V.T.P.; Kosuri, Tanuja; Raju, D.; Karuna, R.
2015-01-01
An ecofriendly green chemistry method using a natural biopolymer, Gum Kondagogu (GK) for the removal of U (VI) from aqueous, simulated nuclear effluents was studied. The adsorption characteristic of GK towards U (VI) from aqueous solution was studied at varied pH, contact time, adsorbent dose, initial U (VI) concentration and temperature using UV–Visible spectroscopy and ICP-MS. Maximum adsorption was seen at pH 4, 0.1% GK with 60 min contact time at room temperature. The GK- U (VI) composite was characterized by FT-IR, zeta potential, TEM and SEM-EDAX. The Langmuir isotherm was found to be 487 mg of U (VI) g −1 of GK. The adsorption capacity and (%) of U (VI) was found to be 490 ± 5.4 mg g −1 and 98.5%. Moreover adsorption of U (VI) by GK was not influenced by other cations present in the simulated effluents. The adsorbed U (VI) was efficiently stripped from composite using 1 M HCl. - Highlights: • An eco-friendly method for removal of U (VI) from simulated nuclear effluents by Gum Kondagogu. • The Langmuir and Freundlich isotherm indicated favourable adsorption. • The adsorption (%) of U (VI) by GK was found to be 98.5%. • Desorption studies on biosorbed metal ions showed that HCl was a good eluent
Sashidhar, R B; Selvi, S Kalaignana; Vinod, V T P; Kosuri, Tanuja; Raju, D; Karuna, R
2015-10-01
An ecofriendly green chemistry method using a natural biopolymer, Gum Kondagogu (GK) for the removal of U (VI) from aqueous, simulated nuclear effluents was studied. The adsorption characteristic of GK towards U (VI) from aqueous solution was studied at varied pH, contact time, adsorbent dose, initial U (VI) concentration and temperature using UV-Visible spectroscopy and ICP-MS. Maximum adsorption was seen at pH 4, 0.1% GK with 60 min contact time at room temperature. The GK- U (VI) composite was characterized by FT-IR, zeta potential, TEM and SEM-EDAX. The Langmuir isotherm was found to be 487 mg of U (VI) g(-1) of GK. The adsorption capacity and (%) of U (VI) was found to be 490 ± 5.4 mg g(-1) and 98.5%. Moreover adsorption of U (VI) by GK was not influenced by other cations present in the simulated effluents. The adsorbed U (VI) was efficiently stripped from composite using 1 M HCl. Copyright © 2015 Elsevier Ltd. All rights reserved.
Aqueous ethanolic extract of Cochlospermum planchonii rhizome ...
African Journals Online (AJOL)
DR. ABU
2012-07-03
Jul 3, 2012 ... This study was designed to investigate the effects of aqueous ethanolic ... Key words: Cochlospermum planchonii, sperm characteristics, reproduction, Wistar rats. ... extract was stored in air-tight container at 4°C until needed.
Cochlospermum religiosum (L.) Alston Syn. C. gossypium DC ...
Indian Academy of Sciences (India)
fibrous, deeply furrowed bark containing gum and lobed leaves. Flowers (in the foreground) which appear after leaffall are large, golden yellow in terminal branched inflorescences. Fruit is large, and pear-shaped. Seeds are numerous and are covered with woolly hairs. Dried leaves and flowers are used as stimulant.
Kumar, Sathish Sundar Dhilip; Mahesh, Ayyavu; Antoniraj, M Gover; Rathore, Hanumant Singh; Houreld, N N; Kandasamy, Ruckmani
2018-04-01
In this study, the green synthesis of gum kondagogu capped gold nanoparticles (GK-GNPs) was prepared using a naturally available polysaccharide. The anionic gum capped GK-GNPs enabled the successful coupling of folic acid (FA) and fluorescein isothiocyanate (FITC) to produce a fluorescently labelled GNP (F2-GNP). F2-GNPs were further characterized using different physicochemical methods Cellular viability, cellular imaging, and targeted delivery of F2-GNPs were further evaluated in both folate receptor positive (MCF-7) and folate receptor negative (A549) cancer cells. Physicochemical characterization revealed a nanoparticle with a small size (37 nm), smooth surface (surface charge of -23.7 mV), crystallinity of gold nanoparticles and existence of gum kondagogu in the F2-GNPs. Cellular uptake of F2-GNPs indicated a greater affinity towards folate receptor positive cells. This study shows that the F2-GNPs is as an effective nanocarrier for targeted drug delivery and cellular imaging via folate receptors. Copyright © 2017. Published by Elsevier B.V.
Physicochemical and functional parameters of Cochlospermum vitifolium (bototo gum exudate
Directory of Open Access Journals (Sweden)
Maritza Coromoto Martínez
2016-12-01
Full Text Available The physicochemical parameters of Cochlospermum vitifolium they were evaluated and were linked to certain functional properties of industrial interest. The physicochemical parameters were determined by the classic methodology used for carbohydrates and the functional properties, as reported in the literature. The results obtained showed that the gum object of this study is low soluble in water, which corresponds with relatively high values of swelling indexes and water absorption capacity. Also, the intrinsic viscosity of the C. vitifolium exudate was related to a high molar mass, in the order of 106. Its emulsifying capacity is high, which is attributed to hydrophobic groups present in its structure. The gum gels at a minimum concentration, similar to that of the gum karaya (4.5%, but the gel that forms agglomerates, it is not uniform. The C. vitifolium gum exhibits important physicochemical and functional parameters which could serve as a criterion for testing its use in various industries.
Phenolic derivatives and other chemical compounds from Cochlospermum regium
International Nuclear Information System (INIS)
Solon, Soraya; Carollo, Carlos Alexandre; Brandao, Luiz Fabricio Gardini; Macedo, Cristiana dos Santos de; Klein, Andre; Dias-Junior, Carlos Alan; Siqueira, Joao Maximo de
2012-01-01
This study describes the chemical investigation of the ethyl acetate fraction obtained from the hydroethanolic extract of the xylopodium of Cochlospermum regium (Mart. and Schr.) Pilger, which has been associated with antimicrobial activity. Phytochemical investigation produced seven phenol derivatives: ellagic acid, gallic acid, dihydrokaempferol, dihydrokaempferol-3-ο-β-glucopyranoside, dihydrokaempferol-3-ο-β-(6''-galloyl)-glucopyranoside, pinoresinol, and excelsin. It also contained two triacylbenzenes, known as cochlospermines A and B. The hydroethanolic extract and its fractions exhibited antimicrobial activity (0.1 mg/mL) against Staphylococcus aureus and Pseudomonas aeruginosa. Gallic acid showed activity against S. aureus. Dihydrokaempferol-3-ο-β-(6 - galloyl)-glucopyranoside is reported here for the first time in the literature (author)
Maternal exposure to Cochlospermum regium: a toxicological evaluation
Directory of Open Access Journals (Sweden)
Andréa Luiza Cunha-Laura
2013-02-01
Full Text Available Cochlospermum regium (Schrank Pilg., Bixaceae, is a Brazilian plant widely used as a folk medicine in the southwestern of the Brazil to treat inflammation and infection diseases. However, the effects of C. regium hydroethanolic extract on pregnant rats have not been assessed. To evaluate the effects of the C. regium on pregnant rats during the organogenic period, the hydroethanolic extract was administered via gavage at a dose of 11.5 mg/kg/day to rats from 6th to 15th day of pregnancy. No clinical signs of maternal toxicity were observed. The placenta's and fetuses' weight were similar in control and treated animals. The term fetuses dis not present malformations or anomalies although the number of live fetuses and birth rate were significantly decreased. In conclusion, the C. regium hydroethanolic extract is nontoxicant to the pregnant rat although it would be likely to interfere in the progress of the embryofetal development.
(Gossypium barbadense) germplasm resources
Indian Academy of Sciences (India)
Navya
2017-03-28
Mar 28, 2017 ... Running title: Marker-trait associations in sea-island cotton ... In this study, Gossypium barbadense germplasm accessions with ... origins (n = 123) were used to perform association analysis of fiber traits with 120 polymorphic simple ... Because fiber yield and quality traits are complex quantitative traits, ...
Directory of Open Access Journals (Sweden)
Nunes Wanderlene Blanco
2003-01-01
Full Text Available During the last few decades the search for medical treatments based on alternative medicine has increased significantly, making knowledge of the plants commonly used as folk medicines extremely important. The plant Cochlospermum regium, a member of the Cochlospermaceae found in the Brazilian cerrado (a type of savanna, is known to have high depurative activity and to be effective not only in treating skin problems such as pimples, boils and blotches but also in curing gastritis and ulcers. We prepared aqueous extracts using 13, 19 and 25 gL-1 of dried C. regium root and investigated these extracts for possible mutagenic effects on Drosophila melanogaster germ cells. Mutagenesis was assessed using the ring-X loss (RXL test which can detect chromosome mosaicism, partial loss of the ring X chromosome and chromosome non-disjunction. Our results showed that at the concentrations tested C. regium extracts did not induce ring-X loss in D. melanogaster.
Inácio, Marielle Cascaes; Paz, Tiago Antunes; Bertoni, Bianca Waléria; Vieira, Maria Aparecida Ribeiro; Marques, Márcia Ortiz Mayo; Pereira, Ana Maria Soares
2014-01-01
Essential oil from Cochlospermum regium (Schrank) Pilg. leaves (CR-EO) has been extracted by hydrodistillation; we analysed the CR-EO by gas chromatography coupled with mass spectrometry. We also conducted histochemical analysis on cross-sections of the central vein of young and adult leaves. A total of 32 compounds were qualitatively and quantitatively analysed, which represented 94.87% of the total CR-EO oil content. The CR-EO basically consisted of sesquiterpenes (96.87%); its main component was β-copaen-4-α-ol (18.73%), followed by viridiflorol (12.67%). The histochemical analyses identified the main classes of compounds present in both young and adult leaves.
Volatile and non-volatile chemical constituents of Cochlospermum vitifolium (Willdenow) Sprengel
International Nuclear Information System (INIS)
Almeida, Sheyla Cristiane Xenofonte de; Lemos, Telma Leda Gomes de; Silveira, Edilberto Rocha; Pessoa, Otilia Deusdenia Loiola
2005-01-01
The essential oils from leaves, root bark and root wood of Cochlospermum vitifolium were investigated for the first time. The oils were obtained by hydrodistillation and analyzed by GC/MS. The main volatile constituents were β-caryophyllene (8.2 - 46.5%), β-bisabolene (11.5 - 29.3%), γ-muurolene (28.4%), α-humulene (26.0%), 1-hydroxy-3-hexadecanone (16.2 - 19.5%) and β-pinene (10.6%). Phytochemical analysis of the root bark and root wood extracts yielded excelsin, pinoresinol, narigenin, aromadendrin, galic acid and a triacylbenzene, along with β-sitosterol and stigmasterol and their D-glucosides. The structures of all compounds were determined by analyses of the spectroscopic data (NMR and MS), and comparison with the literature. (author)
Directory of Open Access Journals (Sweden)
Danny Ellen Meireles Leme
2017-01-01
Full Text Available The roots of Cochlospermum regium, popularly known as “algodãozinho-do-cerrado,” are used for the treatment of genitourinary infections. However, the removal of their subterranean structures results in the death of the plant, and the use of the leaves becomes a viable alternative. Therefore, the antimicrobial activity of Cochlospermum regium leaf’s ethanolic extract and its action on the biofilm formation of microorganisms associated with urinary infection were evaluated. The total phenolic compounds, flavoids, and tannins were quantified using the reagents Folin-Ciocalteu, aluminum chloride, and vanillin, respectively. The antimicrobial activity was evaluated by the broth microdilution method and the effect of the extract in the biofilm treatment was measured by the drop plate method. Cytotoxicity was evaluated by the method based on the reduction of MTS and the mutagenicity by the Ames test. The ethanolic extract of C. regium leaves presented 87.4 mg/EQ of flavonoids, 167.2 mg/EAG of total phenolic compounds, and 21.7 mg/ECA of condensed tannins. It presented reduction of the biofilm formation for E. coli and C. tropicalis and antimicrobial action of 1 mg/mL and 0.5 mg/mL, respectively. The extract showed no cytotoxicity and mutagenicity at the concentrations tested. This study demonstrated that C. regium leaves are a viable option for the treatment of genitourinary infections and for the species preservation.
Selection of Gossypium hirsutum genotypes for interspecific ...
African Journals Online (AJOL)
FORRESTER
ARS), Crop Genetics Research Unit in. Stoneville, Mississippi ... Key words: Cotton, germplasm, immature embryo, tissue culture, wide-hybridization. INTRODUCTION. Tetraploid upland cotton, Gossypium hirsutum L., is comprised of over 90% ...
(Gossypium hirsutum L.) CONTRE LA FUSARIOSE EFFECT ...
African Journals Online (AJOL)
EFFECT OFOLIGOSACCHARIDE FRACTION OF Fusarium oxysporum f. sp. vasinfectum ON COTTON PROTECTION (Gossypium hirsutum L.) AGAINST FUSARIUM WILT. R. A. N'GORAN épse BLA1,2, H. T. KOUAKOU2, F. K. Y. KONAN2, B. CAMARA1,. N. K. KOUASSI3 et D. KONE1. 1Laboratoire de Physiologie Végétale, ...
Directory of Open Access Journals (Sweden)
J. Camillo
2009-01-01
Full Text Available Cochlospermum regium é uma planta de áreas de cerrado, caatinga e pantanal. Na medicina popular é conhecida por "algodão-do-campo" e suas raízes são utilizadas para o tratamento de infecções uterinas, intestinais, gastrite, úlceras e artrite. Atualmente, o extrativismo e a destruição dos habitats naturais colocaram o algodão-do-campo na lista de espécies medicinais nativas prioritárias para conservação ex situ. O objetivo deste trabalho foi desenvolver uma metodologia para a conservação in vitro do algodão-do-campo e fornecer subsídios para estudos de micropropagação da espécie. Sementes de algodão-do-campo foram testadas quanto à germinação in vitro pela escarificação ou não das sementes em ácido sulfúrico e inoculação em meio de cultura MS. Para a conservação in vitro, segmentos nodais retirados das plântulas germinadas in vitro foram avaliados por 90 dias sob três regimes de temperatura (10, 20, e 25ºC e em três concentrações de meio WPM (½, ¾ e pleno. Verificou-se que sementes escarificadas apresentaram percentual de germinação in vitro de 93,3% aos 30 dias, valor significativamente superior aos 13,3% observados nas sementes não escarificadas. A conservação da espécie in vitro mostrou-se viável, desde que as culturas sejam mantidas em câmara de crescimento a 20ºC em meio de cultivo ½WPM. Sob estas condições os explantes mantiveram um crescimento mínimo e percentual de sobrevivência de 100%, após três meses de avaliação.Cochlospermum regium is a plant from cerrado, caatinga and pantanal areas. In popular medicine, it is known as "algodão-do-campo" and its roots are used to treat uterine and intestinal infections, gastritis, ulcers and arthritis. Nowadays, extraction activities and the destruction of natural habitats has made "algodão-do-campo" one of the major native medicinal species for ex situ conservation. The aim of this work was to develop a methodology for the in vitro
Sasikala, A.; Linga Rao, M.; Savithramma, N.; Prasad, T. N. V. K. V.
2015-10-01
The use of different parts of plants for the synthesis of nanoparticles is considered as a green technology as it does not involve any harmful chemicals. Herein, we report on rapid biosynthesis of silver nanoparticles (SNPs) from aqueous stem bark extract of Cochlospermum religiosum a medicinal plant. The reduced silver nanoparticles were characterized by using UV-Visible spectroscopy (UV-Vis), X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray analysis, atomic force microscopy, and Fourier transform infrared (FT-IR). The UV-Visible spectrum of the aqueous medium containing silver nanoparticles showed an absorption peak at around 445 nm, XRD showed that the particles are crystalline in nature, with a face-centered cubic structure and the SEM images showed that the spherical-shaped silver nanoparticles were observed and the size range was found to be 20-35 nm. FT-IR spectroscopy analysis revealed that carbohydrate, polyphenols, and protein molecules were involved in the synthesis and capping of silver nanoparticles. These phytosynthesized SNPs were tested for their antimicrobial activity and it analyzed by measuring the inhibitory zone. Cochlospermum religiosum aqueous stem bark extract of SNPs showed highest toxicity to Staphylococcus followed by Pseudomonas, Escherichia coli and Bacillus and lowest toxicity towards Proteus. Whereas in fungal species highest inhibition zone against Aspergillus flavus followed by Rhizopus, Fusarium, and Curvularia, and minimum inhibition zone was observed against Aspergillus niger species. The outcome of this study could be useful for the development of value added products from indigenous medicinal plants of India for nanotechnology-based biomedical applications.
Multiple shoot regeneration of cotton (Gossypium hirsutum L.) via ...
African Journals Online (AJOL)
user
2011-03-14
Mar 14, 2011 ... Induction of multiple shoots of cotton (Gossypium hirsutum L.) plant in two commercial varieties (Sahel and Varamin) using shoot apex was done. Explants were isolated from 3 - 4 days old seedlings, then they were cultured on a shoot induction media, modified MS nutrient agar with combinations: 1- ...
KUTUN : a morphogenetic model for cotton (Gossypium hirsitum L.)
Mutsaers, H.J.W.
1982-01-01
A whole crop model for growth and development of cotton ( Gossypium hirsutum L.) is presented. The model is based on previous extensive studies on plant morphogenesis, growth of fruits and canopy photosynthesis. The crop model basically is a carbohydrate budget, but all
Association mapping of resistance to Verticillium wilt in Gossypium ...
African Journals Online (AJOL)
Verticillium wilt is a major disease affecting the growth of cotton. For screening the resistant genes, 320 Gossypium hirsutum germplasms were evaluated in Verticillium nursery, and association mapping was used to detect the markers associated with the Verticillium wilt resistance. 106 microsatellite marker primer pairs ...
Ethyl ester purpurine-18 from Gossypium mustelinum (Malvaceae)
International Nuclear Information System (INIS)
Silva, Tania Maria Sarmento; Camara, Celso Amorim; Barbosa-Filho, Jose Maria; Giulietti, Ana Maria
2010-01-01
The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)
Nardeli, Sarah Muniz; Artico, Sinara; Aoyagi, Gustavo Mitsunori; de Moura, Stéfanie Menezes; da Franca Silva, Tatiane; Grossi-de-Sa, Maria Fatima; Romanel, Elisson; Alves-Ferreira, Marcio
2018-06-01
The MADS-box gene family encodes transcription factors that share a highly conserved domain known to bind to DNA. Members of this family control various processes of development in plants, from root formation to fruit ripening. In this work, a survey of diploid (Gossypium raimondii and Gossypium arboreum) and tetraploid (Gossypium hirsutum) cotton genomes found a total of 147, 133 and 207 MADS-box genes, respectively, distributed in the MIKC, Mα, Mβ, Mγ, and Mδ subclades. A comparative phylogenetic analysis among cotton species, Arabidopsis, poplar and grapevine MADS-box homologous genes allowed us to evaluate the evolution of each MADS-box lineage in cotton plants and identify sequences within well-established subfamilies. Chromosomal localization and phylogenetic analysis revealed that G. raimondii and G. arboreum showed a conserved evolution of the MIKC subclade and a distinct pattern of duplication events in the Mα, Mγ and Mδ subclades. Additionally, G. hirsutum showed a combination of its parental subgenomes followed by a distinct evolutionary history including gene gain and loss in each subclade. qPCR analysis revealed the expression patterns of putative homologs in the AP1, AP3, AGL6, SEP4, AGL15, AG, AGL17, TM8, SVP, SOC and TT16 subfamilies of G. hirsutum. The identification of putative cotton orthologs is discussed in the light of evolution and gene expression data from other plants. This analysis of the MADS-box genes in Gossypium species opens an avenue to understanding the origin and evolution of each gene subfamily within diploid and polyploid species and paves the way for functional studies in cotton species. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Silva, Tania Maria Sarmento; Camara, Celso Amorim, E-mail: taniasarmento@dq.ufrpe.b [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Quimica; Barbosa-Filho, Jose Maria [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Lab. de Tecnologia Farmaceutica; Giulietti, Ana Maria [Universidade Estadual de Feira de Santana, BA (Brazil). Dept. de Ciencias Biologicas
2010-07-01
The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)
Evolution and Stress Responses of Gossypium hirsutum SWEET Genes.
Li, Wei; Ren, Zhongying; Wang, Zhenyu; Sun, Kuan; Pei, Xiaoyu; Liu, Yangai; He, Kunlun; Zhang, Fei; Song, Chengxiang; Zhou, Xiaojian; Zhang, Wensheng; Ma, Xiongfeng; Yang, Daigang
2018-03-08
The SWEET (sugars will eventually be exported transporters) proteins are sugar efflux transporters containing the MtN3_saliva domain, which affects plant development as well as responses to biotic and abiotic stresses. These proteins have not been functionally characterized in the tetraploid cotton, Gossypium hirsutum , which is a widely cultivated cotton species. In this study, we comprehensively analyzed the cotton SWEET gene family. A total of 55 putative G. hirsutum SWEET genes were identified. The GhSWEET genes were classified into four clades based on a phylogenetic analysis and on the examination of gene structural features. Moreover, chromosomal localization and an analysis of homologous genes in Gossypium arboreum , Gossypium raimondii , and G. hirsutum suggested that a whole-genome duplication, several tandem duplications, and a polyploidy event contributed to the expansion of the cotton SWEET gene family, especially in Clade III and IV. Analyses of cis -acting regulatory elements in the promoter regions, expression profiles, and artificial selection revealed that the GhSWEET genes were likely involved in cotton developmental processes and responses to diverse stresses. These findings may clarify the evolution of G. hirsutum SWEET gene family and may provide a foundation for future functional studies of SWEET proteins regarding cotton development and responses to abiotic stresses.
The draft genome of a diploid cotton Gossypium raimondii
DEFF Research Database (Denmark)
Wang, Kunbo; Wang, Zhiwen; Li, Fuguang
2012-01-01
We have sequenced and assembled a draft genome of G. raimondii, whose progenitor is the putative contributor of the D subgenome to the economically important fiber-producing cotton species Gossypium hirsutum and Gossypium barbadense. Over 73% of the assembled sequences were anchored on 13 G. raim...
Genetic diversity and relationship analysis of Gossypium arboreum accessions.
Liu, F; Zhou, Z L; Wang, C Y; Wang, Y H; Cai, X Y; Wang, X X; Zhang, Z S; Wang, K B
2015-11-19
Simple sequence repeat techniques were used to identify the genetic diversity of 101 Gossypium arboreum accessions collected from India, Vietnam, and the southwest of China (Guizhou, Guangxi, and Yunnan provinces). Twenty-six pairs of SSR primers produced a total of 103 polymorphic loci with an average of 3.96 polymorphic loci per primer. The average of the effective number of alleles, Nei's gene diversity, and Shannon's information index were 0.59, 0.2835, and 0.4361, respectively. The diversity varied among different geographic regions. The result of principal component analysis was consistent with that of unweighted pair group method with arithmetic mean clustering analysis. The 101 G. arboreum accessions were clustered into 2 groups.
Genetic basis of some yield components in gossypium hirsutum l
International Nuclear Information System (INIS)
Javed, A.; Azhar, F.M.; Khan, I.A.; Rana, S.A.
2014-01-01
A 5 * 5 diallel analysis was conducted to study the inheritance of seed cotton yield, number of bolls and boll weight in Gossypium hirsutum L. using combining ability technique. The analysis of the data revealed that variance due to specific combining ability was significant for all the three traits signifying the importance of non additive gene action. The comparison of the parents showed that NF-801-2-37 was the best general combiner for seed cotton yield, number of bolls and boll weight followed by Acala-63-75. Best hybrid combinations identified were Acala-63-75 * NF-801-2-37 for seed cotton yield and DPL-61 * NF-801-2-37 for number of bolls and boll weight. Higher proportion of dominance variance in all three traits suggested delayed selection or use of heterosis breeding in crop improvement programs. (author)
Comparative transmission genetics of introgressed chromatin in Gossypium (cotton) polyploids.
Waghmare, Vijay N; Rong, Junkang; Rogers, Carl J; Bowers, John E; Chee, Peng W; Gannaway, John R; Katageri, Ishwarappa; Paterson, Andrew H
2016-04-01
Introgression is widely acknowledged as a potential source of valuable genetic variation, and growing effort is being invested in analysis of interspecific crosses conferring transgressive variation. Experimental backcross populations provide an opportunity to study transmission genetics following interspecific hybridization, identifying opportunities and constraints to introgressive crop improvement. The evolutionary consequences of introgression have been addressed at the theoretical level, however, issues related to levels and patterns of introgression among (plant) species remain inadequately explored, including such factors as polyploidization, subgenome interaction inhabiting a common nucleus, and the genomic distribution and linkage relationships of introgressant alleles. We analyze introgression into the polyploid Gossypium hirsutum (upland cotton) from its sister G. tomentosum and compare the level and pattern with that of G. barbadense representing a different clade tracing to the same polyploidization. Across the genome, recurrent backcrossing to Gossypium hirsutum yielded only one-third of the expected average frequency of the G. tomentosum allele, although one unusual region showed preferential introgression. Although a similar rate of introgression is found in the two subgenomes of polyploid (AtDt) G. hirsutum, a preponderance of multilocus interactions were largely within the Dt subgenome. Skewed G. tomentosum chromatin transmission is polymorphic among two elite G. hirsutum genotypes, which suggests that genetic background may profoundly affect introgression of particular chromosomal regions. Only limited correspondence is found between G. hirsutum chromosomal regions that are intolerant to introgression from the two species, G. barbadense and G. tomentosum, concentrated near possible inversion polymorphisms. Complex transmission of introgressed chromatin highlights the challenges to utilization of exotic germplasm in crop improvement. © 2016
Directory of Open Access Journals (Sweden)
Tania Maria Sarmento Silva
2010-01-01
Full Text Available The phaeophorbide ethyl ester named Purpurin-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm.
Use of 10,129 singleton SNPs of known genomic location in tetraploid cotton provided unique opportunities to characterize genome-wide diversity among 440 Gossypium hirsutum and 219 G. barbadense cultivars and landrace accessions of widespread origin. Using the SNPs distributed genome-wide, we exami...
Polyploidization altered gene functions in cotton (Gossypium spp.).
Xu, Zhanyou; Yu, John Z; Cho, Jaemin; Yu, Jing; Kohel, Russell J; Percy, Richard G
2010-12-16
Cotton (Gossypium spp.) is an important crop plant that is widely grown to produce both natural textile fibers and cottonseed oil. Cotton fibers, the economically more important product of the cotton plant, are seed trichomes derived from individual cells of the epidermal layer of the seed coat. It has been known for a long time that large numbers of genes determine the development of cotton fiber, and more recently it has been determined that these genes are distributed across At and Dt subgenomes of tetraploid AD cottons. In the present study, the organization and evolution of the fiber development genes were investigated through the construction of an integrated genetic and physical map of fiber development genes whose functions have been verified and confirmed. A total of 535 cotton fiber development genes, including 103 fiber transcription factors, 259 fiber development genes, and 173 SSR-contained fiber ESTs, were analyzed at the subgenome level. A total of 499 fiber related contigs were selected and assembled. Together these contigs covered about 151 Mb in physical length, or about 6.7% of the tetraploid cotton genome. Among the 499 contigs, 397 were anchored onto individual chromosomes. Results from our studies on the distribution patterns of the fiber development genes and transcription factors between the At and Dt subgenomes showed that more transcription factors were from Dt subgenome than At, whereas more fiber development genes were from At subgenome than Dt. Combining our mapping results with previous reports that more fiber QTLs were mapped in Dt subgenome than At subgenome, the results suggested a new functional hypothesis for tetraploid cotton. After the merging of the two diploid Gossypium genomes, the At subgenome has provided most of the genes for fiber development, because it continues to function similar to its fiber producing diploid A genome ancestor. On the other hand, the Dt subgenome, with its non-fiber producing D genome ancestor
Infraspecific DNA methylation polymorphism in cotton (Gossypium hirsutum L.).
Keyte, Anna L; Percifield, Ryan; Liu, Bao; Wendel, Jonathan F
2006-01-01
Cytosine methylation is important in the epigenetic regulation of gene expression and development in plants and has been implicated in silencing duplicate genes after polyploid formation in several plant groups. Relatively little information exists, however, on levels and patterns of methylation polymorphism (MP) at homologous loci within species. Here we explored the levels and patterns of methylation-polymorphism diversity at CCGG sites within allotetraploid cotton, Gossypium hirsutum, using a methylation-sensitive amplified fragment length polymorphism screen and a selected set of 20 G. hirsutum accessions for which we have information on genetic polymorphism levels and relationships. Methylation and MP exist at high levels within G. hirsutum: of 150 HpaII/MspI sites surveyed, 48 were methylated at the inner cytosine (32%) and 32 of these were polymorphic (67%). Both these values are higher than comparable measures of genetic diversity using restriction fragment length polymorphisms. The high percentage of methylation-polymorphic sites and potential relationship to gene expression underscore the potential significance of MP within and among populations. We speculate that biased correlation of methylation-polymorphic sites and genes in cotton may be a consequence of polyploidy and the attendant doubling of all genes.
Investigating the Antioxidant and Acetylcholinesterase Inhibition Activities of Gossypium herbaceam
Directory of Open Access Journals (Sweden)
Haji Akber Aisa
2013-01-01
Full Text Available Our previous research showed that standardized extract from the flowers of the Gossypium herbaceam labeled GHE had been used in clinical trials for its beneficial effects on brain functions, particularly in connection with age-related dementia and Alzheimer’s disease (AD. The aim of this work was to determine the components of this herb and the individual constituents of GHE. In order to better understand this herb for AD treatment, we investigated the acetylcholinesterase (AChE inhibition and antioxidant activity of GHE as well as the protective effects to PC12 cells against cytotoxicity induced by tertiary butyl hydroperoxide (tBHP using in vitro assays. The antioxidant activities were assessed by measuring their capabilities for scavenging 1,1-diphenyl-2-picylhydrazyl (DPPH and 2-2'-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid (ABTS free radical as well as in inhibiting lipid peroxidation. Our data showed that GHE exhibited certain activities against AChE and also is an efficient free radical scavenger, which may be helpful in preventing or alleviating patients suffering from AD.
Phosphorus use efficiency in pima cotton (Gossypium barbadense L. genotypes
Directory of Open Access Journals (Sweden)
Elcio Santos
2015-06-01
Full Text Available In the Brazilian Cerrado, P deficiency restricts cotton production, which requires large amounts of phosphate fertilizer. To improve the yield of cotton crops, genotypes with high P use efficiency must be identified and used. The present study evaluated P uptake and use efficiency of different Gossypium barbadense L. genotypes grown in the Cerrado. The experiment was carried out in a greenhouse with a completely randomized design, 15 x 2 factorial treatment structure (15 genotypes x 2 P levels, and four replicates. The genotypes were MT 69, MT 70, MT 87, MT 91, MT 92, MT 94, MT 101, MT 102, MT 103, MT 105, MT 106, MT 110, MT 112, MT 124, and MT 125; P levels were sufficient (1000 mg pot-1, PS treatment or deficient (PD treatment. Dry matter (DM and P levels were determined in cotton plant parts and used to calculate plant P content and use efficiency. In general, DM and P content were higher in the PS than in the PD treatment, with the exception of root DM and total DM in some genotypes. Genotypes also differed in terms of P uptake and use capacity. In the PS treatment, genotypes MT 92 and MT 102 had the highest response to phosphate fertilization. Genotype MT 69 exhibited the most efficient P uptake in the PD treatment. Genotype MT 124 showed the best shoot physiological efficiency, apparent recovery efficiency, and utilization efficiency, whereas MT 110 exhibited the highest root physiological efficiency.
Cloning and Functional Analysis of the Promoter of an Ascorbate Oxidase Gene from Gossypium hirsutum
Xin, Shan; Tao, Chengcheng; Li, Hongbin
2016-01-01
Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibite...
Isolation and characterization of terpene synthases in cotton (Gossypium hirsutum).
Yang, Chang-Qing; Wu, Xiu-Ming; Ruan, Ju-Xin; Hu, Wen-Li; Mao, Yin-Bo; Chen, Xiao-Ya; Wang, Ling-Jian
2013-12-01
Cotton plants accumulate gossypol and related sesquiterpene aldehydes, which function as phytoalexins against pathogens and feeding deterrents to herbivorous insects. However, to date little is known about the biosynthesis of volatile terpenes in this crop. Herein is reported that 5 monoterpenes and 11 sesquiterpenes from extracts of a glanded cotton cultivar, Gossypium hirsutum cv. CCRI12, were detected by gas chromatography-mass spectrometry (GC-MS). By EST data mining combined with Rapid Amplification of cDNA Ends (RACE), full-length cDNAs of three terpene synthases (TPSs), GhTPS1, GhTPS2 and GhTPS3 were isolated. By in vitro assays of the recombinant proteins, it was found that GhTPS1 and GhTPS2 are sesquiterpene synthases: the former converted farnesyl pyrophosphate (FPP) into β-caryophyllene and α-humulene in a ratio of 2:1, whereas the latter produced several sesquiterpenes with guaia-1(10),11-diene as the major product. By contrast, GhTPS3 is a monoterpene synthase, which produced α-pinene, β-pinene, β-phellandrene and trace amounts of other monoterpenes from geranyl pyrophosphate (GPP). The TPS activities were also supported by Virus Induced Gene Silencing (VIGS) in the cotton plant. GhTPS1 and GhTPS3 were highly expressed in the cotton plant overall, whereas GhTPS2 was expressed only in leaves. When stimulated by mechanical wounding, Verticillium dahliae (Vde) elicitor or methyl jasmonate (MeJA), production of terpenes and expression of the corresponding synthase genes were induced. These data demonstrate that the three genes account for the biosynthesis of volatile terpenes of cotton, at least of this Upland cotton. Copyright © 2013 Elsevier Ltd. All rights reserved.
Development of a core set of SSR markers for the characterization of Gossypium germplasm
Molecular markers such as simple sequence repeats (SSR) are a useful tool for characterizing genetic diversity of Gossypium germplasm collections. Genetic profiles by DNA fingerprinting of cotton accessions can only be compared among different collections if a common set of molecular markers are us...
Genotype and planting density effects on rooting traits and yield in cotton (Gossypium hirsutum L.)
Zhang, L.Z.; Li, B.G.; Yan, G.T.; Werf, van der W.; Spiertz, J.H.J.; Zhang, S.P.
2006-01-01
Root density distribution of plants is a major indicator of competition between plants and determines resource capture from the soil. This experiment was conducted in 2005 at Anyang, located in the Yellow River region, Henan Province, China. Three cotton (Gossypium hirsutum L.) cultivars were
Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres
Emergent phenotypes are common in polyploids relative to their diploid progenitors, a phenomenon exemplified by spinnable cotton fibers. Following 15-18 fold paleopolyploidy, allopolyploidy 1-2 million years ago reunited divergent Gossypium genomes, imparting new combinatorial complexity that might ...
Genetics of the ovule fuzzless trait in Gossypium arboreum germplasm line PI 615737
The diploid cotton species Gossypium arboreum possesses many favorable agronomic traits such as drought tolerance and disease resistance, which can be utilized in the development of improved upland cotton cultivars. The USDA National Plant Germplasm System maintains more than 1,600 G. arboreum acces...
Utilization of bio-waste cotton ( Gossypium hirsutum L.) stalks and ...
African Journals Online (AJOL)
... three-layer particleboard containing different cotton (Gossypium hirsutum L.) stalks and underutilized paulownia (paulownia fortunie) wood particle ratios (30, 50 and 70%) using urea formaldehyde resin. Addition of cotton stalk and paulownia wood in particleboard improved mechanical properties of resulting composites ...
Wang, Xiaoxiao; Wang, Yingying; Wang, Chen; Chen, Yu; Chen, Yu; Feng, Shouli; Zhao, Ting; Zhou, Baoliang
2016-10-07
Gossypium anomalum (BB genome) possesses the desirable characteristics of drought tolerance, resistance to diseases and insect pests, and the potential for high quality fibers. However, it is difficult to transfer the genes associated with these desirable traits into cultivated cotton (G. hirsutum, AADD genome). Monosomic alien addition lines (MAALs) can be used as a bridge to transfer desired genes from wild species into G. hirsutum. In cotton, however, the high number and smaller size of the chromosomes has resulted in difficulties in discriminating chromosomes from wild species in cultivated cotton background, the development of cotton MAALs has lagged far behind many other crops. To date, no set of G. hirsutum-G. anomalum MAALs was reported. Here the amphiploid (AADDBB genome) derived from G. hirsutum × G. anomalum was used to generate a set of G. hirsutum-G. anomalum MAALs through a combination of consecutive backcrossing, genomic in situ hybridization (GISH), morphological survey and microsatellite marker identification. We improved the GISH technique used in our previous research by using a mixture of two probes from G. anomalum and G. herbaceum (AA genome). The results indicate that a ratio of 4:3 (G. anomalum : G. herbaceum) is the most suitable for discrimination of chromosomes from G. anomalum and the At-subgenome of G. hirsutum. Using this improved GISH technique, 108 MAAL individuals were isolated. Next, 170 G. hirsutum- and G. anomalum-specific codominant markers were obtained and employed for characterization of these MAAL individuals. Finally, eleven out of 13 MAALs were identified. Unfortunately, we were unable to isolate Chrs. 1B a and 5B a due to their very low incidences in backcrossing generation, as these remained in a condition of multiple additions. The characterized lines can be employed as bridges for the transfer of desired genes from G. anomalum into G. hirsutum, as well as for gene assignment, isolation of chromosome
Zhang, Meiping; Rong, Ying; Lee, Mi-Kyung; Zhang, Yang; Stelly, David M; Zhang, Hong-Bin
2015-10-01
Cotton is the world's leading textile fiber crop and is also grown as a bioenergy and food crop. Knowledge of the phylogeny of closely related species and the genome origin and evolution of polyploid species is significant for advanced genomics research and breeding. We have reconstructed the phylogeny of the cotton genus, Gossypium L., and deciphered the genome origin and evolution of its five polyploid species by restriction fragment analysis of repeated sequences. Nuclear DNA of 84 accessions representing 35 species and all eight genomes of the genus were analyzed. The phylogenetic tree of the genus was reconstructed using the parsimony method on 1033 polymorphic repeated sequence restriction fragments. The genome origin of its polyploids was determined by calculating the diploid-polyploid restriction fragment correspondence (RFC). The tree is consistent with the morphological classification, genome designation and geographic distribution of the species at subgenus, section and subsection levels. Gossypium lobatum (D7) was unambiguously shown to have the highest RFC with the D-subgenomes of all five polyploids of the genus, while the common ancestor of Gossypium herbaceum (A1) and Gossypium arboreum (A2) likely contributed to the A-subgenomes of the polyploids. These results provide a comprehensive phylogenetic tree of the cotton genus and new insights into the genome origin and evolution of its polyploid species. The results also further demonstrate a simple, rapid and inexpensive method suitable for phylogenetic analysis of closely related species, especially congeneric species, and the inference of genome origin of polyploids that constitute over 70 % of flowering plants.
GhNAC18 , a novel cotton ( Gossypium hirsutum L.) NAC gene, is ...
African Journals Online (AJOL)
GhNAC18 is a novel NAC gene that was isolated from cotton (Gossypium hirsutum L.). The full-length cDNA was 1511 bp including an open reading frame of 1260 bp in length and encodes a protein of 419 amino acids. With qRT-PCR analysis, GhNAC18 was downregulated during natural and dark-induced senescence, ...
Directory of Open Access Journals (Sweden)
S. Sabiu
2017-12-01
Full Text Available Gossypium spp. belong to a class of botanicals with global therapeutic applications against a number of disorders including ulcers. This study evaluated the membrane stabilization and detoxification potential of aqueous leaf extract of Gossypium barbadense L. (Malvaceae in indomethacin-induced oxidative gastric ulceration in Wistar rats. The ulcerated rats were orally pretreated with the extract and esomeprazole for 4 weeks. Gastric function and antioxidative parameters were thereafter evaluated. The indomethacin-mediated significant elevations in the ulcer index, gastric volume, pepsin activity and mucosal level of malondialdehyde were dosedependently attenuated in the extract-treated animals. The extract also significantly modulated and improved the pH, mucin content, glutathione (reduced as well as gastric activities of superoxide dismutase and catalase in the ulcerated rats. These improvements may be ascribed to the antioxidant and membrane stabilization activities of the extract which are attributable to its active metabolites as revealed by the analytical chromatogram. The observed effects compared favorably with that of esomeprazole and are suggestive of the capability of the extract to prevent mucosal damage and preserve gastric functions as evidently supported by the macroscopical appearance of the stomachs and the % ulcer inhibitory values. Conclusively, the overall data from the present findings suggest that the aqueous leaf extract of G. barbadense could prevent indomethacin-mediated oxidative gastric ulceration via fortification of antioxidant defense mechanisms. Keywords: Esomeprazole, Gossypium barbadense, Indomethacin, Mucosal damage, Oxidative stress
Directory of Open Access Journals (Sweden)
Shan Xin
Full Text Available Apoplastic ascorbate oxidase (AO plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1 gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA. Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome, Gossypium raimondii (Gr, diploid cotton with a DD genome and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence
Xin, Shan; Tao, Chengcheng; Li, Hongbin
2016-01-01
Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element) was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA). Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element) might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome), Gossypium raimondii (Gr, diploid cotton with a DD genome) and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome) indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh) cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence with a
Directory of Open Access Journals (Sweden)
Joy Nyangasi Kirungu
2018-01-01
Full Text Available The challenge in tetraploid cotton cultivars is the narrow genetic base and therefore, the bottleneck is how to obtain interspecific hybrids and introduce the germplasm directly from wild cotton to elite cultivars. Construction of genetic maps has provided insight into understanding the genome structure, interrelationships between organisms in relation to evolution, and discovery of genes that carry important agronomic traits in plants. In this study, we generated an interspecific hybrid between two wild diploid cottons, Gossypium davidsonii and Gossypium klotzschianum, and genotyped 188 F2:3 populations in order to develop a genetic map. We screened 12,560 SWU Simple Sequence Repeat (SSR primers and obtained 1000 polymorphic markers which accounted for only 8%. A total of 928 polymorphic primers were successfully scored and only 728 were effectively linked across the 13 chromosomes, but with an asymmetrical distribution. The map length was 1480.23 cM, with an average length of 2.182 cM between adjacent markers. A high percentage of the markers on the map developed, and for the physical map of G. raimondii, exhibited highly significant collinearity, with two types of duplication. High level of segregation distortion was observed. A total of 27 key genes were identified with diverse roles in plant hormone signaling, development, and defense reactions. The achievement of developing the F2:3 population and its genetic map constructions may be a landmark in establishing a new tool for the genetic improvement of cultivars from wild plants in cotton. Our map had an increased recombination length compared to other maps developed from other D genome cotton species.
Chen, Yu; Wang, Yingying; Wang, Kai; Zhu, Xiefei; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang
2014-05-01
We report the first complete set of alien addition lines of G. hirsutum . The characterized lines can be used to introduce valuable traits from G. australe into cultivated cotton. Gossypium australe is a diploid wild cotton species (2n = 26, GG) native to Australia that possesses valuable characteristics unavailable in the cultivated cotton gene pool, such as delayed pigment gland morphogenesis in the seed and resistances to pests and diseases. However, it is very difficult to directly transfer favorable traits into cultivated cotton through conventional gene recombination due to the absence of pairing and crossover between chromosomes of G. australe and Gossypium hirsutum (2n = 52, AADD). To enhance the transfer of favorable genes from wild species into cultivated cotton, we developed a set of hirsutum-australe monosomic alien chromosome addition lines (MAAL) using a combination of morphological survey, microsatellite marker-assisted selection, and molecular cytogenetic analysis. The amphidiploid (2n = 78, AADDGG) of G. australe and G. hirsutum was consecutively backcrossed with upland cotton to develop alien addition lines of individual G. australe chromosomes in G. hirsutum. From these backcross progeny, we generated the first complete set of chromosome addition lines in cotton; 11 of 13 lines are monosomic additions, and chromosomes 7G(a) and 13G(a) are multiple additions. MAALs of 1G(a) and 11G(a) were the first to be isolated. The chromosome addition lines can be employed as bridges for the transfer of desired genes from G. australe into G. hirsutum, as well as for gene assignment, isolation of chromosome-specific probes, flow sorting and microdissection of chromosome, development of chromosome-specific ''paints'' for fluorochrome-labeled DNA fragments, physical mapping, and selective isolation and mapping of cDNAs for a particular G. australe chromosome.
He, Shou-Pu; Sun, Jun-Ling; Zhang, Chao; Du, Xiong-Ming
2011-01-01
The impact of alien DNA fragments on plant genome has been studied in many species. However, little is known about the introgression lines of Gossypium. To study the consequences of introgression in Gossypium, we investigated 2000 genomic and 800 epigenetic sites in three typical cotton introgression lines, as well as their cultivar (Gossypium hirsutum) and wild parents (Gossypium bickii), by amplified fragment length polymorphism (AFLP) and methylation-sensitive amplified polymorphism (MSAP). The results demonstrate that an average of 0.5% of exotic DNA segments from wild cotton is transmitted into the genome of each introgression line, with the addition of other forms of genetic variation. In total, an average of 0.7% of genetic variation sites is identified in introgression lines. Simultaneously, the overall cytosine methylation level in each introgression line is very close to that of the upland cotton parent (an average of 22.6%). Further dividing patterns reveal that both hypomethylation and hypermethylation occurred in introgression lines in comparison with the upland cotton parent. Sequencing of nine methylation polymorphism fragments showed that most (7 of 9) of the methylation alternations occurred in the noncoding sequences. The molecular evidence of introgression from wild cotton into introgression lines in our study is identified by AFLP. Moreover, the causes of petal variation in introgression lines are discussed.
While the boll weevil, Anthonomus grandis, has been identified as one of the most devastating pests in U.S. history, its origin and activity in Mexico, both on wild and cultivated cotton hosts (genus Gossypium), is poorly understood. Three forms (geographical or host-associated races) of A. grandis ...
Richard C. Cronn; Randall L. Small; Tamara Hanselkorn; Jonathan F. Wendel
2002-01-01
Previous molecular phylogenetic studies have failed to resolve the branching order among the major cotton (Gossypium) lineages, and it has been unclear whether this reflects actual history (rapid radiation) or sampling properties of the genes evaluated. In this paper, we reconsider the phylogenetic relationships of diploid cotton genome groups using DNA sequences from...
I. Alvarez; R. Cronn; J.F. Wendel
2005-01-01
American diploid cottons (Gossypium L., subgenus Houzingenia Fryxell) form a monophyletic group of 13 species distributed mainly in western Mexico, extending into Arizona, Baja California, and with one disjunct species each in the Galapagos Islands and Peru. Prior phylogenetic analyses based on an alcohol dehydrogenase gene (...
Sun, Gao-Fei; He, Shou-Pu; Du, Xiong-Ming
2013-10-01
Cotton genomic studies have boomed since the release of Gossypium raimondii draft genome. In this study, cis-regulatory element (CRE) in 1 kb length sequence upstream 5' UTR of annotated genes were selected and scanned in the Arabidopsis thaliana (At) and Gossypium raimondii (Gr) genomes, based on the database of PLACE (Plant cis-acting Regulatory DNA Elements). According to the definition of this study, 44 (12.3%) and 57 (15.5%) CREs presented "peak-like" distribution in the 1 kb selected sequences of both genomes, respectively. Thirty-four of them were peak-like distributed in both genomes, which could be further categorized into 4 types based on their core sequences. The coincidence of TATABOX peak position and their actual position ((-) -30 bp) indicated that the position of a common CRE was conservative in different genes, which suggested that the peak position of these CREs was their possible actual position of transcription factors. The position of a common CRE was also different between the two genomes due to stronger length variation of 5' UTR in Gr than At. Furthermore, most of the peak-like CREs were located in the region of -110 bp-0 bp, which suggested that concentrated distribution might be conductive to the interaction of transcription factors, and then regulate the gene expression in downstream.
Genome-wide investigation and transcriptome analysis of the WRKY gene family in Gossypium.
Ding, Mingquan; Chen, Jiadong; Jiang, Yurong; Lin, Lifeng; Cao, YueFen; Wang, Minhua; Zhang, Yuting; Rong, Junkang; Ye, Wuwei
2015-02-01
WRKY transcription factors play important roles in various stress responses in diverse plant species. In cotton, this family has not been well studied, especially in relation to fiber development. Here, the genomes and transcriptomes of Gossypium raimondii and Gossypium arboreum were investigated to identify fiber development related WRKY genes. This represents the first comprehensive comparative study of WRKY transcription factors in both diploid A and D cotton species. In total, 112 G. raimondii and 109 G. arboreum WRKY genes were identified. No significant gene structure or domain alterations were detected between the two species, but many SNPs distributed unequally in exon and intron regions. Physical mapping revealed that the WRKY genes in G. arboreum were not located in the corresponding chromosomes of G. raimondii, suggesting great chromosome rearrangement in the diploid cotton genomes. The cotton WRKY genes, especially subgroups I and II, have expanded through multiple whole genome duplications and tandem duplications compared with other plant species. Sequence comparison showed many functionally divergent sites between WRKY subgroups, while the genes within each group are under strong purifying selection. Transcriptome analysis suggested that many WRKY genes participate in specific fiber development processes such as fiber initiation, elongation and maturation with different expression patterns between species. Complex WRKY gene expression such as differential Dt and At allelic gene expression in G. hirsutum and alternative splicing events were also observed in both diploid and tetraploid cottons during fiber development process. In conclusion, this study provides important information on the evolution and function of WRKY gene family in cotton species.
Exp2 polymorphisms associated with variation for fiber quality properties in cotton (Gossypium spp.
Directory of Open Access Journals (Sweden)
Daohua He
2014-10-01
Full Text Available Plant expansins are a group of extracellular proteins thought to affect the quality of cotton fibers. Previous expression profile analysis revealed that six Expansin A genes are present in cotton, of which two (GhExp1 and GhExp2 produce transcripts that are specific to the developing cotton fiber. To identify the phenotypic function of Exp2, and to determine whether nucleotide variation among alleles of Exp2 affects fiber quality, candidate gene association mapping was conducted. Gene-specific primers were designed to amplify the Exp2 gene. By amplicon sequencing, the nucleotide diversity of Exp2 was investigated across 92 accessions (including 7 Gossypium arboreum, 74 Gossypium hirsutum, and 11 Gossypium barbadense accessions with different fiber qualities. Twenty-six SNPs and seven InDels including 14 from the coding region of Exp2 were detected, forming twelve distinct haplotypes in the cotton collection. Among the 14 SNPs in the coding region, five were missense mutations and nine were synonymous nucleotide changes. The average SNP/InDel per nucleotide ratio was 2.61% (one SNP per 39 bp, with 1.81 and 3.87% occurring in coding and non-coding regions, respectively. Nucleotide and haplotype diversity across the entire Exp2 region was 0.00603 (π and 0.844, respectively, and diversity in non-coding regions was higher than that in coding regions. For linkage disequilibrium (LD, the mean r2 value for all polymorphism loci pairs was 0.48, and LD did not decay over 748 bp. Based on 132 simple sequence repeat (SSR loci evenly covering 26 chromosomes, the population structure was estimated, and the accessions were divided into seven groups that agreed well with their genomic origin and evolutionary history. A general linear model was used to calculate the Exp2-wide diversity–trait associations of 5 fiber quality traits, considering population structure (Q. Four SNPs in Exp2 were associated with at least one of the fiber quality traits, but not with
Zhang, Tianzhen; Hu, Yan; Jiang, Wenkai; Fang, Lei; Guan, Xueying; Chen, Jiedan; Zhang, Jinbo; Saski, Christopher A; Scheffler, Brian E; Stelly, David M; Hulse-Kemp, Amanda M; Wan, Qun; Liu, Bingliang; Liu, Chunxiao; Wang, Sen; Pan, Mengqiao; Wang, Yangkun; Wang, Dawei; Ye, Wenxue; Chang, Lijing; Zhang, Wenpan; Song, Qingxin; Kirkbride, Ryan C; Chen, Xiaoya; Dennis, Elizabeth; Llewellyn, Danny J; Peterson, Daniel G; Thaxton, Peggy; Jones, Don C; Wang, Qiong; Xu, Xiaoyang; Zhang, Hua; Wu, Huaitong; Zhou, Lei; Mei, Gaofu; Chen, Shuqi; Tian, Yue; Xiang, Dan; Li, Xinghe; Ding, Jian; Zuo, Qiyang; Tao, Linna; Liu, Yunchao; Li, Ji; Lin, Yu; Hui, Yuanyuan; Cao, Zhisheng; Cai, Caiping; Zhu, Xiefei; Jiang, Zhi; Zhou, Baoliang; Guo, Wangzhen; Li, Ruiqiang; Chen, Z Jeffrey
2015-05-01
Upland cotton is a model for polyploid crop domestication and transgenic improvement. Here we sequenced the allotetraploid Gossypium hirsutum L. acc. TM-1 genome by integrating whole-genome shotgun reads, bacterial artificial chromosome (BAC)-end sequences and genotype-by-sequencing genetic maps. We assembled and annotated 32,032 A-subgenome genes and 34,402 D-subgenome genes. Structural rearrangements, gene loss, disrupted genes and sequence divergence were more common in the A subgenome than in the D subgenome, suggesting asymmetric evolution. However, no genome-wide expression dominance was found between the subgenomes. Genomic signatures of selection and domestication are associated with positively selected genes (PSGs) for fiber improvement in the A subgenome and for stress tolerance in the D subgenome. This draft genome sequence provides a resource for engineering superior cotton lines.
Cytomorphological studies in X-ray induced glandless haploids in Gossypium hirsutum L. (cotton)
Energy Technology Data Exchange (ETDEWEB)
Mehetre, S.S.; Thombre, M.V. (Mahatma Phule Krishi Vidyapeeth, Rahuri (India))
1981-08-01
Six haploid plants were obtained in M/sub 2/ generation of the 25 kr. X-ray irradiated Gossypium hirsutum L. cotton variety H.G. 108. The cytomorphological studies on these plants indicated highly irregular meiosis, giving on an average six bivalents, the range being 0-9. Unequal separation of chromosomes and chromatids at anaphase-1 and II respectively led to formation of abnormal tetrads and pollens with high size variations leading to high pollen sterility. These plants were characterized by miniature stature, shorter stem and internodes, smaller leaves, flowers and stomata with fewer chloroplasts, male and female sterility and halving of chromosomes. The reduction in morphological characters was nearly in the proportion of 1:2 as compared to their diploid counterparts. 31 refs.; 5 tables; 12 figures.
Carter, William W.
1981-01-01
Gossypium arboreum 'Nanking CB 1402' possessed a high level of resistance to Rotylenchulus reniformis. Within 16 h, the nematode penetrated roots of resistant and susceptible cottons equally. After 36 h, significantly fewer nematodes were found in resistant roots. Larvae fed in either an endodermal or pericyclic cell and had no specificity for root tissue of a particular age. In roots of resistant G. arboreum '1402,' wall breakdown of pericyclic cells was evident after 3 d, endodermal and cortical cells collapsed, and the hypertrophied pericyclic cells disintegrated within 12 d. Cell walls immediately adjacent to the nematode's head were thickened and more safranin positive in resistant than in susceptible cotton cultivars. Several other cultivars of G. arboreum were also resistant to R. reniformis, based on nematode fecundity and percent egg reduction. PMID:19300777
Effects of ionizing radiation on the hypocotyl-root axis of three species of gossypium
International Nuclear Information System (INIS)
Reed, J.P.
1977-01-01
The hypocotyl-root axis of cotton seedlings grown from irradiated and non-irradiated seeds was investigated using light microscopy and histological techniques. Special emphasis was placed on the pattern of vascular transition. Two patterns of vascular transition in non-irradiated seedlings were found. In Gossypium hirsutum and G. barbadense there are prominent metaxylem bands between the vascular bundles in the hypocotyl. In G. gossypioides there are no bands. The presence or absence of the bands was easily detected using polarized light. The most outstanding effects of radiation were inhibition of lateral root development and alteration of the pattern of vascular transition in seedlings grown from irradiated seeds. The findings suggest that the root apical meristem determines the vascular pattern
Effect of factory effluents on physiological and biochemical contents of Gossypium hirsutum l.
Muthusamy, A; Jayabalan, N
2001-10-01
The effect of sago and sugar factory effluents was studied on Gossypium hirsutum L. var. MCU 5 and MCU 11. Plants were irrigated with 0, 25, 50, 75 and 100% of effluents of both factories. At lower concentration (25%) of sugar factory effluents had stimulatory effect on all biochemical contents observed. Moreover, all concentration of sago factory effluents were found to have inhibitory effect on all biochemical contents except proline content which increased with increasing concentration of both the effluents. Plants growing on adjacent to sago and sugar factories or they irrigated with such type of polluted water, may accumulate the heavy metals found in both the effluents, at higher levels in plant products and if consumed may have similar effect on living organisms.
Guo, Hui; Wang, Xiyin; Gundlach, Heidrun; Mayer, Klaus F X; Peterson, Daniel G; Scheffler, Brian E; Chee, Peng W; Paterson, Andrew H
2014-08-01
Genome duplication is thought to be central to the evolution of morphological complexity, and some polyploids enjoy a variety of capabilities that transgress those of their diploid progenitors. Comparison of genomic sequences from several tetraploid (AtDt) Gossypium species and genotypes with putative diploid A- and D-genome progenitor species revealed that unidirectional DNA exchanges between homeologous chromosomes were the predominant mechanism responsible for allelic differences between the Gossypium tetraploids and their diploid progenitors. Homeologous gene conversion events (HeGCEs) gradually subsided, declining to rates similar to random mutation during radiation of the polyploid into multiple clades and species. Despite occurring in a common nucleus, preservation of HeGCE is asymmetric in the two tetraploid subgenomes. At-to-Dt conversion is far more abundant than the reciprocal, is enriched in heterochromatin, is highly correlated with GC content and transposon distribution, and may silence abundant A-genome-derived retrotransposons. Dt-to-At conversion is abundant in euchromatin and genes, frequently reversing losses of gene function. The long-standing observation that the nonspinnable-fibered D-genome contributes to the superior yield and quality of tetraploid cotton fibers may be explained by accelerated Dt to At conversion during cotton domestication and improvement, increasing dosage of alleles from the spinnable-fibered A-genome. HeGCE may provide an alternative to (rare) reciprocal DNA exchanges between chromosomes in heterochromatin, where genes have approximately five times greater abundance of Dt-to-At conversion than does adjacent intergenic DNA. Spanning exon-to-gene-sized regions, HeGCE is a natural noninvasive means of gene transfer with the precision of transformation, potentially important in genetic improvement of many crop plants. Copyright © 2014 by the Genetics Society of America.
Liu, Guozheng; Cao, Dandan; Li, Shuangshuang; Su, Aiguo; Geng, Jianing; Grover, Corrinne E; Hu, Songnian; Hua, Jinping
2013-01-01
Mitochondria are the main manufacturers of cellular ATP in eukaryotes. The plant mitochondrial genome contains large number of foreign DNA and repeated sequences undergone frequently intramolecular recombination. Upland Cotton (Gossypium hirsutum L.) is one of the main natural fiber crops and also an important oil-producing plant in the world. Sequencing of the cotton mitochondrial (mt) genome could be helpful for the evolution research of plant mt genomes. We utilized 454 technology for sequencing and combined with Fosmid library of the Gossypium hirsutum mt genome screening and positive clones sequencing and conducted a series of evolutionary analysis on Cycas taitungensis and 24 angiosperms mt genomes. After data assembling and contigs joining, the complete mitochondrial genome sequence of G. hirsutum was obtained. The completed G.hirsutum mt genome is 621,884 bp in length, and contained 68 genes, including 35 protein genes, four rRNA genes and 29 tRNA genes. Five gene clusters are found conserved in all plant mt genomes; one and four clusters are specifically conserved in monocots and dicots, respectively. Homologous sequences are distributed along the plant mt genomes and species closely related share the most homologous sequences. For species that have both mt and chloroplast genome sequences available, we checked the location of cp-like migration and found several fragments closely linked with mitochondrial genes. The G. hirsutum mt genome possesses most of the common characters of higher plant mt genomes. The existence of syntenic gene clusters, as well as the conservation of some intergenic sequences and genic content among the plant mt genomes suggest that evolution of mt genomes is consistent with plant taxonomy but independent among different species.
Directory of Open Access Journals (Sweden)
Wei Liu
2018-01-01
Full Text Available Terpenes are the largest and most diverse class of secondary metabolites in plants and play a very important role in plant adaptation to environment. 3-Hydroxy-3-methylglutaryl coenzyme A reductase (HMGR is a rate-limiting enzyme in the process of terpene biosynthesis in the cytosol. Previous study found the HMGR genes underwent gene expansion in Gossypium raimondii, but the characteristics and evolution of the HMGR gene family in Gossypium genus are unclear. In this study, genome-wide identification and comparative study of HMGR gene family were carried out in three Gossypium species with genome sequences, i.e., G. raimondii, Gossypium arboreum, and Gossypium hirsutum. In total, nine, nine and 18 HMGR genes were identified in G. raimondii, G. arboreum, and G. hirsutum, respectively. The results indicated that the HMGR genes underwent gene expansion and a unique gene cluster containing four HMGR genes was found in all the three Gossypium species. The phylogenetic analysis suggested that the expansion of HMGR genes had occurred in their common ancestor. There was a pseudogene that had a 10-bp deletion resulting in a frameshift mutation and could not be translated into functional proteins in G. arboreum and the A-subgenome of G. hirsutum. The expression profiles of the two pseudogenes showed that they had tissue-specific expression. Additionally, the expression pattern of the pseudogene in the A-subgenome of G. hirsutum was similar to its paralogous gene in the D-subgenome of G. hirsutum. Our results provide useful information for understanding cytosolic terpene biosynthesis in Gossypium species.
Ai, XianTao; Liang, YaJun; Wang, JunDuo; Zheng, JuYun; Gong, ZhaoLong; Guo, JiangPing; Li, XueYuan; Qu, YanYing
2017-10-01
Cotton (Gossypium spp.) is the most important natural textile fiber crop, and Gossypium hirsutum L. is responsible for 90% of the annual cotton crop in the world. Information on cotton genetic diversity and population structure is essential for new breeding lines. In this study, we analyzed population structure and genetic diversity of 288 elite Gossypium hirsutum cultivar accessions collected from around the world, and especially from China, using genome-wide single nucleotide polymorphisms (SNP) markers. The average polymorphsim information content (PIC) was 0.25, indicating a relatively low degree of genetic diversity. Population structure analysis revealed extensive admixture and identified three subgroups. Phylogenetic analysis supported the subgroups identified by STRUCTURE. The results from both population structure and phylogenetic analysis were, for the most part, in agreement with pedigree information. Analysis of molecular variance revealed a larger amount of variation was due to diversity within the groups. Establishment of genetic diversity and population structure from this study could be useful for genetic and genomic analysis and systematic utilization of the standing genetic variation in upland cotton.
Tang, Dong; Feng, Shouli; Li, Sai; Chen, Yu; Zhou, Baoliang
2018-03-27
Gossypium bickii: (2n = 26, G 1 G 1 ), a wild diploid cotton, carries many favourable traits. However, these favourable traits cannot be directly transferred into G. hirsutum (2n = 52, AADD) cultivars due to the differences in genomes. Monosomic alien addition lines (MAALs) are considered an invaluable tool for the introgression of genes of interest from wild relatives into cultivated crops. In this study, the G. hirsutum-G. bickii amphidiploid (2n = 78, AADDG 1 G 1 ) was backcrossed with G. hirsutum to develop alien additions containing individual G. bickii chromosomes in a G. hirsutum background. Genomic in situ hybridization was employed to detect the number of alien chromosomes added to the backcross progenies. A total of 183 G. bickii-specific DNA markers were developed to discriminate the identities of the G. bickii chromosomes added to G. hirsutum and assess the alien chromosome transmissibility. Chromosomes 4G b and 13G b showed the highest transmissibility, while chromosomes 1G b , 7G b and 11G b showed the lowest. Ten of the 13 possible G. hirsutum-G. bickii MAALs were isolated and characterized, which will lay the foundation for transferring resistance genes of G. bickii into G. hirsutum, as well as for gene assignment, physical mapping, and selective isolation and mapping of cDNAs for particular G. bickii chromosomes. The strategies of how to use MAALs to develop varieties with the trait of interest from wild species (such as glanded plant-glandless seed) were proposed and discussed.
Indian Academy of Sciences (India)
2015-03-12
Mar 12, 2015 ... measurement used to compare diversity between two or more ... Each individual genotype is represented by a line partitioned in five coloured segments that .... protein, the addition of more markers to catalogue multi-.
Directory of Open Access Journals (Sweden)
Ranjan Alok
2012-11-01
Full Text Available Abstract Background Root length and its architecture govern the adaptability of plants to various stress conditions, including drought stress. Genetic variations in root growth, length, and architecture are genotypes dependent. In this study, we compared the drought-induced transcriptome of four genotypes of Gossypium herbaceum that differed in their drought tolerance adaptability. Three different methodologies, namely, microarray, pyrosequencing, and qRT–PCR, were used for transcriptome analysis and validation. Results The variations in root length and growth were found among four genotypes of G.herbaceum when exposed to mannitol-induced osmotic stress. Under osmotic stress, the drought tolerant genotypes Vagad and GujCot-21 showed a longer root length than did by drought sensitive RAHS-14 and RAHS-IPS-187. Further, the gene expression patterns in the root tissue of all genotypes were analyzed. We obtained a total of 794 differentially expressed genes by microarray and 104928 high-quality reads representing 53195 unigenes from the root transcriptome. The Vagad and GujCot-21 respond to water stress by inducing various genes and pathways such as response to stresses, response to water deprivation, and flavonoid pathways. Some key regulatory genes involved in abiotic stress such as AP2 EREBP, MYB, WRKY, ERF, ERD9, and LEA were highly expressed in Vagad and GujCot-21. The genes RHD3, NAP1, LBD, and transcription factor WRKY75, known for root development under various stress conditions, were expressed specifically in Vagad and GujCot-21. The genes related to peroxidases, transporters, cell wall-modifying enzymes, and compatible solutes (amino acids, amino sugars, betaine, sugars, or sugar alcohols were also highly expressed in Vagad and Gujcot-21. Conclusion Our analysis highlights changes in the expression pattern of genes and depicts a small but highly specific set of drought responsive genes induced in response to drought stress. Some of these
Structural analysis of Gossypium hirsutum fibers grown under greenhouse and hydroponic conditions.
Natalio, Filipe; Tahir, Muhammad Nawaz; Friedrich, Norman; Köck, Margret; Fritz-Popovski, Gerhard; Paris, Oskar; Paschke, Reinhard
2016-06-01
Cotton is the one of the world's most important crops. Like any other crop, cotton growth/development and fiber quality is highly dependent on environmental factors. Increasing global weather instability has been negatively impacting its economy. Cotton is a crop that exerts an intensive pressure over natural resources (land and water) and demands an overuse of pesticides. Thus, the search for alternative cotton culture methods that are pesticide-free (biocotton) and enable customized standard fiber quality should be encouraged. Here we describe a culture of Gossypium hirsutum ("Upland" Cotton) utilizing a greenhouse and hydroponics in which the fibers are morphological similar to conventional cultures and structurally fit into the classical two-phase cellulose I model with 4.19nm crystalline domains surrounded by amorphous regions. These fibers exhibit a single crystalline form of cellulose I-Iß, monoclinic unit cell. Fiber quality bulk analysis shows an improved length, strength, whiteness when compared with soil-based cultures. Finally, we show that our fibers can be spun, used for production of non-woven fabrics and indigo-vat stained demonstrating its potential in industrial and commercial applications. Copyright © 2016 Elsevier Inc. All rights reserved.
Wang, W; Zhang, M; Chen, H D; Cai, X X; Xu, M L; Lei, K Y; Niu, J H; Deng, L; Liu, J; Ge, Z J; Yu, S X; Wang, B H
2016-10-06
In this study, a methylation-sensitive amplification polymorphism analysis system was used to analyze DNA methylation level in three cotton accessions. Two disease-sensitive near-isogenic lines, PD94042 and IL41, and one disease-resistant Gossypium mustelinum accession were exposed to Verticillium wilt, to investigate molecular disease resistance mechanisms in cotton. We observed multiple different DNA methylation types across the three accessions following Verticillium wilt exposure. These included hypomethylation, hypermethylation, and other patterns. In general, the global DNA methylation level was significantly increased in the disease-resistant accession G. mustelinum following disease exposure. In contrast, there was no significant difference in the disease-sensitive accession PD94042, and a significant decrease was observed in IL41. Our results suggest that disease-resistant cotton might employ a mechanism to increase methylation level in response to disease stress. The differing methylation patterns, together with the increase in global DNA methylation level, might play important roles in tolerance to Verticillium wilt in cotton. Through cloning and analysis of differently methylated DNA sequences, we were also able to identify several genes that may contribute to disease resistance in cotton. Our results revealed the effect of DNA methylation on cotton disease resistance, and also identified genes that played important roles, which may shed light on the future cotton disease-resistant molecular breeding.
Proteomic profiling of developing cotton fibers from wild and domesticated Gossypium barbadense.
Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Grupp, Kara; Chen, Sixue; Wendel, Jonathan F
2013-10-01
Pima cotton (Gossypium barbadense) is widely cultivated because of its long, strong seed trichomes ('fibers') used for premium textiles. These agronomically advanced fibers were derived following domestication and thousands of years of human-mediated crop improvement. To gain an insight into fiber development and evolution, we conducted comparative proteomic and transcriptomic profiling of developing fiber from an elite cultivar and a wild accession. Analyses using isobaric tag for relative and absolute quantification (iTRAQ) LC-MS/MS technology identified 1317 proteins in fiber. Of these, 205 were differentially expressed across developmental stages, and 190 showed differential expression between wild and cultivated forms, 14.4% of the proteome sampled. Human selection may have shifted the timing of developmental modules, such that some occur earlier in domesticated than in wild cotton. A novel approach was used to detect possible biased expression of homoeologous copies of proteins. Results indicate a significant partitioning of duplicate gene expression at the protein level, but an approximately equal degree of bias for each of the two constituent genomes of allopolyploid cotton. Our results demonstrate the power of complementary transcriptomic and proteomic approaches for the study of the domestication process. They also provide a rich database for mining for functional analyses of cotton improvement or evolution. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Pathak, Dharminder; Chen, Sixue; Wendel, Jonathan F
2014-12-01
Comparative proteomic analyses were performed to detail the evolutionary consequences of strong directional selection for enhanced fiber traits in modern upland cotton (Gossypium hirsutum L.). Using two complementary proteomic approaches, 2-DE and iTRAQ LC-MS/MS, fiber proteomes were examined for four representative stages of fiber development. Approximately 1,000 protein features were characterized using each strategy, collectively resulting in the identification and functional categorization of 1,223 proteins. Unequal contributions of homoeologous proteins were detected for over a third of the fiber proteome, but overall expression was balanced with respect to the genome-of-origin in the allopolyploid G. hirsutum. About 30% of the proteins were differentially expressed during fiber development within wild and domesticated cotton. Notably, domestication was accompanied by a doubling of protein developmental dynamics for the period between 10 and 20 days following pollination. Expression levels of 240 iTRAQ proteins and 293 2-DE spots were altered by domestication, collectively representing multiple cellular and metabolic processes, including metabolism, energy, protein synthesis and destination, defense and stress response. Analyses of homoeolog-specific expression indicate that duplicated gene products in cotton fibers can be differently regulated in response to selection. These results demonstrate the power of proteomics for the analysis of crop domestication and phenotypic evolution.
MicroRNA-target gene responses to lead-induced stress in cotton (Gossypium hirsutum L.).
He, Qiuling; Zhu, Shuijin; Zhang, Baohong
2014-09-01
MicroRNAs (miRNAs) play key roles in plant responses to various metal stresses. To investigate the miRNA-mediated plant response to heavy metals, cotton (Gossypium hirsutum L.), the most important fiber crop in the world, was exposed to different concentrations (0, 25, 50, 100, and 200 µM) of lead (Pb) and then the toxicological effects were investigated. The expression patterns of 16 stress-responsive miRNAs and 10 target genes were monitored in cotton leaves and roots by quantitative real-time PCR (qRT-PCR); of these selected genes, several miRNAs and their target genes are involved in root development. The results show a reciprocal regulation of cotton response to lead stress by miRNAs. The characterization of the miRNAs and the associated target genes in response to lead exposure would help in defining the potential roles of miRNAs in plant adaptation to heavy metal stress and further understanding miRNA regulation in response to abiotic stress.
Phenotyping Root System Architecture of Cotton (Gossypium barbadense L. Grown Under Salinity
Directory of Open Access Journals (Sweden)
Mottaleb Shady A.
2017-12-01
Full Text Available Soil salinity causes an annual deep negative impact to the global agricultural economy. In this study, the effects of salinity on early seedling physiology of two Egyptian cotton (Gossypium barbadense L. cultivars differing in their salinity tolerance were examined. Also the potential use of a low cost mini-rhizotron system to measure variation in root system architecture (RSA traits existing in both cultivars was assessed. Salt tolerant cotton cultivar ‘Giza 90’ produced significantly higher root and shoot biomass, accumulated lower Na+/K+ ratio through a higher Na+ exclusion from both roots and leaves as well as synthesized higher proline contents compared to salt sensitive ‘Giza 45’ cultivar. Measuring RSA in mini-rhizotrons containing solid MS nutrient medium as substrate proved to be more precise and efficient than peat moss/sand mixture. We report superior values of main root growth rate, total root system size, main root length, higher number of lateral roots and average lateral root length in ‘Giza 90’ under salinity. Higher lateral root density and length together with higher root tissue tolerance of Na+ ions in ‘Giza 90’ give it an advantage to be used as donor genotype for desirable root traits to other elite cultivars.
Genetic divergence and association among polygenic characters in gossypium hirsutum L
International Nuclear Information System (INIS)
BiBi, M.; Khan, N.U.; Mohammad, F.; Gul, R.
2011-01-01
Development of promising cotton populations with improved agronomic performance is primary objective of the cotton breeders. Genetic potential and variability in 8 X 8 F/sub 1/diallel hybrids versus their parental lines, traits correlation and heritability estimates were studied in Gossypium hirsutum L., during 2008-09 at Khyber Pakhtunkhwa Agricultural University, Peshawar, Pakistan. Highly significant variations were observed among the parental cultivars and their F/sub 1/ hybrids for all traits. Results indicated that F/sub 1/ hybrids CIM-506 X CIM-554, CIM-473 X CIM-554, CIM-446 X CIM-554 and CIM-446 X CIM-496 (its reciprocal) produced significantly higher seed cotton yield, bolls per sympodia, boll weight and seeds per boll. Most of the F/sub 1/ populations involving CIM-554 as maternal plant also revealed early maturity. Yield related traits revealed significant positive correlations with seed cotton yield. Heritability (broad sense) was high in magnitude for all traits. Results revealed that traits with high heritability and wide range of genetic variability in breeding material can work as a base population, and their significant contribution towards high yield can help in early segregating generations. (author)
Genetic diversity of sea-island cotton (Gossypium barbadense) revealed by mapped SSRs.
Wang, X Q; Feng, C H; Lin, Z X; Zhang, X L
2011-12-08
In order to evaluate the genetic diversity of sea-island cotton (Gossypium barbadense), 237 commonly mapped SSR markers covering the cotton genome were used to genotype 56 sea-island cotton accessions. A total of 218 polymorphic primer pairs (91.98%) amplified 361 loci, with a mean of 1.66 loci. Polymorphism information content values of the SSR primers ranged from 0.035 to 0.862, with a mean of 0.320. The highest mean polymorphism information content value for the SSR motifs was from a compound motif (0.402), and for the chromosomes it was Chr10 (0.589); the highest ratio of polymorphic primers in Xinjiang accessions was from Chr21 (83.33%). Genetic diversity was high in Xinjiang accessions. AMOVA showed that variation was 8 and 92% among populations and within populations, respectively. The 56 sea-island accessions were divided into three groups in the UPGMA dendrogram: Xinhai5 was in the first group; accessions from Xinjiang, except the five main ones, were in the second group, and the other 34 accessions were in the third group. Accessions from the former Soviet Union and Xinjiang main accessions were closely related. Both PCA and UPGMA confirmed that Xinhai5 was distinct from the other accessions, and accessions from Xinjiang were in an independent group. Given the differences between principal components analysis and UPGMA results, it is necessary to combine molecular markers and pedigree information so that genetic diversity can be objectively analyzed.
International Nuclear Information System (INIS)
Makhdum, M.I.; Pervez, H.; Ashraf, M.
2005-01-01
A field experiment was conducted using four (Gossypium hirsutum l.) cultivars (OM-448, OM-I00, NIAB-Karishma, 5-12) at four rates of potassium (0, 62, 5, 125, 250 kg K ha-1) and with two sources of potassium (K/sub 2/S0/sub 4/, KCI) to determine the effects of potassium (K) fertilizer on fruit production under irrigated conditions. Cultivars differed significantly amongst themselves in production and retention of fruits per unit land area. The cultivars were categorized as OM-448>OM-1100>Karishma>5-12 in order of fruit production. The number of total fruiting positions increased with concurrent levels of K-fertilizer. The shedding of fruit was significantly reduced by application of 250 kg K ha-1 compared to zero K-rate treatment. The addition of K-fertilizer in the form of K/sub 2/S0/sub 4/ showed an edge over KCI in fruit production. A high degree of correlation (r 0.89**,0.91**, -0.8**) was measured between seed cotton yield and number of total fruiting positions, number of intact fruit and fruit shedding percentage respectively. (author)
Genome-Wide Analysis of the RNA Helicase Gene Family in Gossypium raimondii
Directory of Open Access Journals (Sweden)
Jie Chen
2014-03-01
Full Text Available The RNA helicases, which help to unwind stable RNA duplexes, and have important roles in RNA metabolism, belong to a class of motor proteins that play important roles in plant development and responses to stress. Although this family of genes has been the subject of systematic investigation in Arabidopsis, rice, and tomato, it has not yet been characterized in cotton. In this study, we identified 161 putative RNA helicase genes in the genome of the diploid cotton species Gossypium raimondii. We classified these genes into three subfamilies, based on the presence of either a DEAD-box (51 genes, DEAH-box (52 genes, or DExD/H-box (58 genes in their coding regions. Chromosome location analysis showed that the genes that encode RNA helicases are distributed across all 13 chromosomes of G. raimondii. Syntenic analysis revealed that 62 of the 161 G. raimondii helicase genes (38.5% are within the identified syntenic blocks. Sixty-six (40.99% helicase genes from G. raimondii have one or several putative orthologs in tomato. Additionally, GrDEADs have more conserved gene structures and more simple domains than GrDEAHs and GrDExD/Hs. Transcriptome sequencing data demonstrated that many of these helicases, especially GrDEADs, are highly expressed at the fiber initiation stage and in mature leaves. To our knowledge, this is the first report of a genome-wide analysis of the RNA helicase gene family in cotton.
Institute of Scientific and Technical Information of China (English)
SU Ai-guo; LI Shuang-shuang; LIU Guo-zheng; LEI Bin-bin; KANG Ding-ming; LI Zhao-hu; MA Zhi-ying; HUA Jin-ping
2014-01-01
The plant mitochondrial genome displays complex features, particularly in terms of cytoplasmic male sterility (CMS). Therefore, research on the cotton mitochondrial genome may provide important information for analyzing genome evolution and exploring the molecular mechanism of CMS. In this paper, we present a preliminary study on the mitochondrial genome of sea island cotton (Gossypium barbadense) based on positive clones from the bacterial artiifcial chromosome (BAC) library. Thirty-ifve primers designed with the conserved sequences of functional genes and exons of mitochondria were used to screen positive clones in the genome library of the sea island cotton variety called Pima 90-53. Ten BAC clones were obtained and veriifed for further study. A contig was obtained based on six overlapping clones and subsequently laid out primarily on the mitochondrial genome. One BAC clone, clone 6 harbored with the inserter of approximate 115 kb mtDNA sequence, in which more than 10 primers fragments could be ampliifed, was sequenced and assembled using the Solexa strategy. Fifteen mitochondrial functional genes were revealed in clone 6 by gene annotation. The characteristics of the syntenic gene/exon of the sequences and RNA editing were preliminarily predicted.
Response of Cotton (Gossypium Hirsutum L.) to Nitrogen Phosphorous Fertilizers in Western Kenya
International Nuclear Information System (INIS)
Kouko, W.O; Owino, G.
1999-01-01
The requirements for nitrogen and phosphorous fertilizers for growing cotton (Gossypium hirsutum L.) in Kenya are 26-kg N ha - 1 and 27 kg P ha - 1, respectively. Calcium ammonium nitrate (CAN) was recommended at the rate of 100 kg ha - 1 for black cotton soils while double superphosphate (DSP) was recommended at the rate of 150 kg ha - 1 on reddish brown clays. However, experiments conducted on a major soil types on which cotton is grown in Kenya showed that, soil colour is not the best indicator of nutrients supply power of the soil. It was found that Verto-eutric planosols of National Fibre Research Centres-Kibos requires application of 13-kg ha - 1 as CAN for optimal yields. Ferralo-eurtric Acrisols of Alupe Agricultural Research Sub-Centre, Busia needed 26-kg N ha - 1 and 9 kg P ha - 1 to give high yields. At Siaya FTC 9 kg P ha - 1 was adequate in providing the highest yields without nitrogen. Strict observation of recommended agronomic practices for growing cotton and good soil management practices for growing cotton and good soil management practices were observed a prerequisite for high response and efficient utilisation of fertilizers
International Nuclear Information System (INIS)
Hussain, T.; Majeed, A.; Maqbool, A.; Hussain, S.S.; Ali, T.; Riazuddin, S.
2005-01-01
Negative effects on the Water status of plants is one of the most common and deleterious stresses experienced by wild and cultivated plants throughout the World. Our project is designed to identify, clone and characterize gene sequences regulated in response to Water stress (e.g., drought). We used the differential-display reverse transcriptase polymerase chain reaction (DD-RT- PCA) methodology to accomplish our Objectives. Structural and functional characterization of environmental stress-induced genes has contributed to a better understanding of how plants respond and adapt to different abiotic stresses. Differential display was used to compare overall difference in gene expression between draught stressed and unstressed (control) plants of diploid Cotton (Gossypium arboreum). DDRT-PCR product from stressed and unstressed samples resolved side by side on 6% PAGE to compare qualitative and quantitative difference in mRNA expression. A total of 81 primer combinations were tested. DDRT -PCR enabled us to identify differentially expressed transcripts between water stressed and non-stressed cotton seedlings. PAGE revealed a total of 347 DNA transcripts in stressed samples (New Transcripts) while 110 down regulated and 209 up regulated DNA transcripts were also recorded. Similarly. 22 DNA transcripts were identified based on the comparative study of PAGE and Agarose gel electrophoresis. These sequences showed various degree homology With draught tolerant genes in the gene bank. (author)
Tao, Tao; Zhao, Liang; Lv, Yuanda; Chen, Jiedan; Hu, Yan; Zhang, Tianzhen; Zhou, Baoliang
2013-01-01
The genus Gossypium is a globally important crop that is used to produce textiles, oil and protein. However, gossypol, which is found in cultivated cottonseed, is toxic to humans and non-ruminant animals. Efforts have been made to breed improved cultivated cotton with lower gossypol content. The delayed gland morphogenesis trait possessed by some Australian wild cotton species may enable the widespread, direct usage of cottonseed. However, the mechanisms about the delayed gland morphogenesis are still unknown. Here, we sequenced the first Australian wild cotton species ( Gossypium australe ) and a diploid cotton species ( Gossypium arboreum ) using the Illumina Hiseq 2000 RNA-seq platform to help elucidate the mechanisms underlying gossypol synthesis and gland development. Paired-end Illumina short reads were de novo assembled into 226,184, 213,257 and 275,434 transcripts, clustering into 61,048, 47,908 and 72,985 individual clusters with N50 lengths of 1,710 bp, 1544 BP and 1,743 bp, respectively. The clustered Unigenes were searched against three public protein databases (TrEMBL, SwissProt and RefSeq) and the nucleotide and protein sequences of Gossypium raimondii using BLASTx and BLASTn. A total of 21,987, 17,209 and 25,325 Unigenes were annotated. Of these, 18,766 (85.4%), 14,552 (84.6%) and 21,374 (84.4%) Unigenes could be assigned to GO-term classifications. We identified and analyzed 13,884 differentially expressed Unigenes by clustering and functional enrichment. Terpenoid-related biosynthesis pathways showed differentially regulated expression patterns between the two cotton species. Phylogenetic analysis of the terpene synthases family was also carried out to clarify the classifications of TPSs. RNA-seq data from two distinct cotton species provide comprehensive transcriptome annotation resources and global gene expression profiles during seed germination and gland and gossypol formation. These data may be used to further elucidate various mechanisms and
Linkage and association mapping reveals the genetic basis of brown fibre (Gossypium hirsutum).
Wen, Tianwang; Wu, Mi; Shen, Chao; Gao, Bin; Zhu, De; Zhang, Xianlong; You, Chunyuan; Lin, Zhongxu
2018-02-24
Brown fibre cotton is an environmental-friendly resource that plays a key role in the textile industry. However, the fibre quality and yield of natural brown cotton are poor, and fundamental research on brown cotton is relatively scarce. To understand the genetic basis of brown fibre cotton, we constructed linkage and association populations to systematically examine brown fibre accessions. We fine-mapped the brown fibre region, Lc 1 , and dissected it into 2 loci, qBF-A07-1 and qBF-A07-2. The qBF-A07-1 locus mediates the initiation of brown fibre production, whereas the shade of the brown fibre is affected by the interaction between qBF-A07-1 and qBF-A07-2. Gh_A07G2341 and Gh_A07G0100 were identified as candidate genes for qBF-A07-1 and qBF-A07-2, respectively. Haploid analysis of the signals significantly associated with these two loci showed that most tetraploid modern brown cotton accessions exhibit the introgression signature of Gossypium barbadense. We identified 10 quantitative trait loci (QTLs) for fibre yield and 19 QTLs for fibre quality through a genome-wide association study (GWAS) and found that qBF-A07-2 negatively affects fibre yield and quality through an epistatic interaction with qBF-A07-1. This study sheds light on the genetics of fibre colour and lint-related traits in brown fibre cotton, which will guide the elite cultivars breeding of brown fibre cotton. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Wang, Ning; Hua, Hanbai; Eneji, A Egrinya; Li, Zhaohu; Duan, Liusheng; Tian, Xiaoli
2012-05-02
A hydroponic culture experiment was conducted to determine genotypic variation in photosynthetic rate and the associated physiological changes in response to potassium (K) deficiency in cotton (Gossypium hirsutum L.) seedlings with contrasting two cotton cultivars in K efficiency. The K-efficient Liaomian18 produced 66.7% more biomass than the K-inefficient NuCOTN99(B) under K deficiency, despite their similar biomass under K sufficiency. Compared with NuCOTN99(B), Liaomian18 showed 19.4% higher net photosynthetic rate (P(n), per unit leaf area) under K deficient solutions and this was associated with higher photochemical efficiency and faster export of soluble sugars from the phloem. The lower net P(n) of NuCOTN99(B) was attributed to higher capacity for nitrate assimilation and lower export of soluble sugars. Furthermore, NuCOTN99(B) showed 38.4% greater ETR/P(n) than Liaomian18 under K deficiency, indicating that more electrons were driven to other sinks. Higher superoxide dismutase (SOD) and lower catalase (CAT) and ascorbate peroxidase (APX) activities resulted in higher levels of reactive oxygen species (ROS; e.g. O(2)(-)and H(2)O(2)) in NuCOTN99(B) relative to Liaomian18. Thus, the K inefficiency of NuCOTN99(B), indicated by lower biomass and net P(n) under K deficiency, was associated with excessively high nitrogen assimilation, lower export of carbon assimilates, and greater ROS accumulation in the leaf. Crown Copyright © 2012. Published by Elsevier B.V. All rights reserved.
Characterization of indigenous gossypium arboreum L. genotypes for various fiber quality traits
International Nuclear Information System (INIS)
Iqbal, M. A.; Abbas, A.; Zafar, Y.
2015-01-01
Diploid cotton (Gossypium arboreum L.) being an Old World cultivated cotton species, evolved in Indo-Pak subcontinent, has been known for conferring resistance to biotic and abiotic stresses. To the extent of our knowledge, there is no comprehensive report available on the characterization of G. arboreum germplasm. Hence, the present study was conducted to characterize 26 G. arboreum genotypes by deploying univariate and multivariate analysis in 2010 at NIBGE, Faisalabad. All these genotypes were characterized for boll weight, GOT percentage, micronaire value, staple length, fiber bundle strength and uniformity index. Genotypic variation was significant (p<0.01) for all the analyzed traits except boll weight. Maximum boll weight (2.47g) was observed for genotype 23718. GOT ranged from 18.75% (Haroonabad) to 36.94 percentage (DC-116).The finest fiber was obtained from synthetic (4.37 micro g/inch) and this genotype also exhibited the higher values for staple length (23.81 mm) and fiber bundle strength (27.37 g/tex). Range for uniformity index was observed from 76.19 percentage (Garohill) to 77.98 percentage (212). Principal component analysis (PCA) exhibited that first five components accounted for >63 percentage of the total variability. Cluster analysis identified four groups based on their agronomic properties. Significant relationships among different traits can be useful to select best genotypes having good fiber quality traits. These genotypes may prove a valuable resource to fuel the breeding efforts for not only broadening the genetic base of the newly developed material but can also add synergy to various cotton genomic projects. (author)
Analyses of Fusarium wilt race 3 resistance in Upland cotton (Gossypium hirsutum L.).
Abdullaev, Alisher A; Salakhutdinov, Ilkhom B; Egamberdiev, Sharof Sh; Kuryazov, Zarif; Glukhova, Ludmila A; Adilova, Azoda T; Rizaeva, Sofiya M; Ulloa, Mauricio; Abdurakhmonov, Ibrokhim Y
2015-06-01
Fusarium wilt [Fusarium oxysporum f.sp. vasinfectum (FOV) Atk. Sny & Hans] represents a serious threat to cotton (Gossypium spp.) production. For the last few decades, the FOV pathogen has become a significant problem in Uzbekistan causing severe wilt disease and yield losses of G. hirsutum L. cultivars. We present the first genetic analyses of FOV race 3 resistance on Uzbek Cotton Germplasm with a series of field and greenhouse artificial inoculation-evaluations and inheritance studies. The field experiments were conducted in two different sites: the experimental station in Zangiota region-Environment (Env) 1 and the Institute of Cotton Breeding (Env-2, Tashkent province). The Env-1 was known to be free of FOV while the Env-2 was known to be a heavily FOV infested soil. In both (Env-1 and Env-2) of these sites, field soil was inoculated with FOV race 3. F2 and an F3 Upland populations ("Mebane B1" × "11970") were observed with a large phenotypic variance for plant survival and FOV disease severity within populations and among control or check Upland accessions. Wilt symptoms among studied F2 individuals and F3 families significantly differed depending on test type and evaluation site. Distribution of Mendelian rations of susceptible (S) and resistant (R) phenotypes were 1S:1R field Env-1 and 3S:1R field Env-2 in the F2 population, and 1S:3R greenhouse site in the F3 population. The different segregation distribution of the Uzbek populations may be explained by differences in FOV inoculum level and environmental conditions during assays. However, genetic analysis indicated a recessive single gene action under high inoculum levels or disease pressure for FOV race 3 resistance. Uzbek germplasm may be more susceptible than expected to FOV race 3, and sources of resistance to FOV may be limited under the FOV inoculum levels present in highly-infested fields making the breeding process more complex.
Directory of Open Access Journals (Sweden)
María J Ek-Ramos
Full Text Available Studies of fungi in upland cotton (Gossypium hirsutum cultivated in the United States have largely focused on monitoring and controlling plant pathogens. Given increasing interest in asymptomatic fungal endophytes as potential biological control agents, surveys are needed to better characterize their diversity, distribution patterns and possible applications in integrated pest management. We sampled multiple varieties of cotton in Texas, USA and tested for temporal and spatial variation in fungal endophyte diversity and community composition, as well as for differences associated with organic and conventional farming practices. Fungal isolates were identified by morphological and DNA identification methods. We found members of the genera Alternaria, Colletotrichum and Phomopsis, previously isolated as endophytes from other plant species. Other recovered species such as Drechslerella dactyloides (formerly Arthrobotrys dactyloides and Exserohilum rostratum have not, to our knowledge, been previously reported as endophytes in cotton. We also isolated many latent pathogens, but some species such as Alternaria tennuissima, Epicoccum nigrum, Acremonium alternatum, Cladosporium cladosporioides, Chaetomium globosum and Paecilomyces sp., are known to be antagonists against plant pathogens, insects and nematode pests. We found no differences in endophyte species richness or diversity among different cotton varieties, but did detect differences over time and in different plant tissues. No consistent patterns of community similarity associated with variety, region, farming practice, time of the season or tissue type were observed regardless of the ecological community similarity measurements used. Results indicated that local fungal endophyte communities may be affected by both time of the year and plant tissue, but the specific community composition varies across sites. In addition to providing insights into fungal endophyte community structure, our survey
International Nuclear Information System (INIS)
Makhdum, M.I.; Ashraf, M.
2007-01-01
Field studies were undertaken to determine the interrelationship between potassium (K+) concentration in various organs of plant and phosphorus (P) content as influenced by K-nutrition in cotton. The experiment was conducted on Miani soil series silt loam and classified as Calcaric Cambisols, fine silty, mixed Hyperthermic Fluventic Haplocambids. The treatments consisted .of (a) four cotton (Gossypium hirsutum L.) cultivars (CI.M-448, CIM-IIOO, Karishma, S-12); and (b) four potassium fertilizer doses (0, 62.5, 125.0, 250.0 kg K ha-l). The design of experiment was split plot (main: cultivars, sub-plot: K-doses). The plant samples were collected at five stages of growth, i.e., first flower bud., first flower, peak flowering, first boll split and maturity. The various parts of plants were analyzed for phosphorus and potassium concentration at various stages of growth. Phosphorus concentration in leaves, stems, burs, seed and lint decreased with concurrent increase in K-doses. Crop maintained 0.22% phosphorus concentration in leaf tissues at first flower bud and dropped to 0.11% at maturity. Cultivars differed greatly amongst themselves in terms of maintaining P content in their different parts. Averaged across K-doses, cv. CIM-448 maintained the highest P content in all parts than other cultivars. There was a negative and significant correlation co-efficient between K and P concentration in various parts of the plant. The study demonstrated antagonistic interaction between K+ and P in cotton plant under irrigated conditions. (author)
Selectivity and stability of vegetation-applied herbicides in cotton (Gossypium hirsutum L.
Directory of Open Access Journals (Sweden)
T. Barakova
2016-06-01
Full Text Available Abstract. An experiment was carried out during 2013 – 2015 in the experimental field of the Field Crops Institute, Chirpan, with two cotton cultivars − Helius and Darmi (Gossypium hirsutum L.. Herbicides: Goal 2 E, oxyfluorfen (80 ml/da; Linuron 45 SC, linuron (200 ml/da; Wing-P, pendimethalin + dimethenamid (400 ml/da; Merlin 750 WG, isoxaflutol (5 g/da; Bazagran 480 SL, bentazone (150 ml/da were investigated. They were treated separately or combined with growth regulator Amalgerol (500 ml/da or foliar fertilizer Lactofol O (500 ml/da in the budding stage of the cotton. It was established that selectivity is the lowest in the two cotton cultivars with herbicides Linuron 45 CK and Merlin 750 WG. The purpose of this investigation was to establish the selectivity and stability of some herbicides and their tank mixtures on the cotton by influence of different meteorological conditions. It has been found that the highest phytotoxicity on cotton is given the vegetation-applied herbicides Merlin and Linuron. Foliar fertilizer Laktofol O reduces phytotoxicity of herbicides Goal, Wing, Merlin and Bazagran in two cotton cultivars. Herbicides Wing and Bazagran have excellent selectivity for the two cotton cultivars – Helius and Darmi. The highest yield was obtained by vegetation treatment with herbicide Bazagran, followed by herbicides Wing and Goal. Tank mixtures of Goal, Bazagran and Wing with Laktofol, followed by those with Amalgerol are technologically the most valuable. They combine high yield with high stability over the years. Аlone application of herbicides Linuron and Merlin and their tank mixtures with Amalgerol and Laktofol have low estimate.
Major quantitative trait loci (QTL) have been mapped to Upland cotton (Gossypium hirsutum L.) chromosomes 11 and 14 that govern the highly resistant phenotype in response to infection by root-knot nematode (RKN; Meloidogyne incognita Chitwood & White); however, nearly nothing is known regarding the ...
Changes in temperature, atmospheric [CO2] and precipitation under the scenarios of projected climate change present a challenge to crop production, and may have significant impacts on the physiology, growth and yield of cotton (Gossypium hirsutum L.). A glasshouse experiment explored the early growt...
To Identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode and fungal disease resistance traits, a series of interspecific cotton (Gossypium spp.) chromosome substitution (CS) lines were used in this study. The CS lines were developed in ...
MIC-3-related genes of cotton (Gossypium spp.) were identified and shown to have root-specific expression, associated with pathogen defense-related function and specifically increased expression in root-knot nematode (RKN) resistant plants after nematode infection. Here we cloned and sequenced MIC-...
Hou, Meiying; Cai, Caiping; Zhang, Shuwen; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang
2013-12-01
Gossypium tomentosum, a wild tetraploid cotton species with AD genomes, possesses genes conferring strong fibers and high heat tolerance. To effectively transfer these genes into Gossypium hirsutum, an entire microsatellite (simple sequence repeat, SSR)-based genetic map was constructed using the interspecific cross of G. hirsutum x G. tomentosum (HT). We detected 1800 loci from 1347 pairs of polymorphic primers. Of these, 1204 loci were grouped into 35 linkage groups at LOD ≥ 4. The map covers 3320.8 cM, with a mean density of 2.76 cM per locus. We detected 420 common loci (186 in the At subgenome and 234 in Dt) between the HT map and the map of TM-1 (G. hirsutum) and Hai 7124 (G. barbadense; HB map). The linkage groups were assigned chromosome numbers based on location of common loci and the HB map as reference. A comparison of common markers revealed that no significant chromosomal rearrangement exist between G. tomentosum and G. barbadense. Interestingly, however, we detected numerous (33.7%) segregation loci deviating from 3:1 ratio (P constructed in this study will be useful for further genetic studies on cotton breeding, including mapping loci controlling quantitative traits associated with fiber quality, stress tolerance and developing chromosome segment specific introgression lines from G. tomentosum into G. hirsutum using marker-assisted selection.
Rapp, Ryan A; Haigler, Candace H; Flagel, Lex; Hovav, Ran H; Udall, Joshua A; Wendel, Jonathan F
2010-11-15
Understanding the evolutionary genetics of modern crop phenotypes has a dual relevance to evolutionary biology and crop improvement. Modern upland cotton (Gossypium hirsutum L.) was developed following thousands of years of artificial selection from a wild form, G. hirsutum var. yucatanense, which bears a shorter, sparser, layer of single-celled, ovular trichomes ('fibre'). In order to gain an insight into the nature of the developmental genetic transformations that accompanied domestication and crop improvement, we studied the transcriptomes of cotton fibres from wild and domesticated accessions over a developmental time course. Fibre cells were harvested between 2 and 25 days post-anthesis and encompassed the primary and secondary wall synthesis stages. Using amplified messenger RNA and a custom microarray platform designed to interrogate expression for 40,430 genes, we determined global patterns of expression during fibre development. The fibre transcriptome of domesticated cotton is far more dynamic than that of wild cotton, with over twice as many genes being differentially expressed during development (12,626 versus 5273). Remarkably, a total of 9465 genes were diagnosed as differentially expressed between wild and domesticated fibres when summed across five key developmental time points. Human selection during the initial domestication and subsequent crop improvement has resulted in a biased upregulation of components of the transcriptional network that are important for agronomically advanced fibre, especially in the early stages of development. About 15% of the differentially expressed genes in wild versus domesticated cotton fibre have no homology to the genes in databases. We show that artificial selection during crop domestication can radically alter the transcriptional developmental network of even a single-celled structure, affecting nearly a quarter of the genes in the genome. Gene expression during fibre development within accessions and expression
Artico, Sinara; Ribeiro-Alves, Marcelo; Oliveira-Neto, Osmundo Brilhante; de Macedo, Leonardo Lima Pepino; Silveira, Sylvia; Grossi-de-Sa, Maria Fátima; Martinelli, Adriana Pinheiro; Alves-Ferreira, Marcio
2014-10-04
Cotton is a major fibre crop grown worldwide that suffers extensive damage from chewing insects, including the cotton boll weevil larvae (Anthonomus grandis). Transcriptome analysis was performed to understand the molecular interactions between Gossypium hirsutum L. and cotton boll weevil larvae. The Illumina HiSeq 2000 platform was used to sequence the transcriptome of cotton flower buds infested with boll weevil larvae. The analysis generated a total of 327,489,418 sequence reads that were aligned to the G. hirsutum reference transcriptome. The total number of expressed genes was over 21,697 per sample with an average length of 1,063 bp. The DEGseq analysis identified 443 differentially expressed genes (DEG) in cotton flower buds infected with boll weevil larvae. Among them, 402 (90.7%) were up-regulated, 41 (9.3%) were down-regulated and 432 (97.5%) were identified as orthologues of A. thaliana genes using Blastx. Mapman analysis of DEG indicated that many genes were involved in the biotic stress response spanning a range of functions, from a gene encoding a receptor-like kinase to genes involved in triggering defensive responses such as MAPK, transcription factors (WRKY and ERF) and signalling by ethylene (ET) and jasmonic acid (JA) hormones. Furthermore, the spatial expression pattern of 32 of the genes responsive to boll weevil larvae feeding was determined by "in situ" qPCR analysis from RNA isolated from two flower structures, the stamen and the carpel, by laser microdissection (LMD). A large number of cotton transcripts were significantly altered upon infestation by larvae. Among the changes in gene expression, we highlighted the transcription of receptors/sensors that recognise chitin or insect oral secretions; the altered regulation of transcripts encoding enzymes related to kinase cascades, transcription factors, Ca2+ influxes, and reactive oxygen species; and the modulation of transcripts encoding enzymes from phytohormone signalling pathways. These
Snider, John L; Oosterhuis, Derrick M; Collins, Guy D; Pilon, Cristiane; Fitzsimons, Toby R
2013-03-15
Previous investigations have demonstrated that photosystem II (PSII) thermostability acclimates to prior exposure to heat and drought, but contrasting results have been reported for cotton (Gossypium hirsutum). We hypothesized that PSII thermotolerance in G. hirsutum would acclimate to environmental conditions during the growing season and that there would be differences in PSII thermotolerance between commercially-available U.S. cultivars. To this end, three cotton cultivars were grown under dryland conditions in Tifton Georgia, and two under irrigated conditions in Marianna Arkansas. At Tifton, measurements included PSII thermotolerance (T15, the temperature causing a 15% decline in maximum quantum yield), leaf temperatures, air temperatures, midday (1200 to 1400h) leaf water potentials (ΨMD), leaf-air vapor pressure deficit (VPD), actual quantum yield (ΦPSII) and electron transport rate through PSII (ETR) on three sample dates. At Marianna, T15 was measured on two sample dates. Optimal air and leaf temperatures were observed on all sample dates in Tifton, but PSII thermotolerance increased with water deficit conditions (ΨMD=-3.1MPa), and ETR was either unaffected or increased under water-stress. Additionally, T15 for PHY 499 was ∼5°C higher than for the other cultivars examined (DP 0912 and DP 1050). The Marianna site experienced more extreme high temperature conditions (20-30 days Tmax≥35°C), and showed an increase in T15 with higher average Tmax. When average T15 values for each location and sample date were plotted versus average daily Tmax, strong, positive relationships (r(2) from .954 to .714) were observed between Tmax and T15. For all locations T15 was substantially higher than actual field temperature conditions. We conclude that PSII thermostability in G. hirsutum acclimates to pre-existing environmental conditions; PSII is extremely tolerant to high temperature and water-deficit stress; and differences in PSII thermotolerance exist between
Genetic variation and heritability for cotton seed, fiber and oil traits in gossypium hirsutum
International Nuclear Information System (INIS)
Khan, N.U.; Farhatullah; Batool, S.; Makhdoom, K.; Marwat, K.B.; Hassan, G.; Ahmad, W.; Khan, H.U.
2010-01-01
The research work pertaining to the study of genetic variability, heritability, genetic gain and correlation for cottonseed, fiber and cottonseed oil % in Gossypium hirsutum cultivars was conducted during 2005 at NWFP Agricultural University Peshawar, Pakistan. Analysis of variance manifested highly significant differences among the genotypes for all the traits except seeds per locule. Genetic potential range of eight cotton cultivars for different parameters was recorded i.e. seeds locule-1 (6.33 to 6.60), seeds boll-1 (26.10 to 28.47), seed index (8.61 to 9.69 g), lint index (5.35 to 6.05 g), lint % (35.17 to 38.13 %), seed cotton yield (1200 to 2450 kg ha/sup -1/) and cottonseed oil % (27.52 to 30.15%). Genetic variances were found almost greater than the environmental variances for all the traits except seeds locule-1 and seed index. High broad sense heritability and selection response were also formulated for seeds boll-1 (0.67, 0.84), seed index (0.77, 0.47 g), lint index (0.96, 0.33 g), lint % (0.96, 1.66 %), seed cotton yield (0.98, 643.16 kg) and cottonseed oil % (0.87, 1.28 %), respectively. Correlation of yield with other traits was found positive for majority of traits except seeds locule-1 and cotton seed oil %. Seed cotton yield is our ultimate goal in growing cotton besides lint %. Highest seed cotton yield was recorded in CIM-499 followed by CIM-473, CIM-496 and CIM-506 and were also found as the second and third top scoring genotypes for seeds per boll, seed index, lint % and cottonseed oil %. Cultivar SLH-279 performed better for lint index, lint % and oil %. This type of correlation is rarely found and ultra desirable by the cotton breeders and a little genetic gain in seed and lint traits, and oil content is a great accomplishment. (author)
Directory of Open Access Journals (Sweden)
Fábio Shigeo Takatsuka
2007-09-01
Full Text Available
Avaliou-se a seletividade de inseticidas sobre o complexo de inimigos naturais na cultura do algodão (Gossypium hirsutum L., no município de Goiânia, GO. Utilizou-se a cultivar Deltapine e o delineamento experimental em blocos ao acaso, com sete tratamentos e quatro repetições. Os tratamentos foram: testemunha, thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1, betacyflutrin (800 mL.ha-1, imidacloprid (70 g.ha-1, diflubenzuron (6,0 g.ha-1, endosulfan (1500 mL.ha-1, em suas apresentações comerciais. A pulverização dos inseticidas foi efetuada aos 45 dias após a emergência das plantas. Além da avaliação prévia, foram efetuadas avaliações aos três e sete dias após a aplicação dos inseticidas. As amostragens foram realizadas através do método de batida de pano, com duas batidas ao acaso por parcela, identificando-se e contando-se, o número de inimigos naturais presentes. Três dias após a aplicação dos tratamentos, os inseticidas thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1 e diflubenzuron (60 g.ha-1, considerando os produtos comerciais, não apresentaram efeito de choque sobre o complexo de inimigos naturais presentes na cultura do algodoeiro. Entretanto, aos sete dias após a aplicação, apenas o tratamento com lufenuron manteve a seletividade.a esses artrópodes predadores.
PALAVRAS-CHAVE: Inseticida; controle biológico; Gossypium.
Idris, Ali
2010-12-01
A Cotton leaf crumple virus (CLCrV)-based gene silencing vector containing a fragment of the Gossypium hirsutum Magnesium chelatase subunit I was used to establish endogenous gene silencing in cotton of varied genetic backgrounds. Biolistic inoculation resulted in systemic and persistent photo-bleaching of the leaves and bolls of the seven cultivars tested, however, the intensity of silencing was variable. CLCrV-VIGS-mediated expression of green fluorescent protein was used to monitor the in planta distribution of the vector, indicating successful phloem invasion in all cultivars tested. Acala SJ-1, one of the cotton cultivars, was identified as a particularly optimal candidate for CLCrV-VIGS-based cotton reverse-genetics. © 2010 Elsevier Ltd.
Wang, Wei; Xia, Minxuan; Chen, Jie; Deng, Fenni; Yuan, Rui; Zhang, Xiaopei; Shen, Fafu
2016-12-01
The data presented in this paper is supporting the research article "Genome-Wide Analysis of Superoxide Dismutase Gene Family in Gossypium raimondii and G. arboreum" [1]. In this data article, we present phylogenetic tree showing dichotomy with two different clusters of SODs inferred by the Bayesian method of MrBayes (version 3.2.4), "Bayesian phylogenetic inference under mixed models" [2], Ramachandran plots of G. raimondii and G. arboreum SODs, the protein sequence used to generate 3D sructure of proteins and the template accession via SWISS-MODEL server, "SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information." [3] and motif sequences of SODs identified by InterProScan (version 4.8) with the Pfam database, "Pfam: the protein families database" [4].
Directory of Open Access Journals (Sweden)
A. Zare Feizabadi
2016-04-01
Full Text Available In order to compare of ecological management of weed control on economical income, yield and yield components of cotton (Gossypium hirsutum L., a Randomized Complete Block design with 12 treatments and four replications was conducted in Mahvelat of Khorasan Razavi province, Iran. Treatments consisted of weeding, harrowing, burning, two times weeding, weeding + harrowing, weeding + burning, harrowing + harrowing, harrowing + weeding, harrowing + burning, weeding+ harrowing+ burning, weed free and weedy as a check treatment. Investigated traits were plant height, number of boll in plant, 20 boll weight, 20 boll cotton lint weight, cotton lint yield per plant, cotton yield, number and biomass of weeds, outcome, net and gross income. The result showed that treatments had significant effect (p
Directory of Open Access Journals (Sweden)
Ruijuan Li
Full Text Available Reniform nematode is a semi-endoparasitic nematode species causing significant yield loss in numerous crops, including cotton (Gossypium hirsutum L.. An RNA-sequencing analysis was conducted to measure transcript abundance in reniform nematode susceptible (DP90 & SG747, resistant (BARBREN-713, and hypersensitive (LONREN-1 genotypes of cotton (Gossypium hirsutum L. with and without reniform nematode infestation. Over 90 million trimmed high quality reads were assembled into 84,711 and 80, 353 transcripts using the G. arboreum and the G. raimondii genomes as references. Many transcripts were significantly differentially expressed between the three different genotypes both prior to and during nematode pathogenesis, including transcripts corresponding to the gene ontology categories of cell wall, hormone metabolism and signaling, redox reactions, secondary metabolism, transcriptional regulation, stress responses, and signaling. Further analysis revealed that a number of these differentially expressed transcripts mapped to the G. raimondii and/or the G. arboreum genomes within 1 megabase of quantitative trait loci that had previously been linked to reniform nematode resistance. Several resistance genes encoding proteins known to be strongly linked to pathogen perception and resistance, including LRR-like and NBS-LRR domain-containing proteins, were among the differentially expressed transcripts mapping near these quantitative trait loci. Further investigation is required to confirm a role for these transcripts in reniform nematode susceptibility, hypersensitivity, and/or resistance. This study presents the first systemic investigation of reniform nematode resistance-associated genes using different genotypes of cotton. The candidate reniform nematode resistance-associated genes identified in this study can serve as the basis for further functional analysis and aid in further development of reniform a nematode resistant cotton germplasm.
Directory of Open Access Journals (Sweden)
Baohua Wang
2017-10-01
Full Text Available The molecular genetic basis of cotton fiber strength and fineness in crosses between Gossypium mustelinum and Gossypium hirsutum (Upland cotton was dissected using 21 BC3F2 and 12 corresponding BC3F2:3 and BC3F2:4 families. The BC3F2 families were genotyped with simple sequence repeat markers from a G. hirsutum by G. mustelinum linkage map, and the three generations of BC3-derived families were phenotyped for fiber strength (STR and fineness (Micronaire, MIC. A total of 42 quantitative trait loci (QTLs were identified through one-way analysis of variance, including 15 QTLs for STR and 27 for MIC, with the percentage of variance explained by individual loci averaging 13.86 and 14.06%, respectively. Eighteen of the 42 QTLs were detected at least twice near the same markers in different generations/families or near linked markers in the same family, and 28 of the 42 QTLs were identified in both mixed model-based composite interval mapping and one-way variance analyses. Alleles from G. mustelinum increased STR for eight of 15 and reduced MIC for 15 of 27 QTLs. Significant among-family genotypic effects (P < 0.001 were detected in 13 and 10 loci for STR and MIC respectively, and five loci showed significant (P < 0.001 genotype × family interaction for MIC. These results support the hypothesis that fiber quality improvement for Upland cotton could be realized by introgressing G. mustelinum alleles although complexities due to the different effects of genetic background on introgressed chromatin might be faced. Building on prior work with G. barbadense, G. tomentosum, and G. darwinii, QTL mapping involving introgression of G. mustelinum alleles offers new allelic variation to Upland cotton germplasm.
H.A., Reddy, K. and Pettigrew, W.T.
2018-01-01
The effects of cotton (Gossypium hirsutum L.): soybean [Glycine max (L.) Merr.] rotation on the soil fertility levels are limited. An irrigated soybean: cotton rotation experiment was conducted from 2012 through 2015 near Elizabeth, Mississippi, USA. The crop rotation sequences were included continuous cotton (CCCC), continuous soybean (SSSS), cotton-soybean-cotton-soybean (CSCS), cotton-soybean-soybean-cotton (CSSC), soybean-cotton-cotton-soybean (SCCS), soybean-cotton-soybean-cotton (SCSC)....
International Nuclear Information System (INIS)
Ali, M.A.; Alia, K.B.; Atif, R.M.; Rasulj, I.; Nadeem, H.U.; Shahid, A.; Azeem, F
2017-01-01
SQUAMOSA-Promoter Binding Proteins (SBP) are class of transcription factors that play vital role in regulation of plant tissue growth and development. The genes encoding these proteins have not yet been identified in diploid cotton. Thus here, a comprehensive genome wide analysis of SBP genes/proteins was carried out to identify the genes encoding SBP proteins in Gossypium raimondii and Arabidopsis thaliana. We identified 17 SBP genes from Arabidopsis thaliana genome and 30 SBP genes from Gossypium raimondii. Chromosome localization studies revealed the uneven distribution of SBP encoding genes both in the genomes of A. thaliana and G. raimondii. In cotton, five SBP genes were located on chromosome no. 2, while no gene was found on chromosome 9. In A. thaliana, maximum seven SBP genes were identified on chromosome 9, while chromosome 4 did not have any SBP gene. Thus, the SBP gene family might have expanded as a result of segmental as well as tandem duplications in these species. The comparative phylogenetic analysis of Arabidopsis and cotton SBPs revealed the presence of eight groups. The gene structure analysis of SBP encoding genes revealed the presence of one to eleven inrons in both Arabidopsis and G. raimondii. The proteins sharing the same phyletic group mostly demonstrated the similar intron-exon occurrence pattern; and share the common conserved domains. The SBP DNA-binding domain shared 24 absolutely conserved residues in Arabidopsis. The present study can serve as a base for the functional characterization of SBP gene family in Gossypium raimondii. (author)
Gan, Yimei; Liu, Fang; Chen, Dan; Wu, Qiong; Qin, Qin; Wang, Chunying; Li, Shaohui; Zhang, Xiangdi; Wang, Yuhong; Wang, Kunbo
2013-01-01
We investigated the locations of 5S and 45S rDNA in Gossypium diploid A, B, D, E, F, G genomes and tetraploid genome (AD) using multi-probe fluorescent in situ hybridization (FISH) for evolution analysis in Gossypium genus. The rDNA numbers and sizes, and synteny relationships between 5S and 45S were revealed using 5S and 45S as double-probe for all species, and the rDNA-bearing chromosomes were identified for A, D and AD genomes with one more probe that is single-chromosome-specific BAC clone from G. hirsutum (A1D1). Two to four 45S and one 5S loci were found in diploid-species except two 5S loci in G. incanum (E4), the same as that in tetraploid species. The 45S on the 7th and 9th chromosomes and the 5S on the 9th chromosomes seemed to be conserved in A, D and AD genomes. In the species of B, E, F and G genomes, the rDNA numbers, sizes, and synteny relationships were first reported in this paper. The rDNA pattern agrees with previously reported phylogenetic history with some disagreements. Combined with the whole-genome sequencing data from G. raimondii (D5) and the conserved cotton karyotype, it is suggested that the expansion, decrease and transposition of rDNA other than chromosome rearrangements might occur during the Gossypium evolution.
Directory of Open Access Journals (Sweden)
Jinping Hua
2017-05-01
Full Text Available Acetyl-CoA carboxylase is an important enzyme, which catalyzes acetyl-CoA’s carboxylation to produce malonyl-CoA and to serve as a committed step for de novo fatty acid biosynthesis in plastids. In this study, 24 putative cotton BCCP genes were identified based on the lately published genome data in Gossypium. Among them, 4, 4, 8, and 8 BCCP homologs were identified in Gossypium raimondii, G. arboreum, G. hirsutum, and G. barbadense, respectively. These genes were divided into two classes based on a phylogenetic analysis. In each class, these homologs were relatively conserved in gene structure and motifs. The chromosomal distribution pattern revealed that all the BCCP genes were distributed equally on corresponding chromosomes or scaffold in the four cotton species. Segmental duplication was a predominant duplication event in both of G. hirsutum and G. barbadense. The analysis of the expression profile showed that 8 GhBCCP genes expressed in all the tested tissues with changed expression levels, and GhBCCP genes belonging to class II were predominantly expressed in developing ovules. Meanwhile, the expression analysis for the 16 cotton BCCP genes from G. raimondii, G. arboreum and G. hirsutum showed that they were induced or suppressed by cold or salt stress, and their expression patterns varied among different tissues. These findings will help to determine the functional and evolutionary characteristics of the BCCP genes in Gossypium species.
Wang, Jun; Sun, Na; Deng, Ting; Zhang, Lida; Zuo, Kaijing
2014-11-06
Heat shock transcriptional factors (Hsfs) play important roles in the processes of biotic and abiotic stresses as well as in plant development. Cotton (Gossypium hirsutum, 2n=4x=(AD)2=52) is an important crop for natural fiber production. Due to continuous high temperature and intermittent drought, heat stress is becoming a handicap to improve cotton yield and lint quality. Recently, the related wild diploid species Gossypium raimondii genome (2n=2x=(D5)2=26) has been fully sequenced. In order to analyze the functions of different Hsfs at the genome-wide level, detailed characterization and analysis of the Hsf gene family in G. hirsutum is indispensable. EST assembly and genome-wide analyses were applied to clone and identify heat shock transcription factor (Hsf) genes in Upland cotton (GhHsf). Forty GhHsf genes were cloned, identified and classified into three main classes (A, B and C) according to the characteristics of their domains. Analysis of gene duplications showed that GhHsfs have occurred more frequently than reported in plant genomes such as Arabidopsis and Populus. Quantitative real-time PCR (qRT-PCR) showed that all GhHsf transcripts are expressed in most cotton plant tissues including roots, stems, leaves and developing fibers, and abundantly in developing ovules. Three expression patterns were confirmed in GhHsfs when cotton plants were exposed to high temperature for 1 h. GhHsf39 exhibited the most immediate response to heat shock. Comparative analysis of Hsfs expression differences between the wild-type and fiberless mutant suggested that Hsfs are involved in fiber development. Comparative genome analysis showed that Upland cotton D-subgenome contains 40 Hsf members, and that the whole genome of Upland cotton contains more than 80 Hsf genes due to genome duplication. The expression patterns in different tissues in response to heat shock showed that GhHsfs are important for heat stress as well as fiber development. These results provide an improved
He, Qiuling; Jones, Don C.; Li, Wei; Xie, Fuliang; Ma, Jun; Sun, Runrun; Wang, Qinglian; Zhu, Shuijin; Zhang, Baohong
2016-01-01
The R2R3-MYB is one of the largest families of transcription factors, which have been implicated in multiple biological processes. There is great diversity in the number of R2R3-MYB genes in different plants. However, there is no report on genome-wide characterization of this gene family in cotton. In the present study, a total of 205 putative R2R3-MYB genes were identified in cotton D genome (Gossypium raimondii), that are much larger than that found in other cash crops with fully sequenced genomes. These GrMYBs were classified into 13 groups with the R2R3-MYB genes from Arabidopsis and rice. The amino acid motifs and phylogenetic tree were predicted and analyzed. The sequences of GrMYBs were distributed across 13 chromosomes at various densities. The results showed that the expansion of the G. Raimondii R2R3-MYB family was mainly attributable to whole genome duplication and segmental duplication. Moreover, the expression pattern of 52 selected GrMYBs and 46 GaMYBs were tested in roots and leaves under different abiotic stress conditions. The results revealed that the MYB genes in cotton were differentially expressed under salt and drought stress treatment. Our results will be useful for determining the precise role of the MYB genes during stress responses with crop improvement. PMID:27009386
Anwaar, Shad Ali; Ali, Shafaqat; Ali, Skhawat; Ishaque, Wajid; Farid, Mujahid; Farooq, Muhammad Ahsan; Najeeb, Ullah; Abbas, Farhat; Sharif, Muhammad
2015-03-01
Silicon (Si) is as an important fertilizer element, which has been found effective in enhancing plant tolerance to variety of biotic and a-biotic stresses. This study investigates the Si potential to alleviate zinc (Zn) toxicity stress in cotton (Gossypium hirsutum L.). Cotton plants were grown in hydroponics and exposed to different Zn concentration, 0, 25, and 50 μM, alone and/or in combination with 1 mM Si. Incremental Zn concentration in growth media instigated the cellular oxidative damage that was evident from elevated levels of hydrogen peroxide (H2O2), electrolyte leakage, and malondialdehyde (MDA) and consequently inhibited cotton growth, biomass, chlorophyll pigments, and photosynthetic process. Application of Si significantly suppressed Zn accumulation in various plant parts, i.e., roots, stems, and leaves and thus promoted biomass, photosynthetic, growth parameters, and antioxidant enzymes activity of Zn-stressed as well unstressed plants. In addition, Si reduced the MDA and H2O2 production and electrolyte leakage suggesting its role in protecting cotton plants from Zn toxicity-induced oxidative damage. Thus, the study indicated that exogenous Si application could improve growth and development of cotton crop experiencing Zn toxicity stress by limiting Zn bioavailability and oxidative damage.
Shweta; Akhter, Yusuf; Khan, Jawaid Ahmad
2018-01-05
Cotton leaf curl Burewala virus (CLCuBV, genus Begomovirus) causes devastating cotton leaf curl disease. Among various known virus controlling strategies, RNAi-mediated one has shown potential to protect host crop plants. Micro(mi) RNAs, are the endogenous small RNAs and play a key role in plant development and stress resistance. In the present study we have identified cotton (Gossypium hirsutum)-encoded miRNAs targeting the CLCuBV. Based on threshold free energy and maximum complementarity scores of host miRNA-viral mRNA target pairs, a number of potential miRNAs were annotated. Among them, ghr-miR168 was selected as the most potent candidate, capable of targeting several vital genes namely C1, C3, C4, V1 and V2 of CLCuBV genome. In addition, ghr-miR395a and ghr-miR395d were observed to target the overlapping transcripts of C1 and C4 genes. We have verified the efficacy of these miRNA targets against CLCuBV following suppression of RNAi-mediated virus control through translational inhibition or cleavage of viral mRNA. Copyright © 2017 Elsevier B.V. All rights reserved.
Zhang, Feng; Zhu, Guozhong; Du, Lei; Shang, Xiaoguang; Cheng, Chaoze; Yang, Bing; Hu, Yan; Cai, Caiping; Guo, Wangzhen
2016-02-03
Cotton is an economically important crop throughout the world, and is a pioneer crop in salt stress tolerance research. Investigation of the genetic regulation of salinity tolerance will provide information for salt stress-resistant breeding. Here, we employed next-generation RNA-Seq technology to elucidate the salt-tolerant mechanisms in cotton using the diploid cotton species Gossypium davidsonii which has superior stress tolerance. A total of 4744 and 5337 differentially expressed genes (DEGs) were found to be involved in salt stress tolerance in roots and leaves, respectively. Gene function annotation elucidated salt overly sensitive (SOS) and reactive oxygen species (ROS) signaling pathways. Furthermore, we found that photosynthesis pathways and metabolism play important roles in ion homeostasis and oxidation balance. Moreover, our studies revealed that alternative splicing also contributes to salt-stress responses at the posttranscriptional level, implying its functional role in response to salinity stress. This study not only provides a valuable resource for understanding the genetic control of salt stress in cotton, but also lays a substantial foundation for the genetic improvement of crop resistance to salt stress.
Niu, Erli; Shang, Xiaoguang; Cheng, Chaoze; Bao, Jianghao; Zeng, Yanda; Cai, Caiping; Du, Xiongming; Guo, Wangzhen
2015-01-01
COBRA-Like (COBL) genes, which encode a plant-specific glycosylphosphatidylinositol (GPI) anchored protein, have been proven to be key regulators in the orientation of cell expansion and cellulose crystallinity status. Genome-wide analysis has been performed in A. thaliana, O. sativa, Z. mays and S. lycopersicum, but little in Gossypium. Here we identified 19, 18 and 33 candidate COBL genes from three sequenced cotton species, diploid cotton G. raimondii, G. arboreum and tetraploid cotton G. hirsutum acc. TM-1, respectively. These COBL members were anchored onto 10 chromosomes in G. raimondii and could be divided into two subgroups. Expression patterns of COBL genes showed highly developmental and spatial regulation in G. hirsutum acc. TM-1. Of them, GhCOBL9 and GhCOBL13 were preferentially expressed at the secondary cell wall stage of fiber development and had significantly co-upregulated expression with cellulose synthase genes GhCESA4, GhCESA7 and GhCESA8. Besides, GhCOBL9 Dt and GhCOBL13 Dt were co-localized with previously reported cotton fiber quality quantitative trait loci (QTLs) and the favorable allele types of GhCOBL9 Dt had significantly positive correlations with fiber quality traits, indicating that these two genes might play an important role in fiber development. PMID:26710066
Liu, Xia; Zhao, Bo; Zheng, Hua-Jun; Hu, Yan; Lu, Gang; Yang, Chang-Qing; Chen, Jie-Dan; Chen, Jun-Jian; Chen, Dian-Yang; Zhang, Liang; Zhou, Yan; Wang, Ling-Jian; Guo, Wang-Zhen; Bai, Yu-Lin; Ruan, Ju-Xin; Shangguan, Xiao-Xia; Mao, Ying-Bo; Shan, Chun-Min; Jiang, Jian-Ping; Zhu, Yong-Qiang; Jin, Lei; Kang, Hui; Chen, Shu-Ting; He, Xu-Lin; Wang, Rui; Wang, Yue-Zhu; Chen, Jie; Wang, Li-Jun; Yu, Shu-Ting; Wang, Bi-Yun; Wei, Jia; Song, Si-Chao; Lu, Xin-Yan; Gao, Zheng-Chao; Gu, Wen-Yi; Deng, Xiao; Ma, Dan; Wang, Sen; Liang, Wen-Hua; Fang, Lei; Cai, Cai-Ping; Zhu, Xie-Fei; Zhou, Bao-Liang; Jeffrey Chen, Z; Xu, Shu-Hua; Zhang, Yu-Gao; Wang, Sheng-Yue; Zhang, Tian-Zhen; Zhao, Guo-Ping; Chen, Xiao-Ya
2015-09-30
Of the two cultivated species of allopolyploid cotton, Gossypium barbadense produces extra-long fibers for the production of superior textiles. We sequenced its genome (AD)2 and performed a comparative analysis. We identified three bursts of retrotransposons from 20 million years ago (Mya) and a genome-wide uneven pseudogenization peak at 11-20 Mya, which likely contributed to genomic divergences. Among the 2,483 genes preferentially expressed in fiber, a cell elongation regulator, PRE1, is strikingly At biased and fiber specific, echoing the A-genome origin of spinnable fiber. The expansion of the PRE members implies a genetic factor that underlies fiber elongation. Mature cotton fiber consists of nearly pure cellulose. G. barbadense and G. hirsutum contain 29 and 30 cellulose synthase (CesA) genes, respectively; whereas most of these genes (>25) are expressed in fiber, genes for secondary cell wall biosynthesis exhibited a delayed and higher degree of up-regulation in G. barbadense compared with G. hirsutum, conferring an extended elongation stage and highly active secondary wall deposition during extra-long fiber development. The rapid diversification of sesquiterpene synthase genes in the gossypol pathway exemplifies the chemical diversity of lineage-specific secondary metabolites. The G. barbadense genome advances our understanding of allopolyploidy, which will help improve cotton fiber quality.
Directory of Open Access Journals (Sweden)
Huma Lubna Shaheen and Muhammad Shahbaz
2012-11-01
Full Text Available Salinity is a multidimensional stress affecting crop yield and productivity at various levels of plant organization. To assess salt induced adverse effects on cotton (Gossypium hirsutum L., ten cultivars were grown in sand culture supplemented with full strength Hoagland’s nutrients solutions and different salt concentrations (0, 50, 100 and 200 mM NaCl. Salt stress markedly reduced growth attributes, relative water contents, efficiency of photosystem II, net CO2 assimilation rate (A, transpiration rate (E and stomatal conductance in all cultivars. Reduction was maximum at the highest level of salt stress i.e. 200 mM. However, response of cotton cultivars was variable to various levels of salinity and even at various developmental stages. Cultivars RH-510, BH-118 and MNH-770 were ranked as relatively salt tolerant on the basis of their better growth performance and net CO2 assimilation rate whereas cvs. CIM-496, CIM-473 and FH-901 were relatively salt sensitive. Cultivars RH-510, BH-118 and MNH-770 exhibited high shoot fresh and dry weights, photosynthetic rate (A, and Photosystem II (Fv/Fm efficiency at both seedling and maturity growth stages. Results suggest that selection of plants having high photosynthetic rate and biomass at seedling stage may be a good source of high yield at mature stage of growth.
Xiao, Yanqing; Chen, Yanli; Ding, Yanpeng; Wu, Jie; Wang, Peng; Yu, Ya; Wei, Xi; Wang, Ye; Zhang, Chaojun; Li, Fuguang; Ge, Xiaoyang
2018-05-01
The WUSCHEL (WUS) gene encodes a plant-specific homeodomain-containing transcriptional regulator, which plays important roles during embryogenesis, as well as in the formation of shoot and flower meristems. Here, we isolated two homologues of Arabidopsis thaliana WUS (AtWUS), GhWUS1a_At and GhWUS1b_At, from upland cotton (Gossypium hirsutum). Domain analysis suggested that the two putative GhWUS proteins contained a highly conserved DNA-binding HOX domain and a WUS-box. Expression profile analysis showed that GhWUSs were predominantly expressed during the embryoid stage. Ectopic expression of GhWUSs in Arabidopsis could induce somatic embryo and shoot formation from seedling root tips. Furthermore, in the absence of exogenous hormone, overexpression of GhWUSs in Arabidopsis could promote shoot regeneration from excised roots, and in the presence of exogenous auxin, excised roots expressing GhWUS could be induced to produce somatic embryo. In addition, expression of the chimeric GhWUS repressor in cotton callus inhibited embryogenic callus formation. Our results show that GhWUS is an important regulator of somatic embryogenesis and shoot regeneration. Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Wenbo Shan
2016-08-01
Full Text Available Cotton is the world's most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45S and 5S rDNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.
Directory of Open Access Journals (Sweden)
Changwei Bi
2016-01-01
Full Text Available Cotton is one of the most important economic crops and the primary source of natural fiber and is an important protein source for animal feed. The complete nuclear and chloroplast (cp genome sequences of G. raimondii are already available but not mitochondria. Here, we assembled the complete mitochondrial (mt DNA sequence of G. raimondii into a circular genome of length of 676,078 bp and performed comparative analyses with other higher plants. The genome contains 39 protein-coding genes, 6 rRNA genes, and 25 tRNA genes. We also identified four larger repeats (63.9 kb, 10.6 kb, 9.1 kb, and 2.5 kb in this mt genome, which may be active in intramolecular recombination in the evolution of cotton. Strikingly, nearly all of the G. raimondii mt genome has been transferred to nucleus on Chr1, and the transfer event must be very recent. Phylogenetic analysis reveals that G. raimondii, as a member of Malvaceae, is much closer to another cotton (G. barbadense than other rosids, and the clade formed by two Gossypium species is sister to Brassicales. The G. raimondii mt genome may provide a crucial foundation for evolutionary analysis, molecular biology, and cytoplasmic male sterility in cotton and other higher plants.
International Nuclear Information System (INIS)
Munis, M.F.H.; Tu, L.; Ziaf, K; Tan, J.; Deng, F.; Zhang, X.
2010-01-01
Salinity affects the germination, growth and ultimately the yield of cotton (Gossypium hirsutum L.) which demands reliable traits for the evaluation and selection of salt tolerant cultivars. Here, ten major osmotic, ionic and physiological parameters have been studied to distinguish the effect of salinity in two different cultivars of cotton. Plants were grown in hydroponic system and exposed to different salinity levels of NaCl followed by its recovery under non saline conditions. Data was recorded at three different stages i.e., before stress, after stress and after recovery for comparative study. Recovery assay proved to be very helpful in extracting reliable results. Both cultivars showed significantly different response to Na+ and K+ accumulation and phenotypically salt tolerant cultivar (Coker 312) accumulated less Na+ and more K+ in comparison with susceptible (Simian 3). Decrease in leaf area, seed germination and seedling growth were also conclusive to differentiate these cultivars. We also found other physiological parameters like relative leaf water content (RLWC), plant fresh-weight (PFW), plant dry-weight (PDW), relative growth rate (RGR) and stomatal behavior as good indicators of salinity but could not find their significant role to differentiate two closely relevant cultivars regarding salinity tolerance. Our studies revealed that proline accumulation and chlorophyll concentration are not significant to be used as accurate indicators to characterize the sensitivity of cotton cultivars to salinity. We found post-recovery analysis to be very useful in understanding the role and behavior of different indicators of salinity. (author)
Directory of Open Access Journals (Sweden)
Rehman Iqra
2017-01-01
Full Text Available Cotton Leaf Curl Disease (CLCuD is one of the threatening constrains of cotton production in Pakistan for which no adequate remedy is available until now. Local variety of Gossypium hirsutum (FH-142 was grown in field and infected naturally by CLCuV under variable range of temperature and humidity. Plants showed thickening of veins in lower leaf surface at 34°C and 60% relative humidity at 15days post infection (dpi and curling of leaf margins at 33°C with 58% relative humidity at 30dpi. Remarkable leaf darkening was observed with reduced boll formation at 45dpi at 26°C and 41% relative humidity. Enation developed, severe thickening and curling of leaves intensified and plants showed dwarf growth at 60dpi at 24°C with 52% relative humidity. PCR amplification of Rep associated gene confirmed the presence of CLCuD-associated begomovirus in the infected samples. Quantitative RT-PCR confirmed the amplification and differential expression of a number of pathogen stress responsive genes at different levels of temperature and humidity. This observation predicts that Cotton Leaf Curl Virus (CLCuV interacts with several host genes that are upregulated to make plants susceptible or suppress other genes to overcome host defense responses.
Propagación clonal in vitro y enraizamiento de estacas de algodón nativo (Gossypium barbadense L.
Directory of Open Access Journals (Sweden)
Consuelo Rojas-Idrogo
2013-12-01
Full Text Available En este trabajo se evalúo el efecto de reguladores de crecimiento en la propagación clonal in vitro y el efecto de diferentes soluciones nutritivas y reguladores de crecimiento en el enraizamiento de estacas de algodón (Gossypium barbadense. En el enraizamiento se evaluó el efecto del agua corriente, las soluciones nutritivas de Knop y Knudson y los reguladores de crecimiento AIA, AIB y floroglucinol sobre estacas obtenidas de las zonas apical, media y basal de la planta. En la combinación ANA 0.1 mg/lt - BAP 1.0 y 2.0 mg/lt, después de 30 días de cultivo in vitro, se alcanzó la mayor elongación de brotes (38.1 y 30.7 mm y número de nudos formados (4.1 y 3.4; el mejor enraizamiento se observó con AIA 0.2 mg/lt formando 3.6 raíces. El enraizamiento de estacas, con brotes formados (40 y 50%, fue mayor cuando se utilizó el tercio medio y superior, tanto en agua corriente como en la solución de Knop y únicamente suplementados con AIB 25 y 50 mg/lt.
Institute of Scientific and Technical Information of China (English)
Wenbo; Shan; Yanqin; Jiang; Jinlei; Han; Kai; Wang
2016-01-01
Cotton is the world’s most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45 S and 5S r DNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.
Zahoor, Rizwan; Zhao, Wenqing; Dong, Haoran; Snider, John L; Abid, Muhammad; Iqbal, Babar; Zhou, Zhiguo
2017-10-01
To investigate whether potassium (K) application enhances the potential of cotton (Gossypium hirsutum L.) plants to maintain physiological functions during drought and recovery, low K-sensitive (Siza 3) and -tolerant (Simian 3) cotton cultivars were exposed to three K rates (0, 150, and 300 K 2 O kg ha -1 ) and either well-watered conditions or severe drought stress followed by a recovery period. Under drought stress, cotton plants showed a substantial decline in leaf water potential, stomatal conductance, photosynthetic rate, and the maximum and actual quantum yield of PSII, resulting in greater non-photochemical quenching and lipid peroxidation as compared to well-watered plants. However, plants under K application not only showed less of a decline in these traits but also displayed greater potential to recover after rewatering as compared to the plants without K application. Plants receiving K application showed lower lipid peroxidation, higher antioxidant enzyme activities, and increased proline accumulation as compared to plants without K application. Significant relationships between rates of photosynthetic recovery and K application were observed. The cultivar Siza 3 exhibited a more positive response to K application than Simian 3. The results suggest that K application enhances the cotton plant's potential to maintain functionality under drought and facilitates recovery after rewatering. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Roy, K.; Zwieniecki, M.
2017-12-01
Cotton (Gossypium hirsutum L.) is relatively drought resistant and thus is planted widely in many semi-arid and arid parts of the world, many of which are usually deprived of modern water management technologies. Since the productivity of cotton plants depends on water availability, we carried out the present research aiming at testing two different low cost and arid-environment friendly water efficient techniques: application of particle film technology on leaves to reduce the transpiration rate (kaolin dust), and use of organic material to improve the soil water holding capacity (cotton wool). In details, kaolin (3% and 5%; weight:volume) mixed in water was sprayed on the upper surface of the leaves of young plants, and small amounts of cotton wool (0.1%, 0.3% and 0.5%; weight:weight) were mixed into the soils. The study showed that kaolin spray was useful as a transpiration reducing agent only if plants have adequate water in the soil (well irrigated) but not under water stress conditions. In addition, mixing a small amount of cotton wool into the soil can significantly increase the amount of water available to the plants, and extend the benefit of kaolin application on plants.
Directory of Open Access Journals (Sweden)
Jinhuan Pang
Full Text Available Gossypiumbarbadense is a cultivated cotton species and possesses many desirable traits, including high fiber quality and resistance to pathogens, especially Verticilliumdahliae (a devastating pathogen of Gossypium hirsutum, the main cultivated species. These elite traits are difficult to be introduced into G. hirsutum through classical breeding methods. In addition, genetic transformation of G. barbadense has not been successfully performed. It is therefore important to develop methods for evaluating the function and molecular mechanism of genes in G. barbadense. In this study, we had successfully introduced a virus-induced gene silencing (VIGS system into three cultivars of G. barbadense by inserting marker genes into the tobacco rattle virus (TRV vector. After we optimized the VIGS conditions, including light intensity, photoperiod, seedling age and Agrobacterium strain, 100% of plants agroinfiltrated with the GaPDS silencing vector showed white colored leaves. Three other marker genes, GaCLA1, GaANS and GaANR, were employed to further test this VIGS system in G. barbadense. The transcript levels of the endogenous genes in the silenced plants were reduced by more than 99% compared to control plants; these plants presented phenotypic symptoms 2 weeks after inoculation. We introduced a fusing sequence fragment of GaPDS and GaANR gene silencing vectors into a single plant, which resulted in both photobleaching and brownish coloration. The extent of silencing in plants agroinfiltrated with fusing two-gene-silencing vector was consistent with plants harboring a single gene silencing vector. The development of this VIGS system should promote analysis of gene function in G. barbadense, and help to contribute desirable traits for breeding of G. barbadense and G. hirsutum.
Fan, Xinqi; Guo, Qi; Xu, Peng; Gong, YuanYong; Shu, Hongmei; Yang, Yang; Ni, Wanchao; Zhang, Xianggui; Shen, Xinlian
2015-01-01
WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs) in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III), as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.
Directory of Open Access Journals (Sweden)
Xinqi Fan
Full Text Available WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III, as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.
Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen
2011-04-01
Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.
Hulse-Kemp, Amanda M; Ashrafi, Hamid; Zheng, Xiuting; Wang, Fei; Hoegenauer, Kevin A; Maeda, Andrea B V; Yang, S Samuel; Stoffel, Kevin; Matvienko, Marta; Clemons, Kimberly; Udall, Joshua A; Van Deynze, Allen; Jones, Don C; Stelly, David M
2014-10-30
Cotton (Gossypium spp.) is the largest producer of natural fibers for textile and is an important crop worldwide. Crop production is comprised primarily of G. hirsutum L., an allotetraploid. However, elite cultivars express very small amounts of variation due to the species monophyletic origin, domestication and further bottlenecks due to selection. Conversely, wild cotton species harbor extensive genetic diversity of prospective utility to improve many beneficial agronomic traits, fiber characteristics, and resistance to disease and drought. Introgression of traits from wild species can provide a natural way to incorporate advantageous traits through breeding to generate higher-producing cotton cultivars and more sustainable production systems. Interspecific introgression efforts by conventional methods are very time-consuming and costly, but can be expedited using marker-assisted selection. Using transcriptome sequencing we have developed the first gene-associated single nucleotide polymorphism (SNP) markers for wild cotton species G. tomentosum, G. mustelinum, G. armourianum and G. longicalyx. Markers were also developed for a secondary cultivated species G. barbadense cv. 3-79. A total of 62,832 non-redundant SNP markers were developed from the five wild species which can be utilized for interspecific germplasm introgression into cultivated G. hirsutum and are directly associated with genes. Over 500 of the G. barbadense markers have been validated by whole-genome radiation hybrid mapping. Overall 1,060 SNPs from the five different species have been screened and shown to produce acceptable genotyping assays. This large set of 62,832 SNPs relative to cultivated G. hirsutum will allow for the first high-density mapping of genes from five wild species that affect traits of interest, including beneficial agronomic and fiber characteristics. Upon mapping, the markers can be utilized for marker-assisted introgression of new germplasm into cultivated cotton and in
Wei, Hengling; Li, Wei; Sun, Xiwei; Zhu, Shuijin; Zhu, Jun
2013-01-01
Plant disease resistance genes are a key component of defending plants from a range of pathogens. The majority of these resistance genes belong to the super-family that harbors a Nucleotide-binding site (NBS). A number of studies have focused on NBS-encoding genes in disease resistant breeding programs for diverse plants. However, little information has been reported with an emphasis on systematic analysis and comparison of NBS-encoding genes in cotton. To fill this gap of knowledge, in this study, we identified and investigated the NBS-encoding resistance genes in cotton using the whole genome sequence information of Gossypium raimondii. Totally, 355 NBS-encoding resistance genes were identified. Analyses of the conserved motifs and structural diversity showed that the most two distinct features for these genes are the high proportion of non-regular NBS genes and the high diversity of N-termini domains. Analyses of the physical locations and duplications of NBS-encoding genes showed that gene duplication of disease resistance genes could play an important role in cotton by leading to an increase in the functional diversity of the cotton NBS-encoding genes. Analyses of phylogenetic comparisons indicated that, in cotton, the NBS-encoding genes with TIR domain not only have their own evolution pattern different from those of genes without TIR domain, but also have their own species-specific pattern that differs from those of TIR genes in other plants. Analyses of the correlation between disease resistance QTL and NBS-encoding resistance genes showed that there could be more than half of the disease resistance QTL associated to the NBS-encoding genes in cotton, which agrees with previous studies establishing that more than half of plant resistance genes are NBS-encoding genes. PMID:23936305
Fawzy, Manal; Nasr, Mahmoud; Nagy, Heba; Helmi, Shacker
2018-02-01
In this study, batch biosorption experiments were conducted to determine the removal efficiency of Cd(II) ion from aqueous solutions by Gossypium barbadense waste. The biosorbent was characterized by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM) connected with energy dispersive X-ray (EDX). The sorption mechanism was described by complexation/chelation of Cd 2+ with the functional groups of O-H, C=O, -COO-, and C-O, as well as, cation-exchange with Mg 2+ and K + . At initial Cd(II) ion concentration (C o ), 50 mg/L, the adsorption equilibrium of 89.2% was achieved after 15 min under the optimum experimental factors of pH 6.0, biosorbent dosage 10 g/L, and particle diameter 0.125-0.25 mm. Both Langmuir and Freundlich models fitted well to the sorption data, suggesting the co-existence of monolayer coverage along with heterogenous surface biosorption. Artificial neural network (ANN) with a structure of 5-10-1 was performed to predict the Cd(II) ion removal efficiency. The ANN model provided high fit (R 2 0.923) to the experimental data and indicated that C o was the most influential input. A pure-quadratic model was developed to determine the effects of experimental factors on Cd(II) ion removal efficiency, which indicated the limiting nature of pH and biosorbent dosage on Cd(II) adsorption. Based on the regression model (R 2 0.873), the optimum experimental factors were pH 7.61, biosorbent dosage 24.74 g/L, particle size 0.125-0.25 mm, and adsorption time 109.77 min, achieving Cd 2+ removal of almost 100% at C o 50 mg/L.
Ganesan, M; Jayabalan, N
2004-10-01
Somatic embryogenesis in cotton (Gossypium hirsutum L.) is accelerated when the plant regeneration medium is supplemented with haemoglobin (erythrogen). In cotton SVPR 2 lines, a higher frequency of embryoid formation was observed when the medium contained 400 mg/l haemoglobin. Fresh weight of the callus, rate of embryoid induction, number of embryoids formed and the percentage of plant regeneration from somatic embryos were increased. Among the two different cultivars tested, MCU 11 showed no response to the presence of haemoglobin when compared to SVPR 2, and embryogenic callus formation was completely absent in the former. Medium containing MS salts, 100 mg/l myo-inositol , 0.3 mg/l thiamine-HCL, 0.3 mg/l Picloram (PIC), 0.1 mg/l kinetin and 400 mg/l haemoglobin effected a better response with respect to embryogenic callus induction. After 8 weeks of culture, a high frequency of embryoid induction was observed on medium containing MS basal salts, 100 mg/l myo-inositol, 0.3 mg/l PIC , 0.1 mg/l isopentenyl adenine, 1.0 g/l NH4NO3 and 400 mg/l haemoglobin. Plant regeneration was observed in 75.8% of the mature somatic embryos, and whole plant regeneration was achieved within 6-7 months of culture. The regenerated plantlets were fertile and similar to in vivo-grown, seed-derived plants except that they were phenotypically smaller. A positive influence of haemoglobin was observed at concentrations up to 400 mg/l at all stages of somatic embryogenesis. The increase in the levels of antioxidant enzyme activities, for example superoxide dismutase and peroxidase, indicated the presence of excess oxygen uptake and the stressed condition of the plant tissues that arose from haemoglobin supplementation. This increased oxygen uptake and haemoglobin-mediated stress appeared to accelerate somatic embryogenesis in cotton.
Directory of Open Access Journals (Sweden)
Di Chen
Full Text Available Speciation is always a contentious and challenging issue following with the presence of gene flow. In Gossypium, there are many valuable resources and wild diploid cotton especially C and B genome species possess some excellent traits which cultivated cotton always lacks. In order to explore character transferring rule from wild cotton to upland tetraploid cotton, the [G. capitis-viridis × (G. hirsutum × G. australe2] triple hybrid was synthesized by interspecies hybridization and chromosome doubling. Morphology comparisons were measured among this hybrid and its parents. It showed that trispecific hybrid F1 had some intermediate morphological characters like leaf style between its parents and some different characters from its parents, like crawl growth characteristics and two kind flower color. It is highly resistant to insects comparing with other cotton species by four year field investigation. By cytogenetic analysis, triple hybrid was further confirmed by meiosis behavior of pollen mother cells. Comparing with regular meiosis of its three parents, it was distinguished by the occurrence of polyads with various numbers of unbalanced microspores and finally generating various abnormal pollen grains. All this phenomenon results in the sterility of this hybrid. This hybrid was further identified by SSR marker from DNA molecular level. It showed that 98 selected polymorphism primers amplified effective bands in this hybrids and its parents. The genetic proportion of three parents in this hybrid is 47.8% from G. hirsutum, 14.3% from G. australe, 7.0% from G. capitis-viridis, and 30.9% recombination bands respectively. It was testified that wild genetic material has been transferred into cultivated cotton and this new germplasm can be incorporated into cotton breeding program.
Directory of Open Access Journals (Sweden)
Qian Yan
Full Text Available Basic/helix-loop-helix (bHLH proteins comprise one of the largest transcription factor families and play important roles in diverse cellular and molecular processes. Comprehensive analyses of the composition and evolution of the bHLH family in cotton are essential to elucidate their functions and the molecular basis of cotton development. By searching bHLH homologous genes in sequenced diploid cotton genomes (Gossypium raimondii and G. arboreum, a set of cotton bHLH reference genes containing 289 paralogs were identified and named as GobHLH001-289. Based on their phylogenetic relationships, these cotton bHLH proteins were clustered into 27 subfamilies. Compared to those in Arabidopsis and cacao, cotton bHLH proteins generally increased in number, but unevenly in different subfamilies. To further uncover evolutionary changes of bHLH genes during tetraploidization of cotton, all genes of S5a and S5b subfamilies in upland cotton and its diploid progenitors were cloned and compared, and their transcript profiles were determined in upland cotton. A total of 10 genes of S5a and S5b subfamilies (doubled from A- and D-genome progenitors maintained in tetraploid cottons. The major sequence changes in upland cotton included a 15-bp in-frame deletion in GhbHLH130D and a long terminal repeat retrotransposon inserted in GhbHLH062A, which eliminated GhbHLH062A expression in various tissues. The S5a and S5b bHLH genes of A and D genomes (except GobHLH062 showed similar transcription patterns in various tissues including roots, stems, leaves, petals, ovules, and fibers, while the A- and D-genome genes of GobHLH110 and GobHLH130 displayed clearly different transcript profiles during fiber development. In total, this study represented a genome-wide analysis of cotton bHLH family, and revealed significant changes in sequence and expression of these genes in tetraploid cottons, which paved the way for further functional analyses of bHLH genes in the cotton genus.
Lee, Mi-Kyung; Zhang, Yang; Zhang, Meiping; Goebel, Mark; Kim, Hee Jin; Triplett, Barbara A; Stelly, David M; Zhang, Hong-Bin
2013-03-28
Cotton, one of the world's leading crops, is important to the world's textile and energy industries, and is a model species for studies of plant polyploidization, cellulose biosynthesis and cell wall biogenesis. Here, we report the construction of a plant-transformation-competent binary bacterial artificial chromosome (BIBAC) library and comparative genome sequence analysis of polyploid Upland cotton (Gossypium hirsutum L.) with one of its diploid putative progenitor species, G. raimondii Ulbr. We constructed the cotton BIBAC library in a vector competent for high-molecular-weight DNA transformation in different plant species through either Agrobacterium or particle bombardment. The library contains 76,800 clones with an average insert size of 135 kb, providing an approximate 99% probability of obtaining at least one positive clone from the library using a single-copy probe. The quality and utility of the library were verified by identifying BIBACs containing genes important for fiber development, fiber cellulose biosynthesis, seed fatty acid metabolism, cotton-nematode interaction, and bacterial blight resistance. In order to gain an insight into the Upland cotton genome and its relationship with G. raimondii, we sequenced nearly 10,000 BIBAC ends (BESs) randomly selected from the library, generating approximately one BES for every 250 kb along the Upland cotton genome. The retroelement Gypsy/DIRS1 family predominates in the Upland cotton genome, accounting for over 77% of all transposable elements. From the BESs, we identified 1,269 simple sequence repeats (SSRs), of which 1,006 were new, thus providing additional markers for cotton genome research. Surprisingly, comparative sequence analysis showed that Upland cotton is much more diverged from G. raimondii at the genomic sequence level than expected. There seems to be no significant difference between the relationships of the Upland cotton D- and A-subgenomes with the G. raimondii genome, even though G
Directory of Open Access Journals (Sweden)
Giband Marc
2010-06-01
Full Text Available Abstract Background Cotton fibers (produced by Gossypium species are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb and G. hirsutum (Gh, differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh × Gb recombinant inbred line (RIL population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. Results The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2, 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes where an effective co-localization of unidirectional (similar sign of additivity QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Conclusions Meta-analysis provided a reliable means of integrating phenotypic and
Lacape, Jean-Marc; Llewellyn, Danny; Jacobs, John; Arioli, Tony; Becker, David; Calhoun, Steve; Al-Ghazi, Yves; Liu, Shiming; Palaï, Oumarou; Georges, Sophie; Giband, Marc; de Assunção, Henrique; Barroso, Paulo Augusto Vianna; Claverie, Michel; Gawryziak, Gérard; Jean, Janine; Vialle, Michèle; Viot, Christopher
2010-06-28
Cotton fibers (produced by Gossypium species) are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb) and G. hirsutum (Gh), differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh x Gb recombinant inbred line (RIL) population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2), 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents) and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes) where an effective co-localization of unidirectional (similar sign of additivity) QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Meta-analysis provided a reliable means of integrating phenotypic and genetic mapping data across multiple populations and
Energy Technology Data Exchange (ETDEWEB)
Gennadios, Heather A.; Gonzalez, Veronica; Di Costanzo, Luigi; Li, Amang; Yu, Fanglei; Miller, David J.; Allemann, Rudolf K.; Christianson, David W.; (UPENN); (Cardiff); (UC)
2009-09-11
(+)-{delta}-Cadinene synthase (DCS) from Gossypium arboreum (tree cotton) is a sesquiterpene cyclase that catalyzes the cyclization of farnesyl diphosphate in the first committed step of the biosynthesis of gossypol, a phytoalexin that defends the plant from bacterial and fungal pathogens. Here, we report the X-ray crystal structure of unliganded DCS at 2.4 {angstrom} resolution and the structure of its complex with three putative Mg{sup 2+} ions and the substrate analogue inhibitor 2-fluorofarnesyl diphosphate (2F-FPP) at 2.75 {angstrom} resolution. These structures illuminate unusual features that accommodate the trinuclear metal cluster required for substrate binding and catalysis. Like other terpenoid cyclases, DCS contains a characteristic aspartate-rich D{sup 307}DTYD{sup 311} motif on helix D that interacts with Mg{sub A}{sup 2+} and Mg{sub C}{sup 2+}. However, DCS appears to be unique among terpenoid cyclases in that it does not contain the 'NSE/DTE' motif on helix H that specifically chelates Mg{sub B}{sup 2+}, which is usually found as the signature sequence (N,D)D(L,I,V)X(S,T)XXXE (boldface indicates Mg{sub B}{sup 2+} ligands). Instead, DCS contains a second aspartate-rich motif, D{sup 451}DVAE{sup 455}, that interacts with Mg{sub B}{sup 2+}. In this regard, DCS is more similar to the isoprenoid chain elongation enzyme farnesyl diphosphate synthase, which also contains two aspartate-rich motifs, rather than the greater family of terpenoid cyclases. Nevertheless, the structure of the DCS-2F-FPP complex shows that the structure of the trinuclear magnesium cluster is generally similar to that of other terpenoid cyclases despite the alternative Mg{sub B}{sup 2+} binding motif. Analyses of DCS mutants with alanine substitutions in the D{sup 307}DTYD{sup 311} and D{sup 451}DVAE{sup 455} segments reveal the contributions of these segments to catalysis.
Akmal, Mohd; Baig, Mirza S; Khan, Jawaid A
2017-12-10
Cotton leaf curl disease (CLCuD), a major factor resulting in the enormous yield losses in cotton crop, is caused by a distinct monopartite begomovirus in association with Cotton leaf curl Multan betasatellite (CLCuMB). Micro(mi)RNAs are known to regulate gene expression in eukaryotes, including antiviral defense in plants. In a previous study, we had computationally identified a set of cotton miRNAs, which were shown to have potential targets in the genomes of Cotton leaf curl Multan virus (CLCuMuV) and CLCuMB at multiple loci. In the current study, effect of Gossypium arboreum-encoded miRNAs on the genome of CLCuMuV and CLCuMB was investigated in planta. Two computationally predicted cotton-encoded miRNAs (miR398 and miR2950) that showed potential to bind multiple Open Reading Frames (ORFs; C1, C4, V1, and non- coding intergenic region) of CLCuMuV, and (βC1) of CLCuMB were selected. Functional validation of miR398 and miR2950 was done by overexpression approach in G. hirsutum var. HS6. A total of ten in vitro cotton plants were generated from independent events and subjected to biological and molecular analyses. Presence of the respective Precursor (pre)-miRNA was confirmed through PCR and Southern blotting, and their expression level was assessed by semi quantitative RT-PCR, Real Time quantitative PCR and northern hybridization in the PCR-positive lines. Southern hybridization revealed 2-4 copy integration of T-DNA in the genome of the transformed lines. Remarkably, expression of pre-miRNAs was shown up to 5.8-fold higher in the transgenic (T 0 ) lines as revealed by Real Time PCR. The virus resistance was monitored following inoculation of the transgenic cotton lines with viruliferous whitefly (Bemisia tabaci) insect vector. After inoculation, four of the transgenic lines remained apparently symptom free. While a very low titre of viral DNA could be detected by Rolling circle amplification, betasatellite responsible for symptom induction could not be detected
Cotton (Gossypium hirsutum L.).
Rathore, Keerti S; Campbell, LeAnne M; Sherwood, Shanna; Nunes, Eugenia
2015-01-01
Cotton continues to be a crop of great economic importance in many developing and some developed countries. Cotton plants expressing the Bt gene to deter some of the major pests have been enthusiastically and widely accepted by the farmers in three of the major producing countries, i.e., China, India, and the USA. Considering the constraints related to its production and the wide variety of products derived from the cotton plant, it offers several target traits that can be improved through genetic engineering. Thus, there is a great need to accelerate the application of biotechnological tools for cotton improvement. This requires a simple, yet robust gene delivery/transformant recovery system. Recently, a protocol, involving large-scale, mechanical isolation of embryonic axes from germinating cottonseeds followed by direct transformation of the meristematic cells has been developed by an industrial laboratory. However, complexity of the mechanical device and the patent restrictions are likely to keep this method out of reach of most academic laboratories. In this chapter, we describe the method developed in our laboratory that has undergone further refinements and involves Agrobacterium-mediated transformation of cotton cells, selection of stable transgenic callus lines, and recovery of plants via somatic embryogenesis.
Indian Academy of Sciences (India)
dell
Improvement of cotton fiber yield and quality is challenging due to the narrow ... The polymorphic information content (PIC) values ranged from 0.371 to ... Several DNA marker systems have been developed and applied to assess the genetic.
(Gossypium barbadense) germplasm resources
Indian Academy of Sciences (India)
QI MA
and JILIAN LI1∗. 1Cotton Research Institute, Xinjiang Academy of Agricultural and Reclamation ... respectively, are the two main methods used for studying ... ized plot design with a single-row plot and 80 individuals .... The mixed linear model.
Directory of Open Access Journals (Sweden)
Julio Pedro Laca-Buendia
1985-12-01
Full Text Available Com a finalidade de estudar a mistura de tanque mais eficiente com cyanazine em aplicação de pré-emergência na cultura algodoeira (Gossypium hirsutum L. , foram estudados os seguintes tratamentos: cyanazine + diuron nas doses de 0,8 + 0,8 kg i.a/ha e 1,0 + 1,0 kg i.a/ha; cyanazine+ oryzalin , nas do sés de 1,2 + 0,8 kg i.a/ha e 1,6 + 1,2 kg i.a/h a; cyanazyne + metol a chlor, nas doses de 1,4 + 2,0 kg i.a/ha e 1,75 + 2,52 kg i.a/ ha;cianazine na dose de 1,75 kg i.a /ha; oryzalin na dose de 1,12 kg i.a/ha; metol achlor na dose de 2,52 kg i.a /ha e diuron na dose de 1,6 kg i.a /ha. Para efeito de comparação, utilizou-se uma testemunha sem capina e outra com capina manual. Nenhum tratamento apresentou injúria para as plantas de algodão e não houve diferenças significativas para o "stand" inicial. Já no "stand" final, a testemunha sem capina apresentou o menor número de plantas, sendo que não houve diferenças significativas dos outros tratamentos com a testemunha capinada. Para o rendimento, a mistura cyanazine + metolachior em ambas as doses estudadas, não apresentaram diferenças significativas da testemunha capinada. Quanto à altura da planta, peso de 100 sementes, porcentagem e índice de fibras não houve diferenças significativas entre os tratamentos estudados, somente o peso do capulho foi afetado pelo oryzalin. Pela avaliação visual (EWRC 1 a 9*, os herbicidas apres entaram um controle satisfatório somente até os 30 dias após aplicação, sendo que a mistura cyanazine + metolachlor foi efici ente quanto a testemunha capinada. No controle da Portulaca oleracea , a mistura cyanazine + oryzalin na maior dose e oryzalin apresentaram 71,4% de controle ate os 30 dias e 79,4% e 82,4%, respectivamente, até 45 dias da aplicação. Para Amaranthus sp., à exceção da cyanazine e cyanazine + diuron nas doses menores, não apresentaram nenhum controle, sendo que os outros herbicidas controlaram com eficiência superior a 70
Directory of Open Access Journals (Sweden)
Hongtao Hu
Full Text Available MicroRNAs (miRNAs and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs are two distinct subfamilies of small RNAs (sRNAs that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs are processed from longer RNA precursors by DICER-LIKE proteins (DCLs. Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs and 108 novel lineage-specific miRNAs (ls-miRNAs. Along with miRNAs, 2,033 miRNA variants (isomiRNAs were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers
Hu, Hongtao; Rashotte, Aaron M; Singh, Narendra K; Weaver, David B; Goertzen, Leslie R; Singh, Shree R; Locy, Robert D
2015-01-01
MicroRNAs (miRNAs) and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs) are two distinct subfamilies of small RNAs (sRNAs) that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs) are processed from longer RNA precursors by DICER-LIKE proteins (DCLs). Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs) and 108 novel lineage-specific miRNAs (ls-miRNAs). Along with miRNAs, 2,033 miRNA variants (isomiRNAs) were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs) were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers of a second
Chen, Eryong; Zhang, Xueyan; Yang, Zhaoen; Wang, Xiaoqian; Yang, Zuoren; Zhang, Chaojun; Wu, Zhixia; Kong, Depei; Liu, Zhao; Zhao, Ge; Butt, Hamama Islam; Zhang, Xianlong; Li, Fuguang
2017-06-01
HD-ZIP IV proteins belong to the homeodomain-leucine zipper (HD-ZIP) transcription factor family and are involved in trichome development and drought stress in plants. Although some functions of the HD-ZIP IV group are well understood in Arabidopsis, little is known about their function in cotton. In this study, HD-ZIP genes were identified from three Gossypium species (G. arboreum, G. raimondii and G. hirsutum) and clustered into four families (HD-ZIP I, II, III and IV) to separate HD-ZIP IV from the other three families. Systematic analyses of phylogeny, gene structure, conserved domains, and expression profiles in different plant tissues and the expression patterns under osmotic stress in leaves were further conducted in G. arboreum. More importantly, ectopic overexpression of GaHDG11, a representative of the HD-ZIP IV family, confers enhanced osmotic tolerance in transgenic Arabidopsis plants, possibly due to elongated primary root length, lower water loss rates, high osmoprotectant proline levels, significant levels of antioxidants CAT, and/or SOD enzyme activity with reduced levels of MDA. Taken together, these observations may lay the foundation for future functional analysis of cotton HD-ZIP IV genes to unravel their biological roles in cotton.
Directory of Open Access Journals (Sweden)
M. Velayati
2011-01-01
Full Text Available Abstract Weeds are problematic plants in agroecosystems as a competitor for crops. In order to evaluate effects of cotton (Gossypium hirsutum and common lambsquarter (Chenopodium album densities on some crop growth indices, a study was conducted during 2006 in Experimental Station of Faculty of Agriculture, The University of Birjand as factorial experiment based on complete randomized block design with four replications. Three densities of cotton (6, 9 and 12 Pl.m-2 and four weed densities (0, 6, 9 and 12 Pl.m-2 were used to provide different weed interference levels. Indeed, three plots in each replication were intended to cultivation of lambsquarter alone at 6, 9 or 12 Pl.m-2. Results showed that crop growth rate (CGR of cotton was influenced by weed density, and its relative growth rate (RGR and net assimilation rate (NAR indicated a declining trend as weed density increased. Dry matter accumulation of cotton also was affected negatively by weed densities, as interference of lambsquarter at 6, 9 and 12 Pl.m-2 resulted to 35, 42 and 48 percent dry matter reduction, respectively, than weed-free treatment. Increasing of cotton density could partly compensate for negative impact of weed attendance on cotton growth. Thus, it seems higher plant densities can be used as a managing tool against weeds in cotton fields to avoid reduction of yield. Keywords: Cotton, Density, Weed, competition, Growth analysis
Directory of Open Access Journals (Sweden)
Zhen Zhang
Full Text Available Cotton (Gossypium hirsutum L. is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.
Zhang, Zhen; Li, Junwen; Muhammad, Jamshed; Cai, Juan; Jia, Fei; Shi, Yuzhen; Gong, Juwu; Shang, Haihong; Liu, Aiying; Chen, Tingting; Ge, Qun; Palanga, Koffi Kibalou; Lu, Quanwei; Deng, Xiaoying; Tan, Yunna; Li, Wei; Sun, Linyang; Gong, Wankui; Yuan, Youlu
2015-01-01
Cotton (Gossypium hirsutum L.) is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL) mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs) from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.
Wegier, A; Piñeyro-Nelson, A; Alarcón, J; Gálvez-Mariscal, A; Alvarez-Buylla, E R; Piñero, D
2011-10-01
Over 95% of the currently cultivated cotton was domesticated from Gossypium hirsutum, which originated and diversified in Mexico. Demographic and genetic studies of this species at its centre of origin and diversification are lacking, although they are critical for cotton conservation and breeding. We investigated the actual and potential distribution of wild cotton populations, as well as the contribution of historical and recent gene flow in shaping cotton genetic diversity and structure. We evaluated historical gene flow using chloroplast microsatellites and recent gene flow through the assessment of transgene presence in wild cotton populations, exploiting the fact that genetically modified cotton has been planted in the North of Mexico since 1996. Assessment of geographic structure through Bayesian spatial analysis, BAPS and Genetic Algorithm for Rule-set Production (GARP), suggests that G. hirsutum seems to conform to a metapopulation scheme, with eight distinct metapopulations. Despite evidence for long-distance gene flow, genetic variation among the metapopulations of G. hirsutum is high (He = 0.894 ± 0.01). We identified 46 different haplotypes, 78% of which are unique to a particular metapopulation, in contrast to a single haplotype detected in cotton cultivars. Recent gene flow was also detected (m = 66/270 = 0.24), with four out of eight metapopulations having transgenes. We discuss the implications of the data presented here with respect to the conservation and future breeding of cotton populations and genetic diversity at its centre of crop origin. © 2011 Blackwell Publishing Ltd.
Liu, Ji; Pang, Chaoyou; Wei, Hengling; Song, Meizhen; Meng, Yanyan; Ma, Jianhui; Fan, Shuli; Yu, Shuxun
2015-08-03
Male sterility is a common phenomenon in flowering plants, and it has been successfully developed in several crops by taking advantage of heterosis. Cotton (Gossypium hirsutum L.) is an important economic crop, used mainly for the production of textile fiber. Using a space mutation breeding technique, a novel photosensitive genetic male sterile mutant CCRI9106 was isolated from the wild-type upland cotton cultivar CCRI040029. To use CCRI9106 in cotton hybrid breeding, it is of great importance to study the molecular mechanisms of its male sterility. Here, histological and iTRAQ-facilitated proteomic analyses of anthers were performed to explore male sterility mechanisms of the mutant. Scanning and transmission electron microscopy of the anthers showed that the development of pollen wall in CCRI9106 was severely defective with a lack of exine formation. At the protein level, 6121 high-confidence proteins were identified and 325 of them showed differential expression patterns between mutant and wild-type anthers. The proteins up- or down-regulated in MT anthers were mainly involved in exine formation, protein degradation, calcium ion binding,etc. These findings provide valuable information on the proteins involved in anther and pollen development, and contribute to elucidate the mechanism of male sterility in upland cotton. Copyright © 2015. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Gregory N. Thyssen
2016-06-01
Full Text Available Cotton seed trichomes are the most important source of natural fibers globally. The major fiber thickness properties influence the price of the raw material, and the quality of the finished product. The recessive immature fiber (im gene reduces the degree of fiber cell wall thickening by a process that was previously shown to involve mitochondrial function in allotetraploid Gossypium hirsutum. Here, we present the fine genetic mapping of the im locus, gene expression analysis of annotated proteins near the locus, and association analysis of the linked markers. Mapping-by-sequencing identified a 22-bp deletion in a pentatricopeptide repeat (PPR gene that is completely linked to the immature fiber phenotype in 2837 F2 plants, and is absent from all 163 cultivated varieties tested, although other closely linked marker polymorphisms are prevalent in the diversity panel. This frame-shift mutation results in a transcript with two long open reading frames: one containing the N-terminal transit peptide that targets mitochondria, the other containing only the RNA-binding PPR domains, suggesting that a functional PPR protein cannot be targeted to mitochondria in the im mutant. Taken together, these results suggest that PPR gene Gh_A03G0489 is involved in the cotton fiber wall thickening process, and is a promising candidate gene at the im locus. Our findings expand our understanding of the molecular mechanisms that modulate cotton fiber fineness and maturity, and may facilitate the development of cotton varieties with superior fiber attributes.
International Nuclear Information System (INIS)
Shaukat, S.; Khan, T.M.; Ijaz, S.
2013-01-01
Combining ability was studied for identification of potential cultivars and hybrids in upland cotton (Gossypium hirsutum L.) in a 6x6 set of diallel crosses among six genotypes of cotton, i.e., VH-232, CRS-2007, SB-149, GR-156, FH-207, and MARVI carried out on fiber length, fiber fineness, fiber elongation, fiber strength, ginning out tern (GOT) and seed cotton yield. Analysis of variance revealed highly significant (p < 0.01) differences among the genotypes for all traits. Combining ability studies showed that the mean squares, due to general combining ability (GCA), specific combining ability (SCA) and reciprocal effects were highly significant in F1 generation. Genetic components, due to GCA and SCA, revealed that traits, such as, fiber length, strength and fineness, showed high proportion of additive type of gene action in F1 generation because of greater GCA variances were greater than SCA variance. GR-156 was the best combiner for lint percentage and fiber length. FH-207 was the best combiner for fiber fineness. FH-207, MARVI and SB-149 were the best general combiners for fiber character and were suggested to be used in future breeding programme to improve fiber quality traits. CRS-2007 x GR-156, CRS-2007 x MARVI, SB-149 x MARVI and VH-232 x SB-149 had higher specific combining ability and reciprocal effects and they can be used for future breeding programme to improve fiber quality. (author)
Sun, Xiang; Gong, Si-Ying; Nie, Xiao-Ying; Li, Yang; Li, Wen; Huang, Geng-Qing; Li, Xue-Bao
2015-07-01
Secondary cell wall (SCW) is an important industrial raw material for pulping, papermaking, construction, lumbering, textiles and potentially for biofuel production. The process of SCW thickening of cotton fibers lays down the cellulose that will constitute the bulk (up to 96%) of the fiber at maturity. In this study, a gene encoding a MYB-domain protein was identified in cotton (Gossypium hirsutum) and designated as GhMYBL1. Quantitative real-time polymerase chain reaction (RT-PCR) analysis revealed that GhMYBL1 was specifically expressed in cotton fibers at the stage of secondary wall deposition. Further analysis indicated that this protein is a R2R3-MYB transcription factor, and is targeted to the cell nucleus. Overexpression of GhMYBL1 in Arabidopsis affected the formation of SCW in the stem xylem of the transgenic plants. The enhanced SCW thickening also occurred in the interfascicular fibers, xylary fibers and vessels of the GhMYBL1-overexpression transgenic plants. The expression of secondary wall-associated genes, such as CesA4, CesA7, CesA8, PAL1, F5H and 4CL1, were upregulated, and consequently, cellulose and lignin biosynthesis were enhanced in the GhMYBL1 transgenic plants. These data suggested that GhMYBL1 may participate in modulating the process of secondary wall biosynthesis and deposition of cotton fibers. © 2014 Scandinavian Plant Physiology Society.
Yuan, Daojun; Tang, Zhonghui; Wang, Maojun; Gao, Wenhui; Tu, Lili; Jin, Xin; Chen, Lingling; He, Yonghui; Zhang, Lin; Zhu, Longfu; Li, Yang; Liang, Qiqi; Lin, Zhongxu; Yang, Xiyan; Liu, Nian; Jin, Shuangxia; Lei, Yang; Ding, Yuanhao; Li, Guoliang; Ruan, Xiaoan; Ruan, Yijun; Zhang, Xianlong
2015-01-01
Gossypium hirsutum contributes the most production of cotton fibre, but G. barbadense is valued for its better comprehensive resistance and superior fibre properties. However, the allotetraploid genome of G. barbadense has not been comprehensively analysed. Here we present a high-quality assembly of the 2.57 gigabase genome of G. barbadense, including 80,876 protein-coding genes. The double-sized genome of the A (or At) (1.50 Gb) against D (or Dt) (853 Mb) primarily resulted from the expansion of Gypsy elements, including Peabody and Retrosat2 subclades in the Del clade, and the Athila subclade in the Athila/Tat clade. Substantial gene expansion and contraction were observed and rich homoeologous gene pairs with biased expression patterns were identified, suggesting abundant gene sub-functionalization occurred by allopolyploidization. More specifically, the CesA gene family has adapted differentially temporal expression patterns, suggesting an integrated regulatory mechanism of CesA genes from At and Dt subgenomes for the primary and secondary cellulose biosynthesis of cotton fibre in a “relay race”-like fashion. We anticipate that the G. barbadense genome sequence will advance our understanding the mechanism of genome polyploidization and underpin genome-wide comparison research in this genus. PMID:26634818
Satya, Pratik; Paswan, Pramod Kumar; Ghosh, Swagata; Majumdar, Snehalata; Ali, Nasim
2016-06-01
Cross-species transferability is a quick and economic method to enrich SSR database, particularly for minor crops where little genomic information is available. However, transferability of SSR markers varies greatly between species, genera and families of plant species. We assessed confamiliar transferability of SSR markers from cotton (Gossypium hirsutum) and jute (Corchorus olitorius) to 22 species distributed in different taxonomic groups of Malvaceae. All the species selected were potential industrial crop species having little or no genomic resources or SSR database. Of the 14 cotton SSR loci tested, 13 (92.86 %) amplified in G. arboreum and 71.43 % exhibited cross-genera transferability. Nine out of 11 jute SSRs (81.81 %) showed cross-transferability across genera. SSRs from both the species exhibited high polymorphism and resolving power in other species. The correlation between transferability of cotton and jute SSRs were highly significant (r = 0.813). The difference in transferability among species was also significant for both the marker groups. High transferability was observed at genus, tribe and subfamily level. At tribe level, transferability of jute SSRs (41.04 %) was higher than that of cotton SSRs (33.74 %). The tribe Byttnerieae exhibited highest SSR transferability (48.7 %). The high level of cross-genera transferability (>50 %) in ten species of Malvaceae, where no SSR resource is available, calls for large scale transferability testing from the enriched SSR databases of cotton and jute.
Directory of Open Access Journals (Sweden)
N'G.D.V. Kouakou
2010-01-01
Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.
Directory of Open Access Journals (Sweden)
Renesh Bedre
Full Text Available Aflatoxins are toxic and potent carcinogenic metabolites produced from the fungi Aspergillus flavus and A. parasiticus. Aflatoxins can contaminate cottonseed under conducive preharvest and postharvest conditions. United States federal regulations restrict the use of aflatoxin contaminated cottonseed at >20 ppb for animal feed. Several strategies have been proposed for controlling aflatoxin contamination, and much success has been achieved by the application of an atoxigenic strain of A. flavus in cotton, peanut and maize fields. Development of cultivars resistant to aflatoxin through overexpression of resistance associated genes and/or knocking down aflatoxin biosynthesis of A. flavus will be an effective strategy for controlling aflatoxin contamination in cotton. In this study, genome-wide transcriptome profiling was performed to identify differentially expressed genes in response to infection with both toxigenic and atoxigenic strains of A. flavus on cotton (Gossypium hirsutum L. pericarp and seed. The genes involved in antifungal response, oxidative burst, transcription factors, defense signaling pathways and stress response were highly differentially expressed in pericarp and seed tissues in response to A. flavus infection. The cell-wall modifying genes and genes involved in the production of antimicrobial substances were more active in pericarp as compared to seed. The genes involved in auxin and cytokinin signaling were also induced. Most of the genes involved in defense response in cotton were highly induced in pericarp than in seed. The global gene expression analysis in response to fungal invasion in cotton will serve as a source for identifying biomarkers for breeding, potential candidate genes for transgenic manipulation, and will help in understanding complex plant-fungal interaction for future downstream research.
Zhang, Xueying; Wang, Liman; Xu, Xiaoyang; Cai, Caiping; Guo, Wangzhen
2014-12-10
Mitogen-activated protein kinase (MAPK) cascades play a crucial role in plant growth and development as well as biotic and abiotic stress responses. Knowledge about the MAPK gene family in cotton is limited, and systematic investigation of MAPK family proteins has not been reported. By performing a bioinformatics homology search, we identified 28 putative MAPK genes in the Gossypium raimondii genome. These MAPK members were anchored onto 11 chromosomes in G. raimondii, with uneven distribution. Phylogenetic analysis showed that the MAPK candidates could be classified into the four known A, B, C and D groups, with more MAPKs containing the TEY phosphorylation site (18 members) than the TDY motif (10 members). Furthermore, 21 cDNA sequences of MAPKs with complete open reading frames (ORFs) were identified in G. hirsutum via PCR-based approaches, including 13 novel MAPKs and eight with homologs reported previously in tetraploid cotton. The expression patterns of 23 MAPK genes reveal their important roles in diverse functions in cotton, in both various developmental stages of vegetative and reproductive growth and in the stress response. Using a reverse genetics approach based on tobacco rattle virus-induced gene silencing (TRV-VIGS), we further verified that MPK9, MPK13 and MPK25 confer resistance to defoliating isolates of Verticillium dahliae in cotton. Silencing of MPK9, MPK13 and MPK25 can significantly enhance cotton susceptibility to this pathogen. This study presents a comprehensive identification of 28 mitogen-activated protein kinase genes in G. raimondii. Their phylogenetic relationships, transcript expression patterns and responses to various stressors were verified. This study provides the first systematic analysis of MAPKs in cotton, improving our understanding of defense responses in general and laying the foundation for future crop improvement using MAPKs.
Chen, Yu; Wang, Yingying; Zhao, Ting; Yang, Jianwei; Feng, Shouli; Nazeer, Wajad; Zhang, Tianzhen; Zhou, Baoliang
2015-01-01
Gossypium arboreum, a cultivated cotton species (2n = 26, AA) native to Asia, possesses invaluable characteristics unavailable in the tetraploid cultivated cotton gene pool, such as resistance to pests and diseases and tolerance to abiotic stresses. However, it is quite difficult to transfer favorable traits into Upland cotton through conventional methods due to the cross-incompatibility of G. hirsutum (2n = 52, AADD) and G. arboreum. Here, we improved an embryo rescue technique to overcome the cross-incompatibility between these two parents for transferring favorable genes from G. arboreum into G. hirsutum. Our results indicate that MSB2K supplemented with 0.5 mgl-1 kinetin and 250 mg-1 casein hydrolysate is an efficient initial medium for rescuing early (3 d after pollination) hybrid embryos. Eight putative hybrids were successfully obtained, which were further verified and characterized by cytology, molecular markers and morphological analysis. The putative hybrids were subsequently treated with different concentrations of colchicine solution to double their chromosomes. The results demonstrate that four putative hybrid plants were successfully chromosome-doubled by treatment with 0.1% colchicine for 24 h and become amphiploid, which were confirmed by cytological observation, self-fertilization and backcrossing. Preliminary assessments of resistance at seedling stage indicate that the synthetic amphiploid showed highly resistant to Verticillium and drought. The synthetic amphiploid between G. hirsutum × G. arboreum would lay the foundation for developing G. arboreum-introgressed lines with the uniform genetic background of G. hirsutum acc TM-1, which would greatly enhance and simplify the mining, isolation, characterization, cloning and use of G. arboreum-specific desirable genes in future cotton breeding programs. PMID:26061996
Lambret-Frotté, Julia; Artico, Sinara; Muniz Nardeli, Sarah; Fonseca, Fernando; Brilhante Oliveira-Neto, Osmundo; Grossi-de-Sá, Maria Fatima; Alves-Ferreira, Marcio
2016-01-01
Cotton is one of the most economically important cultivated crops. It is the major source of natural fiber for the textile industry and an important target for genetic modification for both biotic stress and herbicide tolerance. Therefore, the characterization of genes and regulatory regions that might be useful for genetic transformation is indispensable. The isolation and characterization of new regulatory regions is of great importance to drive transgene expression in genetically modified crops. One of the major drawbacks in cotton production is pest damage; therefore, the most promising, cost-effective, and sustainable method for pest control is the development of genetically resistant cotton lines. Considering this scenario, our group isolated and characterized the promoter region of a MCO (multicopper oxidase) from Gossypium hirsutum, named GhAO-like1 (ascorbate oxidase-like1). The quantitative expression, together with the in vivo characterization of the promoter region reveals that GhAO-like1 has a flower- and fruit-specific expression pattern. The GUS activity is mainly observed in stamens, as expected considering that the GhAO-like1 regulatory sequence is enriched in cis elements, which have been characterized as a target of reproductive tissue specific transcription factors. Both histological and quantitative analyses in Arabidopsis thaliana have confirmed flower (mainly in stamens) and fruit expression of GhAO-like1. In the present paper, we isolated and characterized both in silico and in vivo the promoter region of the GhAO-like1 gene. The regulatory region of GhAO-like1 might be useful to confer tissue-specific expression in genetically modified plants.
Directory of Open Access Journals (Sweden)
Xueyan Zhang
Full Text Available The cotton diploid species, Gossypium arboreum, shows important properties of stress tolerance and good genetic stability. In this study, through mRNA-seq, we de novo assembled the unigenes of multiple samples with 3h H(2O, NaCl, or PEG treatments in leaf, stem and root tissues and successfully obtained 123,579 transcripts of G. arboreum, 89,128 of which were with hits through BLAST against known cotton ESTs and draft genome of G. raimondii. About 36,961 transcripts (including 1,958 possible transcription factor members were identified with differential expression under water stresses. Principal component analysis of differential expression levels in multiple samples suggested tissue selective signalling responding to water stresses. Venn diagram analysis showed the specificity and intersection of transcripts' response to NaCl and PEG treatments in different tissues. Self-organized mapping and hierarchical cluster analysis of the data also revealed strong tissue selectivity of transcripts under salt and osmotic stresses. In addition, the enriched gene ontology (GO terms for the selected tissue groups were differed, including some unique enriched GO terms such as photosynthesis and tetrapyrrole binding only in leaf tissues, while the stem-specific genes showed unique GO terms related to plant-type cell wall biogenesis, and root-specific genes showed unique GO terms such as monooxygenase activity. Furthermore, there were multiple hormone cross-talks in response to osmotic and salt stress. In summary, our multidimensional mRNA sequencing revealed tissue selective signalling and hormone crosstalk in response to salt and osmotic stresses in G. arboreum. To our knowledge, this is the first such report of spatial resolution of transcriptome analysis in G. arboreum. Our study will potentially advance understanding of possible transcriptional networks associated with water stress in cotton and other crop species.
Yi, Xiao-Ping; Zhang, Ya-Li; Yao, He-Sheng; Han, Ji-Mei; Chow, Wah Soon; Fan, Da-Yong; Zhang, Wang-Feng
2018-01-01
To clarify the influence of water deficit on the functionality of the photosynthetic apparatus of cotton plants, leaf gas exchange, chlorophyll a fluorescence, and P700 redox state were examined in field-grown cotton Gossypium hirsutum L. cv. Xinluzao 45. In addition, we measured changes in the P515 signal and analyzed the activity of ATP synthase and the trans-thylakoid proton gradient (ΔpH). With increasing water deficit, the net CO 2 assimilation rate (A N ) and stomatal conductance (g s ) significantly decreased, but the maximum quantum efficiency of PSII photochemistry (F v /F m ) did not change. The photochemical activity of photosystem II (PSII) was reflected by the photochemical quenching coefficient (qP), quantum efficiency of photosystem II [Y(II)], and electron transport rate through PSII [ETR(II)], while the activity of photosystem I (PSI) was reflected by the quantum efficiency of photosystem I [Y(I)] and the electron transport rate through PSI [ETR(I)]. Both activities were maintained under mild water deficit, but were slightly decreased under moderate water deficit. Under moderate water deficit, cyclic electron flow (CEF), the fraction of absorbed light dissipated thermally via the ΔpH- and xanthophyll-regulated process [Y(NPQ)], and the fraction of P700 oxidized under a given set of conditions [Y(ND)] increased. Our results suggest that the activities of both photosystems are stable under mild water deficit and decrease only slightly under moderate water deficit. Moderate water deficit stimulates CEF, and the stimulation of CEF is essential for protecting PSI and PSII against photoinhibition. Copyright © 2017 Elsevier GmbH. All rights reserved.
He, Peng; Zhao, Peng; Wang, Limin; Zhang, Yuzhou; Wang, Xiaosi; Xiao, Hui; Yu, Jianing; Xiao, Guanghui
2017-07-03
Cell elongation and expansion are significant contributors to plant growth and morphogenesis, and are often regulated by environmental cues and endogenous hormones. Auxin is one of the most important phytohormones involved in the regulation of plant growth and development and plays key roles in plant cell expansion and elongation. Cotton fiber cells are a model system for studying cell elongation due to their large size. Cotton is also the world's most utilized crop for the production of natural fibers for textile and garment industries, and targeted expression of the IAA biosynthetic gene iaaM increased cotton fiber initiation. Polar auxin transport, mediated by PIN and AUX/LAX proteins, plays a central role in the control of auxin distribution. However, very limited information about PIN-FORMED (PIN) efflux carriers in cotton is known. In this study, 17 PIN-FORMED (PIN) efflux carrier family members were identified in the Gossypium hirsutum (G. hirsutum) genome. We found that PIN1-3 and PIN2 genes originated from the At subgenome were highly expressed in roots. Additionally, evaluation of gene expression patterns indicated that PIN genes are differentially induced by various abiotic stresses. Furthermore, we found that the majority of cotton PIN genes contained auxin (AuxREs) and salicylic acid (SA) responsive elements in their promoter regions were significantly up-regulated by exogenous hormone treatment. Our results provide a comprehensive analysis of the PIN gene family in G. hirsutum, including phylogenetic relationships, chromosomal locations, and gene expression and gene duplication analyses. This study sheds light on the precise roles of PIN genes in cotton root development and in adaption to stress responses.
Ma, Rendi; Yuan, Hali; An, Jing; Hao, Xiaoyun; Li, Hongbin
2018-01-01
GDSL lipase (GLIP) plays a pivotal role in plant cell growth as a multifunctional hydrolytic enzyme. Herein, a cotton (Gossypium hirsutum L. cv Xuzhou 142) GDSL lipase gene (GhGLIP) was obtained from developing ovules and fibers. The GhGLIP cDNA contained an open reading frame (ORF) of 1,143 base pairs (bp) and encodes a putative polypeptide of 380 amino acid residues. Sequence alignment indicated that GhGLIP includes four enzyme catalytic amino acid residue sites of Ser (S), Gly (G), Asn (N) and His (H), located in four conserved blocks. Phylogenetic tree analysis showed that GhGLIP belongs to the typical class IV lipase family with potential functions in plant secondary metabolism. Subcellular distribution analysis demonstrated that GhGLIP localized to the nucleus, cytoplasm and plasma membrane. GhGLIP was expressed predominantly at 5-15 day post anthesis (dpa) in developing ovules and elongating fibers, measured as mRNA levels and enzyme activity. Ectopic overexpression of GhGLIP in Arabidopsis plants resulted in enhanced seed development, including length and fresh weight. Meanwhile, there was increased soluble sugar and protein storage in transgenic Arabidopsis plants, coupled with the promotion of lipase activity. Moreover, the expression of cotton GhGLIP is induced by ethylene (ETH) treatment in vitro. A 1,954-bp GhGLIP promoter was isolated and expressed high activity in driving green fluorescence protein (GFP) expression in tobacco leaves. Cis-acting element analysis of the GhGLIP promoter (pGhGLIP) indicated the presence of an ethylene-responsive element (ERE), and transgenic tobacco leaves with ectopic expression of pGhGLIP::GFP-GUS showed increased GUS activity after ETH treatment. In summary, these results suggest that GhGLIP is a functional enzyme involved in ovule and fiber development and performs significant roles in seed development.
Directory of Open Access Journals (Sweden)
Thereza Raquel de Lucena Vieira
2010-06-01
Full Text Available Esta pesquisa teve como objetivo avaliar o efeito de dietas de terminação contendo diferentes níveis (0, 20, 30 e 40% de caroço de algodão integral (Gossypium hirsutum sobre os parâmetros físicos e sensoriais da carne de vinte e quatro cordeiros da raça Santa Inês. Foram avaliados os parâmetros de pH, capacidade de retenção de água (CRA, perda de peso por cocção (PPC, textura e cor, além dos parâmetros sensoriais de sabor, aroma, cor e textura. Apenas o parâmetro cor da carne ovina sofreu influência significativa da adição do caroço de algodão integral, observando-se variações para as coordenadas b* e L* (antes da cocção. Verificou-se também que os tratamentos apresentaram influência (p The objective of this research was to evaluate the effect of termination diets containing increasing levels (0, 20, 30, and 40% of whole cotton seed (Gossypium hirsutum on the physical (pH, water holding capacity, cooking losses, texture, colour and sensory parameters (flavour, odour, colour, texture of the lamb meat of twenty four Santa Ines sheep. Only the b* and L* colour parameters of the lamb meat were significantly affected by the addition of different levels of whole cotton seed to the diet. The inclusion of the whole cotton seed in the diet of the Santa Ines sheep also influenced sensory attributes such as natural colour, odour, and characteristic flavour. Based on these observations, considering the physical and sensory attributes of the lamb meat, the use of whole cotton seed at a 40% level for sheep in termination for short periods, i.e., up to 90 days, is recommended.
Directory of Open Access Journals (Sweden)
Sarr D.
2009-01-01
Full Text Available Genetic broadening of the main cultivated cotton species Gossypium hirsutum L. by creation and exploitation of monosomic alien addition lines. The genus Gossypium is composed of about forty wild diploïd species that constitute an important reservoir of interesting genes for the genetic improvement of Gossypium hirsutum L., the main cultivated cotton species. Creation of monosomic alien addition lines (MAAL, made up of plants having in addition to the chromosome set of the cultivated species one wild species' supernumerary chromosome, is an interesting way to exploit this diversity. Numerous constraints limit the creation of MAAL, among them the most important is doubtless the production of first generation derivatives from pentaploids obtained by backcrossing G. hirsutum with bispecific hexaploid hybrids made of the cultivated species tetraploid genome and the genome of a donor diploid species. Raising this impediment by appropriate techniques allows to develop MAAL offering the possibility to introgress finely traits of interest from diploid species and to better understand genomic relationships between species in the genus Gossypium. Identification and exploitation of these MAAL have been for a long time based on not very reliable morphological characteristics and on the use of classical cytogenetic techniques, very heavy to implement. Nowadays, the exploitation of MAAL benefits from the great advances registered in molecular biology through the development of DNA markers and molecular cytogenetics. These progresses make of MAAL a promising way for the genetic improvement of the main cultivated cotton species.
Lv, Yuanda; Zhao, Liang; Xu, Xiaoyang; Wang, Lei; Wang, Cheng; Zhang, Tianzhen; Guo, Wangzhen
2013-03-13
Cotton is the leading fiber crop worldwide. Gossypium barbadense is an important species of cotton because of its extra-long staple fibers with superior luster and silkiness. However, a systematic analysis and utilization of cDNA sequences from G. barbadense fiber development remains understudied. A total of 21,079 high quality sequences were generated from two non-normalized cDNA libraries prepared by using a mixture of G. barbadense Hai7124 fibers and ovules. After assembly processing, a set of 8,653 unigenes were obtained. Of those, 7,786 were matched to known proteins and 7,316 were assigned to functional categories. The molecular functions of these unigenes were mostly related to binding and catalytic activity, and carbohydrate, amino acid, and energy metabolisms were major contributors among the subsets of metabolism. Sequences comparison between G. barbadense and G. hirsutum revealed that 8,245 unigenes from G. barbadense were detected the similarity with those released publicly in G. hirsutum, however, the remaining 408 sequences had no hits against G. hirsutum unigenes database. Furthermore, 13,275 putative ESTs InDels loci involved in the orthologous and/or homoeologous differences between/within G. barbadense and G. hirsutum were discovered by in silico analyses, and 2,160 InDel markers were developed by ESTs with more than five insertions or deletions. By gel electrophoresis combined with sequencing verification, 71.11% candidate InDel loci were reconfirmed orthologous and/or homoeologous loci polymorphisms using G. hirsutum acc TM-1 and G. barbadense cv Hai7124. Blastx result showed among 2,160 InDel loci, 81 with significant function similarity with known genes associated with secondary wall synthesis process, indicating the important roles in fiber quality in tetraploid cultivated cotton species. Sequence comparisons and InDel markers development will lay the groundwork for promoting the identification of genes related to superior agronomic traits
Directory of Open Access Journals (Sweden)
Caroline da Cruz Vasconcelos
2017-03-01
Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.
Ulloa, M; Wang, C; Saha, S; Hutmacher, R B; Stelly, D M; Jenkins, J N; Burke, J; Roberts, P A
2016-04-01
Chromosome substitution (CS) lines in plants are a powerful genetic resource for analyzing the contribution of chromosome segments to phenotypic variance. In this study, a series of interspecific cotton (Gossypium spp.) CS lines were used to identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode or fungal disease resistance traits. The CS lines were developed in the G. hirsutum L. TM-1 background with chromosome or chromosome segment substitutions from G. barbadense L. Pima 3-79 or G. tomentosum. Root-knot nematode (Meloidogyne incognita) and fusarium wilt (Fusarium oxysporum f. sp. vasinfectum) (races 1 and 4) resistance alleles and quantitative trait loci (QTL) previously placed on cotton chromosomes using SSR markers in two interspecific recombinant inbred line populations were chosen for testing. Phenotypic responses of increased resistance or susceptibility in controlled inoculation and infested field assays confirmed the resistance QTLs, based on substitution with the positive or negative allele for resistance. Lines CS-B22Lo, CS-B04, and CS-B18 showed high resistance to nematode root-galling, confirming QTLs on chromosomes 4 and 22 (long arm) with resistance alleles from Pima 3-79. Line CS-B16 had less fusarium race 1-induced vascular root staining and higher percent survival than the TM-1 parent, confirming a major resistance QTL on chromosome 16. Lines CS-B(17-11) and CS-B17 had high fusarium race 4 vascular symptoms and low survival due to susceptible alleles introgressed from Pima 3-79, confirming the localization on chromosome 17 of an identified QTL with resistance alleles from TM1 and other resistant lines. Analyses validated regions on chromosomes 11, 16, and 17 harboring nematode and fusarium wilt resistance genes and demonstrated the value of CS lines as both a germplasm resource for breeding programs and as a powerful genetic analysis tool for determining QTL effects for disease
Zhao, Jun; Gao, Yulong; Zhang, Zhiyuan; Chen, Tianzi; Guo, Wangzhen; Zhang, Tianzhen
2013-08-06
Cotton (Gossypium spp.) is widely cultivated due to the important economic value of its fiber. However, extreme environmental degradation impedes cotton growth and production. Receptor-like kinase (RLK) proteins play important roles in signal transduction and participate in a diverse range of processes in response to plant hormones and environmental cues. Here, we introduced an RLK gene (GbRLK) from cotton into Arabidopsis and investigated its role in imparting abiotic stress tolerance. GbRLK transcription was induced by exogenously supplied abscisic acid (ABA), salicylic acid, methyl jasmonate, mock drought conditions and high salinity. We cloned the promoter sequence of this gene via self-formed adaptor PCR. Sequence analysis revealed that the promoter region contains many cis-acting stress-responsive elements such as ABRE, W-Box, MYB-core, W-Box core, TCA-element and others. We constructed a vector containing a 1,890-bp sequence in the 5' region upstream of the initiation codon of this promoter and transformed it into Arabidopsis thaliana. GUS histochemical staining analysis showed that GbRLK was expressed mainly in leaf veins, petioles and roots of transgenic Arabidopsis, but not in the cotyledons or root hairs. GbRLK promoter activity was induced by ABA, PEG, NaCl and Verticillium dahliae. Transgenic Arabidopsis with constitutive overexpression of GbRLK exhibited a reduced rate of water loss in leaves in vitro, along with improved salinity and drought tolerance and increased sensitivity to ABA compared with non-transgenic Col-0 Arabidopsis. Expression analysis of stress-responsive genes in GbRLK Arabidopsis revealed that there was increased expression of genes involved in the ABA-dependent signaling pathway (AtRD20, AtRD22 and AtRD26) and antioxidant genes (AtCAT1, AtCCS, AtCSD2 and AtCSD1) but not ion transporter genes (AtNHX1, AtSOS1). GbRLK is involved in the drought and high salinity stresses pathway by activating or participating in the ABA signaling
Directory of Open Access Journals (Sweden)
Min Lin
Full Text Available BACKGROUND: Cotton (Gossypium hirsutum L. is one of the world's most economically-important crops. However, its entire genome has not been sequenced, and limited resources are available in GenBank for understanding the molecular mechanisms underlying leaf development and senescence. METHODOLOGY/PRINCIPAL FINDINGS: In this study, 9,874 high-quality ESTs were generated from a normalized, full-length cDNA library derived from pooled RNA isolated from throughout leaf development during the plant blooming stage. After clustering and assembly of these ESTs, 5,191 unique sequences, representative 1,652 contigs and 3,539 singletons, were obtained. The average unique sequence length was 682 bp. Annotation of these unique sequences revealed that 84.4% showed significant homology to sequences in the NCBI non-redundant protein database, and 57.3% had significant hits to known proteins in the Swiss-Prot database. Comparative analysis indicated that our library added 2,400 ESTs and 991 unique sequences to those known for cotton. The unigenes were functionally characterized by gene ontology annotation. We identified 1,339 and 200 unigenes as potential leaf senescence-related genes and transcription factors, respectively. Moreover, nine genes related to leaf senescence and eleven MYB transcription factors were randomly selected for quantitative real-time PCR (qRT-PCR, which revealed that these genes were regulated differentially during senescence. The qRT-PCR for three GhYLSs revealed that these genes express express preferentially in senescent leaves. CONCLUSIONS/SIGNIFICANCE: These EST resources will provide valuable sequence information for gene expression profiling analyses and functional genomics studies to elucidate their roles, as well as for studying the mechanisms of leaf development and senescence in cotton and discovering candidate genes related to important agronomic traits of cotton. These data will also facilitate future whole-genome sequence
Directory of Open Access Journals (Sweden)
Andrés Guzmán
2012-01-01
Full Text Available Título en ingles: Selection and characterization of plant growth promoting rhizobacteria (PGPR’s associated with cotton crop (Gossypium hirsutum Resumen: Como parte de las estrategias de una agricultura sostenible, se hace necesario disminuir el uso de fertilizantes nitrogenados de síntesis, mediante la utilización de los biofertilizantes. En particular, los géneros Azotobacter y Azospirillum son utilizados como agentes promotores de crecimiento vegetal debido a su capacidad para fijar nitrógeno atmosférico y producir hormonas de tipo indólico. Por tal razón, en este estudio se aislaron bacterias diazotróficas de los géneros Azotobacter y Azospirillum a partir de la rizósfera de cultivos de algodón en el Espinal (Tolima. Las poblaciones microbianas se caracterizaron fenotípicamente en los medios de cultivo semiespecíficos: Ashby y LG (Azotobacter sp. y NFb, LGI y Batata (Azospirillum sp.. La promoción de crecimiento vegetal se determinó mediante la actividad de la enzima nitrogenasa por medio de la técnica de reducción de acetileno y producción de índoles por el método colorimétrico de Salkowsky. Se obtuvieron 9 aislamientos tentativos de Azotobacter sp. y 4 de Azospirillum sp. Se presentaron diferencias significativas en la prueba de reducción de acetileno con las cepas presuntivas de Azotobacter sp.: NAT 9 (206.43 nmol C2H2 mL-1.h-1, NAT 4, (292.77 nmol C2H2 mL-1.h-1, y NAT 6 (460.60 nmol C2H2 mL-1.h-1 y en la producción de índoles de las cepas NAT 19 (19.87 μg.mL-1 y NAT 13 (20.08 μg.mL-1. Por su eficiencia in vitro en la promoción de crecimiento vegetal se seleccionaron las cepas NAT9, NAT4, NAT6, NAT19 y NAT13 para ser evaluadas como principio activo en futuros inoculantes para el algodón en esta zona del departamento del Tolima. Palabras clave: fijación biológica de nitrógeno; producción de índoles; promoción del crecimiento vegetal; biofertilizantes. Abstract: As part of strategies for sustainable
Directory of Open Access Journals (Sweden)
J.P. del C. Laca-Buendia
1978-09-01
região foi encontrado efeito negativo da aplicação dos herbicidas.Several herbicide mixtures were tested on cotton, (Gossypium hirsutum L. in the main production areas of the State of Minas Gerais, Brasil. The cultivar "Minas Dona Beta", was used in the Metalúrgica region, whilst in Triângulo and Norte the cultivar employed was ."IAC-13-1", . In Triângulo litle regrowth occurred up to 30 days after application when the following mixtures were used: dinitramine + diuron, dinitroanilin + prometryne and pendimethalin + diuron. These treatments controlled 96.2%, 92.5% and 96.5% of the total weeds, respectively. When yields were compared, 1,962 Kg/ha were obtained in the best treatment (pendimethalin + diuron, against the control plots average of 1,130 Kg/ha. Tank mixtures of 2,00 Kg/ha of alachlor and 0.35 Kg/ha of metribuzin, or 3,00 Kg/ha of alachlor and 0,50 Kg/ha of metribuzin, and 1,00 Kg/ha of trifluralin and 0,50 Kg/ha of metribuzin were the most efficient in controlling grasses and dicotyledons. Effective weed control was recorded in Nor th of Minas Gerais when pendimethalin + diuron were applied expressed as: 86.4%, 83.6% and 70.3% of the total weeds after 30,50 and 80 days, respectively. The mixtures dinitramine + fluome - turon and dinitroanilin + fluometuron showed the best results regard to a cotton yield of 1,532 Kg/ha, produced in the treated plots against only 229 kg/ha in the control (unhoed. The best combination for total weed control in the Metalúrgica region was dinitramine + diuron with an efficiency of 67% after 30 days. When differences in fiber production were considered, however, the best mixture was dinitramine + fluometuron, the treated plots yielding 831 kg/ha and the control 145 kg/ha.
Wubben, Martin J; Callahan, Franklin E; Jenkins, Johnie N; Deng, Dewayne D
2016-09-01
Genetic analysis of MIC-3 transgene with RKN resistance QTLs provides insight into the resistance regulatory mechanism and provides a framework for testing additional hypotheses. Resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. The MIC-3 (Meloidogyne Induced Cotton3) protein accumulates specifically within the immature galls of RKN-resistant plants that possess these QTLs. Recently, we showed that MIC-3 overexpression in an RKN-susceptible cotton genotype suppressed RKN egg production but not RKN-induced root galling. In this study, the MIC-3 overexpression construct T-DNA in the single-copy transgenic line '14-7-1' was converted into a codominant molecular marker that allowed the marker assisted selection of F2:3 cotton lines, derived from a cross between 14-7-1 and M-240 RNR, having all possible combinations of the chromosomes 11 and 14 QTLs with and without the MIC-3 overexpression construct. Root-knot nematode reproduction (eggs g(-1) root) and severity of RKN-induced root galling were assessed in these lines. We discovered that the addition of MIC-3 overexpression suppressed RKN reproduction in lines lacking both resistance QTLs and in lines having only the chromosome 14 QTL, suggesting an additive effect of the MIC-3 construct with this QTL. In contrast, MIC-3 overexpression did not improve resistance in lines having the single chromosome 11 QTL or in lines having both resistance QTLs, suggesting an epistatic interaction between the chromosome 11 QTL and the MIC-3 construct. Overexpression of MIC-3 did not affect the severity of RKN-induced root galling regardless of QTL genotype. These data provide new insights into the relative order of action of the chromosomes 11 and 14 QTLs and their potential roles in regulating MIC-3 expression as part of the RKN resistance response.
Chen, Yu; Wang, Yingying; Chen, Jinjin; Zhang, Tianzhen; Zhou, Baoliang
2015-01-01
Gossypium herbaceum, a cultivated diploid cotton species (2n = 2x = 26, A1A1), has favorable traits such as excellent drought tolerance and resistance to sucking insects and leaf curl virus. G. australe, a wild diploid cotton species (2n = 2x = 26, G2G2), possesses numerous economically valuable characteristics such as delayed pigment gland morphogenesis (which is conducive to the production of seeds with very low levels of gossypol as a potential food source for humans and animals) and resistance to insects, wilt diseases and abiotic stress. Creating synthetic allotetraploid cotton from these two species would lay the foundation for simultaneously transferring favorable genes into cultivated tetraploid cotton. Here, we crossed G. herbaceum (as the maternal parent) with G. australe to produce an F1 interspecific hybrid and doubled its chromosome complement with colchicine, successfully generating a synthetic tetraploid. The obtained tetraploid was confirmed by morphology, cytology and molecular markers and then self-pollinated. The S1 seedlings derived from this tetraploid gradually became flavescent after emergence of the fifth true leaf, but they were rescued by grafting and produced S2 seeds. The rescued S1 plants were partially fertile due to the existence of univalents at Metaphase I of meiosis, leading to the formation of unbalanced, nonviable gametes lacking complete sets of chromosomes. The S2 plants grew well and no flavescence was observed, implying that interspecific incompatibility, to some extent, had been alleviated in the S2 generation. The synthetic allotetraploid will be quite useful for polyploidy evolutionary studies and as a bridge for transferring favorable genes from these two diploid species into Upland cotton through hybridization. PMID:25879660
Meiosis in a triploid hybrid of Gossypium
Indian Academy of Sciences (India)
During meiotic metaphase I, 13 AA bivalents and 13 D univalents are expected in the hybrid. However, only 28% of the PMCs had this expected configuration. The rest of the PMCs had between 8 and 12 bivalents and between 12 and 17 univalents. Univalents lagged at anaphase I, and at metaphase II one or a group of ...
Extraction and Characterization of Cottonseed (Gossypium) Oil
Efomah Andrew Ndudi; Orhevba Bosede Adelola
2012-01-01
This study investigated the extraction and characterization of cottonseed oil using solvent extraction method. Normal hexane was used as solvent in the extraction process. The AOAC method of Analysis was employed in the determination of the chemical, physical and proximate compositions of the oil. The chemical properties of the oil determined include the saponification value, free fatty acid, iodine value, peroxide value and acid value. The physical properties of the oil determined are viscos...
APPLICATION OF DRIP IRRIGATION ON COTTON PLANT GROWTH (Gossypium sp.
Directory of Open Access Journals (Sweden)
Syahruni Thamrin
2017-12-01
Full Text Available The condition of cotton planting in South Sulawesi is always constrained in the fulfillment of water. All plant growth stages are not optimal to increase production, so it is necessary to introduce good water management technology, such as through water supply with drip irrigation system. This study aims to analyze the strategy of irrigation management in cotton plants using drip irrigation system. Model of application by designing drip irrigation system and cotton planting on land prepared as demonstration plot. Observations were made in the germination phase and the vegetative phase of the early plants. Based on the result of drip irrigation design, the emitter droplet rate (EDR was 34.266 mm/hour with an operational time of 4.08 min/day. From the observation of cotton growth, it is known that germination time lasted from 6 to 13 days after planting, the average plant height reached 119.66 cm, with the number of leaves averaging 141.93 pieces and the number of bolls averaging 57.16 boll.
Yield and fiber quality properties of cotton (Gossypium hirsutum L ...
African Journals Online (AJOL)
Jane
2011-10-03
Oct 3, 2011 ... The experiment was laid out as a randomized split block design (RSBD) with four replications. ... classified as a drought tolerant crop as some other plants species such ..... character for textile industry and spinning technology,.
Canalization of Gene Action in the Gossypium Leaf Shape System
Indian Academy of Sciences (India)
The important, .... Canalization of gene action is important from two aspects. In the first .... indices for the heterozygotes also agree with Silow's actual figures, and it may be inferred .... demic outbreaks which often annihilate the whole stock.
Effect of nitrates on embryo induction efficiency in cotton (Gossypium ...
African Journals Online (AJOL)
Fred
cotton species (Zhang, 1994b). Somatic embryogenesis and plant regeneration systems have been established from cotton tissue, protoplasts and ovules (Zhang and Li,. 1992; Feng and Zhang, 1994; Zhang, 1995). Regeneration procedures have been used to obtain genetically modified plants after Agrobacterium- ...
Screening of cotton (gossypium hirsutum l.) genotypes for heat tolerance
International Nuclear Information System (INIS)
Abro, S.; Khan, M.A.; Sial, M.A.
2015-01-01
Cotton yield is highly affected due to biotic (diseases and pests) and abiotic (heat, dought and salinity) Stresses. Among them, high temperature is the main environmental constraint which adversely reduces cotton yield and quality. High temperature above 36 degree C affects plant growth and development especially during reproductive phase. Present studies were carried out to assess the tolerance of fifty-eight newly evolved cotton genotypes to heat stresses, based on agronomic and physiological characteristics. The genotypes were screened in field conditions under two temperature regimes. The studies were conducted at experimental farm of Nuclear Institute of Agriculture, Tando Jam, Pakistan. The results showed that March sown crop experienced high temperature (i.e. > 44 degree C in May and June), which significantly affected crop growth and productivity. The genotypes were identified as heat-tolerant on the basis of relative cell injury percentage (RCI %), heat susceptibility index (HSI) values, boll retention and seed cotton yield (kg/ha). RCI level in cotton genotypes ranged from 39.0 to 86.0%. Out of 58, seventeen genotypes (viz.NIA-80, NIA-81, NIA-83, NIA-84, NIA-M-30, NIA-M31, NIA-HM-48, NIA-HM-327, NIA-H-32, NIA-HM-2-1, NIA-Bt1, NIA-Bt2, NIA-Perkh, CRIS-342, CRIS-134, NIAB-111 and check variety Sadori indicated high level of heat tolerance at both (heat-stressed and non-stressed) temperature regimes; as shown the lowest relative injury level and relatively heat resistant index (HSI<1) values. Such genotypes could be used as heattolerant genotypes under heat-stressed environments. (author)
Genetic transformation of cry1EC gene into cotton ( Gossypium ...
African Journals Online (AJOL)
Cotton is the chief fibre crop of global importance. It plays a significant role in the national economy. Cotton crop is vulnerable to a number of insect species, especially to the larvae of lepidopteron pests. 60% insecticides sprayed on cotton are meant to control the damage caused by bollworm complex. Transgenic ...
Genetic transformation of cry1EC gene into cotton (Gossypium ...
African Journals Online (AJOL)
welcome
2013-04-10
Apr 10, 2013 ... Full Length Research Paper. Genetic ... This research work was carried out to transform ... were maintained on the same medium till somatic embryos matured. ... of secondary pests, as well as risk to human health and.
Sequencing of a Cultivated Diploid Cotton Genome-Gossypium arboreum
Institute of Scientific and Technical Information of China (English)
WILKINS; Thea; A
2008-01-01
Sequencing the genomes of crop species and model systems contributes significantly to our understanding of the organization,structure and function of plant genomes.In a `white paper' published in 2007,the cotton community set forth a strategic plan for sequencing the AD genome of cultivated upland cotton that initially targets less complex diploid genomes.This strategy banks on the high degree
Problems and achievements of cotton (Gossypium Hirsutum L. weeds control
Directory of Open Access Journals (Sweden)
T. Barakova
2017-09-01
Full Text Available Abstract. Weed control in the cultivation of cotton is critical to the yield and quality of production. The influence of economically important weeds was studied. Chemical control is the most effective method of weed control in cotton but much of the information on it relates to primary weed infestation. Problems with primary weed infestation in cotton have been solved to a significant extent. The question of secondary weed infestation with annual and perennial graminaceous weeds during the period of cotton vegetation is also determined largely by the use of antigraminaceous herbicides. The data related to herbicides to effectively control secondary germinated broadleaf weeds in conventional technology for cotton growing are quite scarce, even globally. We are still seeking effective herbicides for control of these weeds in cotton crops. Studies on their influence on the sowing characteristics of cotton seed and the quality of cotton fiber are still insufficient. In the scientific literature there is not enough information on these questions. The combinations of herbicides, as well as their tank mixtures with fertilizers or plant growth regulators are more efficient than autonomous application. Often during their combined application higher synergistic effect on yield is produced. There is information about cotton cultivars resistant to glyphosate. These cultivars are GMO and they are banned within the European Union, including Bulgaria.
Polyploidization altered gene functions in cotton (Gossypium spp.)
Cotton fibers are seed trichomes derived from individual cells of the epidermal layer of the seed coat. It has been known for a long time that a large set of genes determine the development of cotton fiber, and more recently it has been determined that these genes are distributed across the At and ...
Asymmetric evolution and domestication in allotetraploid cotton (Gossypium hirsutum L.
Directory of Open Access Journals (Sweden)
Lei Fang
2017-04-01
Full Text Available Polyploidy plays a major role in genome evolution, which corresponds to environmental changes over millions of years. The mechanisms of genome evolution, particularly during the process of domestication, are of broad interest in the fields of plant science and crop breeding. Upland cotton is derived from the hybridization and polyploidization of its ancient A and D diploid ancestors. As a result, cotton is a model for polyploid genome evolution and crop domestication. To explore the genomic mysteries of allopolyploid cotton, we investigated asymmetric evolution and domestication in the A and D subgenomes. Interestingly, more structural rearrangements have been characterized in the A subgenome than in the D subgenome. Correspondingly, more transposable elements, a greater number of lost and disrupted genes, and faster evolution have been identified in the A subgenome. In contrast, the centromeric retroelement (RT-domain related sequence of tetraploid cotton derived from the D subgenome progenitor was found to have invaded the A subgenome centromeres after allotetrapolyploid formation. Although there is no genome-wide expression bias between the subgenomes, as with expression-level alterations, gene expression bias of homoeologous gene pairs is widespread and varies from tissue to tissue. Further, there are more positively selected genes for fiber yield and quality in the A subgenome and more for stress tolerance in the D subgenome, indicating asymmetric domestication. This review highlights the asymmetric subgenomic evolution and domestication of allotetraploid cotton, providing valuable genomic resources for cotton research and enhancing our understanding of the basis of many other allopolyploids.
An evaluation of some mutant cotton (Gossypium hirsutum L ...
African Journals Online (AJOL)
user1
2013-08-14
Aug 14, 2013 ... to the high percentage of the seed oil and protein. ... Yield, yield components and fiber technological traits in .... L.) genotypes during the main growing season, from ... interaction was highly significant, indicating differential .... Combined analysis of variance of the varieties tested for yield,yield components, ...
Polyploidization effect in two diploid cotton (Gossypium herbaceum ...
African Journals Online (AJOL)
SERVER
2008-01-18
Jan 18, 2008 ... 2Department of Biology, Gorgan University of Agricultural Sciences and Natural ... examined the effects of different doses of colchicine on polyploidy ... number of stomata are generally increased in the poly- ... species; one comprising the New World (D-genome ... used for preparation of microscopic slides.
Correlations and Correlated Responses in Upland Cotton (Gossypium hirsutum L.
Directory of Open Access Journals (Sweden)
Echekwu, CA.
2001-01-01
Full Text Available Plant breeders must be concerned with the total array of economic characters in their efforts to develop a crop variety acceptable to farmers. Their selection endeavours must therefore take into consideration how changes in one trait affect, simultaneously changes in other economic attributes. The importance of correlations and correlated responses is therefore self evident in plant breeding endeavours. In this study F3 progenies from a cross between two cotton lines SAMCOT-9 x Y422 were evaluated for two years and performance data were used to obtain correlations between nine agronomic and fibre quality traits in upland cotton. The results indicated that plant helght was significantly and positively correlated with seed cotton yield, number of sympodial and monopodial branches, seed index, fibre length and micronaire index. Positive and significant correlations were also obtained between : seed cotton yield, tint percent and fibre strength and fibre length. Significant negative correlations were obtained between : plant height and lint percent ; number of monopodial branches, sympodial branches and lint percent ; fibre length, fibre strength and micronaire index. The correlated responses in the other eight traits when selection was practiced for seed cotton yield in the present study shows that it might be more profitable to practice direct selection for seed cotton yield compared to selecting for seed cotton yield through any of the other traits.
Directory of Open Access Journals (Sweden)
Yating Dong
Full Text Available Aldehyde dehydrogenases (ALDHs are a superfamily of enzymes which play important role in the scavenging of active aldehydes molecules. In present work, a comprehensive whole-genomic study of ALDH gene superfamily was carried out for an allotetraploid cultivated cotton species, G. hirsutum, as well as in parallel relative to their diploid progenitors, G. arboreum and G. raimondii. Totally, 30 and 58 ALDH gene sequences belong to 10 families were identified from diploid and allotetraploid cotton species, respectively. The gene structures among the members from same families were highly conserved. Whole-genome duplication and segmental duplication might be the major driver for the expansion of ALDH gene superfamily in G. hirsutum. In addition, the expression patterns of GhALDH genes were diverse across tissues. Most GhALDH genes were induced or repressed by salt stress in upland cotton. Our observation shed lights on the molecular evolutionary properties of ALDH genes in diploid cottons and their alloallotetraploid derivatives. It may be useful to mine key genes for improvement of cotton response to salt stress.
Directory of Open Access Journals (Sweden)
Muhammad Kashif Riaz eKhan
2016-04-01
Full Text Available A high density genetic map was constructed using F2 population derived from an interspecific cross of G. hirsutum x G. tomentosum. The map consisted of 3,093 marker loci distributed across all the 26 chromosomes and covered 4,365.3 cM of cotton genome with an average inter-marker distance of 1.48 cM. The maximum length of chromosome was 218.38 cM and the minimum was 122.09 cM with an average length of 167.90 cM. A sub-genome covers more genetic distance (2,189.01 cM with an average inter loci distance of 1.53 cM than D sub-genome which covers a length of 2,176.29 cM with an average distance of 1.43 cM. There were 716 distorted loci in the map accounting for 23.14% and most distorted loci were distributed on D sub-genome (25.06%, which were more than on A sub-genome (21.23%. In our map 49 segregation hotspots (SDR were distributed across the genome with more on D sub-genome as compared to A genome. Two post-polyploidization reciprocal translocations of A2/A3 and A4/A5 were suggested by 7 pairs of duplicate loci. The map constructed through these studies is one of the three densest genetic maps in cotton however; this is the first dense genome wide SSR interspecific genetic map between G. hirsutum and G. tomentosum.
Anti-ulcerogenic activity of the methanol root bark extract of ...
African Journals Online (AJOL)
Cochlospermum planchonii (Hook f) is a common medicinal plant used in Nigeria traditional medicine for treatment of different ailments including ulcers. The anti ulcer activity of the root bark methanol extract of Cochlospermum planchonii was evaluated using different [ethanol, acetylsalicylic acid (aspirin), cold/restraint ...
International Nuclear Information System (INIS)
Shaheen, T.; Zafar, Y.; Rahman, M.
2014-01-01
Single nucleotide polymorphism analysis is an expedient way to study polymorphisms at genomic level. In the present study we have explored Ubiquitin extension protein gene of G. arboreum (A2) and G. herbaceum (A1) of cotton which is a multiple copy gene. We have found SNPs at 16 positions in 200 bp region within A genome of cotton indicating frequency of SNPs 1/13 bp. Both sequences from cotton have shown maximum similarity with UBQ5 and UBQ6 of Arabidopsis thaliana. Sequence obtained from G. arboreum has shown SNPs at 28 positions in comparison with each UBQ5 and UBQ6 of Arabidopsis thaliana while sequence obtained from G. herbaceum has shown SNPs at 31 positions in comparison with each UBQ5 and UBQ6 of Arabidopsis thaliana. In conclusion although during pace of evolution ubiquitin extension protein genes of both A genome species have got some mutations from nature but still most of their sequence is similar. Single nucleotide polymorphism study can prove a vital tool to identify gene type in case of Multicopy genes. (author)
Monitoring cotton (Gossypium hirsutum L.) germination using ultrahigh-resolution UAS images
Examination of seed germination rate is of great importance for growers early in the season to determine the necessity for replanting their fields. The objective of this study was to explore the potential of using unmanned aircraft system (UAS)-based visible-band images to monitor and quantify the c...
Directory of Open Access Journals (Sweden)
Le Wang
2016-01-01
Full Text Available Dihydroflavanol 4-reductase (DFR is a key later enzyme involved in two polyphenols’ (anthocyanins and proanthocyanidins (PAs biosynthesis, however it is not characterized in cotton yet. In present reports, a DFR cDNA homolog (designated as GhDFR1 was cloned from developing fibers of upland cotton. Silencing GhDFR1 in cotton by virus-induced gene silencing led to significant decrease in accumulation of anthocyanins and PAs. More interestingly, based on LC-MS analysis, two PA monomers, (–-epicatachin and (–-epigallocatachin, remarkably decreased in content in fibers of GhDFR1-silenced plants, but two new monomers, (–-catachin and (–-gallocatachin were present compared to the control plants infected with empty vector. The ectopic expression of GhDFR1 in an Arabidopsis TT3 mutant allowed for reconstruction of PAs biosynthesis pathway and led to accumulation of PAs in seed coat. Taken together, these data demonstrate that GhDFR1 contributes to the biosynthesis of anthocyanins and PAs in cotton.
Genetic and DNA methylation changes in cotton (Gossypium genotypes and tissues.
Directory of Open Access Journals (Sweden)
Kenji Osabe
Full Text Available In plants, epigenetic regulation is important in normal development and in modulating some agronomic traits. The potential contribution of DNA methylation mediated gene regulation to phenotypic diversity and development in cotton was investigated between cotton genotypes and various tissues. DNA methylation diversity, genetic diversity, and changes in methylation context were investigated using methylation-sensitive amplified polymorphism (MSAP assays including a methylation insensitive enzyme (BsiSI, and the total DNA methylation level was measured by high-performance liquid chromatography (HPLC. DNA methylation diversity was greater than the genetic diversity in the selected cotton genotypes and significantly different levels of DNA methylation were identified between tissues, including fibre. The higher DNA methylation diversity (CHG methylation being more diverse than CG methylation in cotton genotypes suggest epigenetic regulation may be important for cotton, and the change in DNA methylation between fibre and other tissues hints that some genes may be epigenetically regulated for fibre development. The novel approach using BsiSI allowed direct comparison between genetic and epigenetic diversity, and also measured CC methylation level that cannot be detected by conventional MSAP.
Genetic and DNA methylation changes in cotton (Gossypium) genotypes and tissues.
Osabe, Kenji; Clement, Jenny D; Bedon, Frank; Pettolino, Filomena A; Ziolkowski, Lisa; Llewellyn, Danny J; Finnegan, E Jean; Wilson, Iain W
2014-01-01
In plants, epigenetic regulation is important in normal development and in modulating some agronomic traits. The potential contribution of DNA methylation mediated gene regulation to phenotypic diversity and development in cotton was investigated between cotton genotypes and various tissues. DNA methylation diversity, genetic diversity, and changes in methylation context were investigated using methylation-sensitive amplified polymorphism (MSAP) assays including a methylation insensitive enzyme (BsiSI), and the total DNA methylation level was measured by high-performance liquid chromatography (HPLC). DNA methylation diversity was greater than the genetic diversity in the selected cotton genotypes and significantly different levels of DNA methylation were identified between tissues, including fibre. The higher DNA methylation diversity (CHG methylation being more diverse than CG methylation) in cotton genotypes suggest epigenetic regulation may be important for cotton, and the change in DNA methylation between fibre and other tissues hints that some genes may be epigenetically regulated for fibre development. The novel approach using BsiSI allowed direct comparison between genetic and epigenetic diversity, and also measured CC methylation level that cannot be detected by conventional MSAP.
Influence of bleach activators on the fabric made from cotton (gossypium hamster l.)
International Nuclear Information System (INIS)
Asif, H.M.; Iftikhar, M.; Shahbaz, B.
2013-01-01
Raw cotton contains various type of trash and most of the impurities are removed during the spinning process but still the cotton fabric coming from the weaving or knitting process always contains some impurities. Some time cotton fabric gets the oil, stains and coloured materials which affect the quality of dyed fabric. Bleaching is a process that eliminates unwanted coloured matters from the fibres, yarn and fabrics. A bleaching agent is a material that lightens or whitens a substrate through chemical action. Hydrogen peroxide is by far the most commonly used oxidative bleaching agent for cotton and its blends, accounting for more than 90 percent of all the bleaching agents. The use of activators to enhance the bleaching performance of hydrogen peroxide for cellulosic materials has gained popularity now a day. In this context the main objectives of this paper are to study the influence of different bleaching activators on cotton fabric and to give implications for textile extension.The results indicate that the activators with different concentrations, along with different concentrations of hydrogen peroxide (H/sub 2/O/sub 2) have significant influence on the bleaching performance of cotton fabric. (author)
Directory of Open Access Journals (Sweden)
Eminur ELÇİ
2016-09-01
Full Text Available Cotton is an important crop in terms of economic and strategic impacts. Drought stress is one of the most important environmental stress factors which negatively affects growth and yield of plants in Turkey as occurred in many countries in the world. In this study, 11 different cotton cultivars selected based on their agronomical characters were tested under water deficit irrigation strategies. Thus, it was aimed to select and/or determine appropriate new varieties for breeding new national materials resistant to drought stress, and to characterize with the molecular microsatellite markers. According to the different irrigation levels (25%, 50%, 75% and 100% plants were observed under the stressed conditions at the irrigation levels of 50% and 25%. Among the tested varieties, Tamcot Sphinx, Tamcot 94, Tamcot CamdEs and BA525 varieties were found to be more water stress tolerant than others in terms of germination time and germinated plant. The UPGMA (Unweighted Pair-Group Method Using Arithmetic Averages analysis was carried out using 28 markers with average 0.306 polymorphism information content (PIC for molecular characterization studies. Based on the UPGMA results, the varieties were clustered into two groups. It is expected that the results obtained from this study might provide considerable data for improving new drought tolerant varieties.
Herbicide-resistant cotton (Gossypium hirsutum) plants: an alternative way of manual weed removal.
Latif, Ayesha; Rao, Abdul Qayyum; Khan, Muhammad Azmat Ullah; Shahid, Naila; Bajwa, Kamran Shehzad; Ashraf, Muhammad Aleem; Abbas, Malik Adil; Azam, Muhammad; Shahid, Ahmad Ali; Nasir, Idrees Ahmad; Husnain, Tayyab
2015-09-17
Cotton yield has been badly affected by different insects and weed competition. In Past Application of multiple chemicals is required to manage insects and weed control was achieved by different conventional means, such as hand weeding, crop rotation and polyculture, because no synthetic chemicals were available. The control methods shifted towards high input and target-oriented methods after the discovery of synthetic herbicide in the 1930s. To utilise the transgenic approach, cotton plants expressing the codon-optimised CEMB GTGene were produced in the present study. Local cotton variety CEMB-02 containing Cry1Ac and Cry2A in single cassette was transformed by synthetic codon-optimised 5-enolpyruvylshikimate-3-phosphate synthase gene cloned into pCAMBIA 1301 vector under 35S promoter with Agrobacterium tumifaciens. Putative transgenic plants were screened in MS medium containing 120 µmol/L glyphosate. Integration and expression of the gene were evaluated by PCR from genomic DNA and ELISA from protein. A 1.4-kb PCR product for Glyphosate and 167-bp product for Cry2A were obtained by amplification through gene specific primers. Expression level of Glyphosate and Bt proteins in two transgenic lines were recorded to be 0.362, 0.325 µg/g leaf and 0.390, 0.300 µg/g leaf respectively. FISH analysis of transgenic lines demonstrates the presence of one and two copy no. of Cp4 EPSPS transgene respectively. Efficacy of the transgene Cp4 EPSPS was further evaluated by Glyphosate spray (41 %) assay at 1900 ml/acre and insect bioassay which shows 100 %mortality of insect feeding on transgenic lines as compared to control. The present study shows that the transgenic lines produced in this study were resistant not only to insects but also equally good against 1900 ml/acre field spray concentration of glyphosate.
Gamma ray induced diversity in restorer line of cotton (Gossypium Hirsutum)
International Nuclear Information System (INIS)
Mehetre, S.S.; Patil, V.R.; Surana, P.P.
2000-01-01
Looking to the limitation of very few restorers available in cotton a diversification of available restorer line was undertaken by gamma irradiation. The four hundred individual plants selected from individual M 2 families were crossed with CMS lines. Out of which 12 plants restored fertility in CMS lines and their F 1 's with CMS produced more heterotic hybrids than their checks (control). The results indicated that sufficient variability can be induced with the help of gamma rays and the diversification of restorers is possible within a short period with simultaneous improvement in either one or two characters. (author)
International Nuclear Information System (INIS)
Akhtar, N.; Iqbal, A.; Qureshi, M.A.; Khan, K.H
2010-01-01
Phosphate solubilizing bacteria (PSB) and plants have symbiotic relationship, as bacteria provide soluble phosphate for the plants and plants supply root borne carbon compounds which can be metabolized for bacterial growth. PSB solubilize the applied and fixed soil phosphorus resulting in higher crop yield. Intensive cropping has resulted in wide spread deficiency of Phosphorus in our soils and situation is becoming more serious because of a drastic increase in the cost of phosphatic fertilizers. Keeping in view the capabilities of microbes (Bacillus sp.), a field experiment was conducted on cotton at farmer field district Faisalabad in 2008. Effect of PSM (Bacillus spp.) was studied at three phosphorus levels i.e.20, 40 and 60 kg ha-l while N was applied at recommended dose (120 kg ha/sup -1/). Bacillus spp. was applied as seed coating to the cotton crop (Var. BT 121). Recommended plant protection measures were adopted. Results revealed that Bacillus spp. significantly increased the seed cotton yield; number of boll plant-I, boll weight, plant height, GOT (%), staple length, plant P and available P in the soil. Maximum seed cotton yield 4250 kg ha/sup -l/ was obtained with Bacillus inoculation along with 60 kg of P followed by 4162 kg ha/sup -1/ with Bacillus inoculation and 40 kg of P compared with their respective controls i.e.4093 and 3962 kg ha/sup -1/ respectively. Soil P was improved from 8.1 to 9.5 ppm by Bacillus inoculation. Phosphorus in plant matter was also higher (0.39%) as compare with control (0.36%). Rhizosphere soil pH was found slightly decreased (8.12 to 8.0) by Bacillus inoculation compare with control. It is concluded that PSB inoculation not only exerts beneficial effect on crop growth but also enhances the phosphorus concentration in the plant and soil. (author)
Modeling cotton (Gossypium spp) leaves and canopy using computer aided geometric design (CAGD)
The goal of this research is to develop a geometrically accurate model of cotton crop canopies for exploring changes in canopy microenvironment and physiological function with leaf structure. We develop an accurate representation of the leaves, including changes in three-dimensional folding and orie...
CRISPR/Cas9-mediated targeted mutagenesis in upland cotton (Gossypium hirsutum L.).
Janga, Madhusudhana R; Campbell, LeAnne M; Rathore, Keerti S
2017-07-01
The clustered, regularly interspaced, short palindromic repeats (CRISPR)/CRISPR associated (Cas)9 protein system has emerged as a simple and efficient tool for genome editing in eukaryotic cells. It has been shown to be functional in several crop species, yet there are no reports on the application of this or any other genome editing technologies in the cotton plant. Cotton is an important crop that is grown mainly for its fiber, but its seed also serves as a useful source of edible oil and feed protein. Most of the commercially-grown cotton is tetraploid, thus making it much more difficult to target both sets of homeologous alleles. Therefore, in order to understand the efficacy of the CRISPR/Cas9 system to target a gene within the genome of cotton, we made use of a transgenic cotton line previously generated in our laboratory that had a single copy of the green fluorescent protein (GFP) gene integrated into its genome. We demonstrate, for the first time, the use of this powerful new tool in targeted knockout of a gene residing in the cotton genome. By following the loss of GFP fluorescence, we were able to observe the cells that had undergone targeted mutations as a result of CRISPR/Cas9 activity. In addition, we provide examples of the different types of indels obtained by Cas9-mediated cleavage of the GFP gene, guided by three independent sgRNAs. The results provide useful information that will help us target important native genes in the cotton plant in future.
Mining and Analysis of SNP in Response to Salinity Stress in Upland Cotton (Gossypium hirsutum L.).
Wang, Xiaoge; Lu, Xuke; Wang, Junjuan; Wang, Delong; Yin, Zujun; Fan, Weili; Wang, Shuai; Ye, Wuwei
2016-01-01
Salinity stress is a major abiotic factor that affects crop output, and as a pioneer crop in saline and alkaline land, salt tolerance study of cotton is particularly important. In our experiment, four salt-tolerance varieties with different salt tolerance indexes including CRI35 (65.04%), Kanghuanwei164 (56.19%), Zhong9807 (55.20%) and CRI44 (50.50%), as well as four salt-sensitive cotton varieties including Hengmian3 (48.21%), GK50 (40.20%), Xinyan96-48 (34.90%), ZhongS9612 (24.80%) were used as the materials. These materials were divided into salt-tolerant group (ST) and salt-sensitive group (SS). Illumina Cotton SNP 70K Chip was used to detect SNP in different cotton varieties. SNPv (SNP variation of the same seedling pre- and after- salt stress) in different varieties were screened; polymorphic SNP and SNPr (SNP related to salt tolerance) were obtained. Annotation and analysis of these SNPs showed that (1) the induction efficiency of salinity stress on SNPv of cotton materials with different salt tolerance index was different, in which the induction efficiency on salt-sensitive materials was significantly higher than that on salt-tolerant materials. The induction of salt stress on SNPv was obviously biased. (2) SNPv induced by salt stress may be related to the methylation changes under salt stress. (3) SNPr may influence salt tolerance of plants by affecting the expression of salt-tolerance related genes.
Current status of genetic engineering in cotton (Gossypium hirsutum L): an assessment.
Chakravarthy, Vajhala S K; Reddy, Tummala Papi; Reddy, Vudem Dashavantha; Rao, Khareedu Venkateswara
2014-06-01
Cotton is considered as the foremost commercially important fiber crop and is deemed as the backbone of the textile industry. The productivity of cotton crop, worldwide, is severely hampered by the occurrence of pests, weeds, pathogens apart from various environmental factors. Several beneficial agronomic traits, viz., early maturity, improved fiber quality, heat tolerance, etc. have been successfully incorporated into cotton varieties employing conventional hybridization and mutation breeding. Crop losses, due to biotic factors, are substantial and may be reduced through certain crop protection strategies. In recent years, pioneering success has been achieved through the adoption of modern biotechnological approaches. Genetically engineered cotton varieties, expressing Bacillus thuringiensis cry genes, proved to be highly successful in controlling the bollworm complex. Various other candidate genes responsible for resistance to insect pests and pathogens, tolerance to major abiotic stress factors such as temperature, drought and salinity, have been introduced into cotton via genetic engineering methods to enhance the agronomic performance of cotton cultivars. Furthermore, genes for improving the seed oil quality and fiber characteristics have been identified and introduced into cotton cultivars. This review provides a brief overview of the various advancements made in cotton through genetic engineering approaches.
Ma, Xiaoyan; Wu, Hanwen; Jiang, Weili; Ma, Yajie; Ma, Yan
2015-01-01
Redroot pigweed is one of the injurious agricultural weeds on a worldwide basis. Understanding of its interference impact in crop field will provide useful information for weed control programs. The effects of redroot pigweed on cotton at densities of 0, 0.125, 0.25, 0.5, 1, 2, 4, and 8 plants m(-1) of row were evaluated in field experiments conducted in 2013 and 2014 at Institute of Cotton Research, CAAS in China. Redroot pigweed remained taller and thicker than cotton and heavily shaded cotton throughout the growing season. Both cotton height and stem diameter reduced with increasing redroot pigweed density. Moreover, the interference of redroot pigweed resulted in a delay in cotton maturity especially at the densities of 1 to 8 weed plants m(-1) of row, and cotton boll weight and seed numbers per boll were reduced. The relationship between redroot pigweed density and seed cotton yield was described by the hyperbolic decay regression model, which estimated that a density of 0.20-0.33 weed plant m(-1) of row would result in a 50% seed cotton yield loss from the maximum yield. Redroot pigweed seed production per plant or per square meter was indicated by logarithmic response. At a density of 1 plant m(-1) of cotton row, redroot pigweed produced about 626,000 seeds m(-2). Intraspecific competition resulted in density-dependent effects on weed biomass per plant, a range of 430-2,250 g dry weight by harvest. Redroot pigweed biomass ha(-1) tended to increase with increasing weed density as indicated by a logarithmic response. Fiber quality was not significantly influenced by weed density when analyzed over two years; however, the fiber length uniformity and micronaire were adversely affected at density of 1 weed plant m(-1) of row in 2014. The adverse impact of redroot pigweed on cotton growth and development identified in this study has indicated the need of effective redroot pigweed management.
Nehra, Vibha; Saharan, Baljeet Singh; Choudhary, Madhu
2016-01-01
The present investigation was undertaken to isolate, screen and evaluate a selected promising PGPR Brevibacillus brevis on cotton crop. Out of 156 bacterial isolates one of the most promising isolate was analyzed for the various PGP traits. A seed germination analysis was conducted with cotton seeds to evaluate the potential of the isolate to promote plant growth. The bacterial isolate was checked for its growth and survival at high temperatures. The isolate was also analyzed for the PGP traits exhibited after the heat treatment. To identify the isolate morphological, biochemical and molecular characterization was performed. The isolate was found positive for many of the PGP attributes like IAA, ARA, anti-fungal activity and ammonia production. Effect of seed bacterization on various plant growth parameters was used as an indicator. The isolate showed significant growth and exhibited various PGP traits at high temperature making it suitable as an inoculant for cotton crop. Isolate was identified as Brevibacillus brevis [SVC(II)14] based on phenotypic as well as genotypic attributes and after conducting this research we propose that the B. brevis which is reported for the first time for its PGP potential in cotton, exerts its beneficial effects on cotton crop through combined modes of actions.
Study of gene flow from GM cotton (Gossypium hirsutum) varieties in El Espinal (Tolima, Colombia)
International Nuclear Information System (INIS)
Rache Cardenal, Leidy Yanira; Mora Oberlaender, Julian; Chaparro Giraldo, Alejandro
2013-01-01
In 2009, 4088 hectares of genetically modified (GM) cotton were planted in Tolima (Colombia), however there is some uncertainty about containment measures needed to prevent the flow of pollen and seed from regulated GM fields into adjacent fields. In this study, the gene flow from GM cotton varieties to conventional or feral cotton plants via seed and pollen was evaluated. ImmunostripTM, PCR and ELISA assays were used to detect gene flow. Fifty six refuges, 27 fields with conventional cotton and four feral individuals of the enterprise Remolinos Inc. located in El Espinal (Tolima) were analyzed in the first half of 2010. The results indicated seed mediated gene flow in 45 refuges (80.4 %) and 26 fields with conventional cotton (96 %), besides pollen mediated gene flow in one field with conventional cotton and nine refuges. All fields cultivated with conventional cotton showed gene flow from GM cotton. Two refuges and two feral individuals did not reveal gene flow from GM cotton.
Inheritance of the ovule fuzzless trait for Gossypium arboreum germplasm line PI 529708
Background: Cotton is the most important fiber crop and understanding the genetic mechanisms controlling fiber production on cotton seeds can aid in the development of improved varieties with higher lint yields and improved fiber quality. Lint and fuzz are the two types of fiber produced on the cott...
Induced variants in cotton (Gossypium Hirsutum L.) by in vitro mutagenesis
International Nuclear Information System (INIS)
Muthusamy, A.; Jayabalan, N.
2000-01-01
The shoot tips (3-5mm) of cotton were isolated from five day old in vitro grown seedlings and it contained two small unexpanded leaves approximately 1.0 mm along with cotyledons and the cotyledons were removed before the treatment with mutagens. The shoot tip alone was treated with 1-5 kR doses of gamma rays from 60C o source at Sugarcane Breeding Institute (ICAR), Coimbatore, Tamil Nadu and 1-5 mM of ethyl methane sulphonate (EMS) and sodium azide (SA) for 30 min. at pH 6 and 3 respectively. The treated shoot tips were inoculated on MS medium supplemented with 0.1 mg/l KIN, l-inositol 100 mg/l, thiamine HCI 1.0 mg/l, sucrose 30 g/l and agar 8 g/l. During the development of shoots, a number of leaf mutants with narrow, tubular, bilobed and multilobed leaves was observed. The plants also showed the best performance in number of branches, leaf area and yield characters than control. The morphological variants obtained due to mutagenic treatment in the present investigation showed high frequency with increasing doses of mutagens. Compared with somatic cell culture of cotton, shoot and meristem culture is an easier method to obtain regenerative plants. The in vitro induction of mutations has also potential application in the development of disease-resistant plants through tissue culture. (author)
Genetic study of various agronomic traits in cotton (Gossypium hirsutum L.)
International Nuclear Information System (INIS)
Ashraf, F.; Khan, I.A.; Ahmed, S.
2009-01-01
The use of already existing genetic variability in the breeding material, as well as, the creation of new variability along with the genetic understanding of various agronomic traits is of crucial importance, in order to develop potential sources of cotton. For this purpose, 5 X 6 complete diallel cross experiment was conducted during 2003-04, involving 5 strains i.e. VH-55, MNH-516, ACALA-SJ-4, A-8100 and CRIS-420, to evaluate gene-action, general and specific combining ability for number of sympodial branches, number of monopodial branches, plant height, number of bolls per plant, boll weight and yield of seed cotton. Additive type of gene action, with partial dominance for all the traits studied, was observed. Most dominant genes for boll weight, yield of seed-cotton, and number of sympodial branches were observed in CRIS-420, while maximum dominant genes for number of monopodial branches, plant height were observed in ACALA-SJ-4. Variety VH-55 carried maximum dominant genes for number of bolls per plant. Recessive genes for the number of sympodial branches, number of monopodial branches, plant height, number of bolls per plant and yield of seed-cotton, were exhibited by MNH-516. The variety ACAU-SJ-4 showed harmonius combination for bolls per plant and yield of seed-cotton, whereas CRIS- 420 was found a good general combiner for plant height and number of sympodial branches. (author)
International Nuclear Information System (INIS)
Hussain, A.
2014-01-01
Periodic flooding at any growth stage greatly affects growth and yield of crops. In order to develop flooding tolerant cotton cultivar and to identify the most sensitive growth stage to periodic flooding, a field experiment was conducted in which 60-cultivars/accessions/lines were subjected to two week flooding at seedling/early vegetative, flower and boll formation growth stages. Pre- and post-flooding soil analysis was also carried out. Nitrate-N was greatly reduced due to flooding applied at all growth stages, whereas NH4-N increased significantly. Similarly, Fe and Mn were also increased to many folds in flooded soils. Under hypoxic conditions, depletion of nitrates and toxic effects of accumulated NH4, Fe and Mn caused severe damages to cotton plants and even death of plants. Of the three growth stages, early vegetative growth stage is most sensitive to two week flooding. Flooding imposed at the flowering and boll formation growth stages caused a substantial amount of yield penalty. On the basis of survival percentage, the 60-cultivars/accessions/lines were categorized into tolerant (61%), moderately tolerant (31=60%) and sensitive (31%) to short term flooding. At the seedling or early vegetative growth stage, genotypes DPL-SR-2 followed by 124-F and MNH-427 were most tolerant to flooding, while AET-5, N-KRISHMA, LRA-5166, CEDIX and H-142 were ranked as sensitive to flooding stress. At the flowering stage, the genotype NIAB-92 followed by S-14 and MNH-427 were highly tolerant to flooding. At the boll formation stage, genotypes DPL-70010-N followed by GH-11-9-75 and B-2918-2 were highly tolerant waterlogging. More than 50% of the genotypes maintained the degree of flooding tolerance at three growth stages. However, on the basis of survival percentage at three growth stages, genotypes MNH-564, FH-114, MNH-786 and CIM-573 were included in the tolerant group and the genotypes N-KRISHMA, LRA-5166, CEDIX and H-142 were included in the sensitive group. These genotypes/cultivars maintaining high degree of stress tolerance at different growth stages are of considerable importance for the development of tolerant cultivar. (author)
Carter, William W.
1982-01-01
The degree of resistance by a cotton plant to Meloidogyne incognita is affected by soil temperature, particularly in moderately resistant cultivars, The total number of nematodes in the resistant and moderately resistant rools at 35 C was equal to, or greater than, the number in susceptible roots at 20, 25, or 30 C. A shift in numbers to developing and egg-bearing forms of nematodes in the susceptible cultivar as tentperature increased indicates development was affected by temperature rather ...
Gamma irradiation of the interspecific hybrids Gossypium hirsutum L. x G. barbadense L. Part 1
International Nuclear Information System (INIS)
Stoilova, A.
1990-01-01
The study was aimed at combining the methods of hybridization and experimental mutagenesis and widening the possibilities of interspecific hybridization for successful breeding work. The reaction of interspecific cotton hybrids (G. hirsutum x G. barbadense) to gamma rays in the year of treatment was investigated. Four hybrid combinations resulting from reciprocal crosses between the two species were studied. Seeds of long fibre F 1 plants from each combination were divided in four equal parts (irradiated with 15, 20 and 25 krad and a control). The changes in the main biometrical indices between the control and maximum dose (25 krad) treatment showed that the F 2 hybrids were either resistant or slightly sensitive to irradiation depending on the direction of crossing in respect to growth processes, field germination and survival to the end of vegetation. 3 tabs., 2 figs., 14 refs
Global gene expression in cotton (Gossypium hirsutum L. leaves to waterlogging stress.
Directory of Open Access Journals (Sweden)
Yanjun Zhang
Full Text Available Cotton is sensitive to waterlogging stress, which usually results in stunted growth and yield loss. To date, the molecular mechanisms underlying the responses to waterlogging in cotton remain elusive. Cotton was grown in a rain-shelter and subjected to 0 (control-, 10-, 15- and 20-d waterlogging at flowering stage. The fourth-leaves on the main-stem from the top were sampled and immediately frozen in liquid nitrogen for physiological measurement. Global gene transcription in the leaves of 15-d waterlogged plants was analyzed by RNA-Seq. Seven hundred and ninety four genes were up-regulated and 1018 genes were down-regulated in waterlogged cotton leaves compared with non-waterlogged control. The differentially expressed genes were mainly related to photosynthesis, nitrogen metabolism, starch and sucrose metabolism, glycolysis and plant hormone signal transduction. KEGG (Kyoto Encyclopedia of Genes and Genomes analysis indicated that most genes related to flavonoid biosynthesis, oxidative phosphorylation, amino acid metabolism and biosynthesis as well as circadian rhythm pathways were differently expressed. Waterlogging increased the expression of anaerobic fermentation related genes, such as alcohol dehydrogenase (ADH, but decreased the leaf chlorophyll concentration and photosynthesis by down-regulating the expression of photosynthesis related genes. Many genes related to plant hormones and transcription factors were differently expressed under waterlogging stress. Most of the ethylene related genes and ethylene-responsive factor-type transcription factors were up-regulated under water-logging stress, suggesting that ethylene may play key roles in the survival of cotton under waterlogging stress.
Responses of physiological and biochemical components in Gossypium hirsutum L. to mutagens
International Nuclear Information System (INIS)
Muthusamy, A.; Vasanth, K.; Jayabalan, N.
2003-01-01
The two tetraploid varieties of cotton were exposed to gamma rays, EMS and SA. Chlorophyll, carotenoids, sugar, starch, free amino acids, protein, lipids, DNA and RNA were estimated quantitatively. All the physiological and biochemical components were increased in lower dose/concentration of the mutagenic treatments and they were decreased in higher dose/concentrations. The stimulation of the biochemical contents was a dose/concentration dependent response. Among the two varieties, MCU 11 was found to be responsive to mutagens than MCU 5. Based on the study the lower dose/concentration of the mutagenic treatments could enhance the biochemical components which is used for improved economic characters of cotton. (author)
Sethi, Khushboo; Siwach, Priyanka; Verma, Surender Kumar
2015-10-01
Among the four cultivated cotton species, G. hirsutum (allotetraploid) presently holds a primary place in cultivation. Efforts to further improve this primary cotton face the constraints of its narrow genetic base due to repeated selective breeding and hence demands enrichment of diversity in the gene pool. G. arboreum (diploid species) is an invaluable genetic resource with great potential in this direction. Based on the dispersal and domestication in different directions from Indus valley, different races of G. arboreum have evolved, each having certain traits like drought and disease resistance, which the tetraploid cotton lack. Due to lack of systematic, race wise characterization of G. arboreum germplasm, it has not been explored fully. During the present study, 100 polymorphic SSR loci were used to genotype 95 accessions belonging to 6 races of G. arboreum producing 246 polymorphic alleles; mean number of effective alleles was 1.505. AMOVA showed 14 % of molecular variance among population groups, 34 % among individuals and remaining 52 % within individuals. UPGMA dendrogram, based on Nei's genetic distance, distributed the six populations in two major clusters of 3 populations each; race 'bengalense' was found more close to 'cernuum' than the others. The clustering of 95 genotypes by UPGMA tree generation as well as PCoA analysis clustered 'bengalense' genotypes into one group along with some genotypes of 'cernuum', while rest of the genotypes made separate clusters. Outcomes of this research should be helpful in identifying the genotypes for their further utilization in hybridization program to obtain high level of germplasm diversity.
Expression analysis of fiber related genes in cotton (gossypium hirsutum l.) through real time pcr
International Nuclear Information System (INIS)
Iqbal, N.; Khatoon, A.; Asif, M.; Bashir, A.
2016-01-01
Cotton fibers are unicellular seed trichomes and the largest known plant cells. Fiber morphogenesis in cotton is a complex process involving a large number of genes expressed throughout fiber development process. The expression profiling of five gene families in various cotton tissues was carried out through real time PCR. Expression analysis revealed that transcripts of expansin, tubulin and E6 were elevated from 5 to 20 days post anthesis (DPA) fibers. Three Lipid transfer proteins (LTPs) including LTP1, LTP3, LTP7 exhibited highest expression in 10 - 20 DPA fibers. Transcripts of LTP3 were detected in fibers and non fiber tissues that of LTP7 were almost negligible in non fiber tissues. Sucrose phosphate synthase gene showed highest expression in 10 DPA fibers while sucrose synthse (susy) expressed at higher rate in 5-20 DPA fibers as well as roots. The results reveal that most of fiber related genes showed high expression in 5-20 DPA fibers. Comprehensive expression study may help to determine tissue and stage specificity of genes under study. The study may also help to explore complex process of fiber development and understand the role of these genes in fiber development process. Highly expressed genes in fibers may be transformed in cotton for improvement of fiber quality traits. Genes that were expressed specifically in fibers or other tissues could be used for isolation of upstream regulatory sequences. (author)
Genome-wide functional analysis of cotton (Gossypium hirsutum in response to drought.
Directory of Open Access Journals (Sweden)
Yun Chen
Full Text Available Cotton is one of the most important crops for its natural textile fibers in the world. However, it often suffered from drought stress during its growth and development, resulting in a drastic reduction in cotton productivity. Therefore, study on molecular mechanism of cotton drought-tolerance is very important for increasing cotton production. To investigate molecular mechanism of cotton drought-resistance, we employed RNA-Seq technology to identify differentially expressed genes in the leaves of two different cultivars (drought-resistant cultivar J-13 and drought-sensitive cultivar Lu-6 of cotton. The results indicated that there are about 13.38% to 18.75% of all the unigenes differentially expressed in drought-resistant sample and drought-sensitive control, and the number of differentially expressed genes was increased along with prolonged drought treatment. DEG (differentially expression gene analysis showed that the normal biophysical profiles of cotton (cultivar J-13 were affected by drought stress, and some cellular metabolic processes (including photosynthesis were inhibited in cotton under drought conditions. Furthermore, the experimental data revealed that there were significant differences in expression levels of the genes related to abscisic acid signaling, ethylene signaling and jasmonic acid signaling pathways between drought-resistant cultivar J-13 and drought-sensitive cultivar Lu-6, implying that these signaling pathways may participate in cotton response and tolerance to drought stress.
Genetic analysis of some agronomic traits (gossypium hamster L.) in cotton
International Nuclear Information System (INIS)
Zulqarnain, M.; Khan, I.A.; Shakeel, T.; JAfri, J.S.
1998-01-01
Four varieties of cotton were crossed in a complete diallel fashion to evaluate the mode of inheritance of different agronomic traits. Height of main stem, number of bolls per plant, boll weight and yield of seed cotton per plant appeared to be controlled by additive with partial dominance type of gene action. While number of seeds per boll was controlled by over dominance type of gene action. Variety MNH-93 possessed dominant genes for height of main stem, number of bolls per plant number of seeds per boll and yield of seed cotton per plant. AMSI-38 carried dominant genes for boll weight and recessive for number of bolls per plant, number of seeds per boll and boll weight. Height of main stem and yield of seed cotton were controlled by recessive genes in Variety AMSI-38. (author)
The natural refuge policy for Bt cotton (Gossypium L. in Pakistan – a situation analysis
Directory of Open Access Journals (Sweden)
Muhammad Sajjad Ali
2013-07-01
Full Text Available Bt cotton (event Cry1Ac was formally commercialized in Pakistan in 2010. However, there has been an increasing trend of planting unauthorized Bt cotton germplasm in farmers' fields since 2003 with a high rate of adoption in the core cotton areas especially in the province Punjab. The transgenic cotton technology has provided the growers with substantial economic benefits and has reduced their dependence on pesticides for pest control, especially against Helicoverpa armigera (Hubner. However, keeping in view the capacity of this insect to develop resistance against novel chemical formulations, it is easily speculated that Bt toxin, too, is no exception. Refuge crop policy for mono transgenic crop events has helped in delaying the rate of resistance evolution in the target pests. Thus, in Pakistan, where planting of structured refuge crops along Bt cotton fields is not mandatory, the effectiveness and durability of Bt cotton technology may decrease due to a number of factors which are discussed in this review.
Effets du stress salin sur la germination des graines de Gossypium ...
African Journals Online (AJOL)
SARAH
31 août 2014 ... herbeuses et vives tandis que 40 % des graines ont germé sur tanne arbustive en milieu réel. Conclusion et application: l'objectif général de cette étude menée en milieu contrôlé (application des doses de sel) et en milieu réel (tannes) était de montrer les effets du stress salin sur la germination des graines.
Wäckers, F.L.; Bonifay, C.
2004-01-01
Plants employ nectar for two distinct functions. Floral nectar has traditionally been viewed in the context of pollination. Extrafloral nectar on the other hand, can act as an indirect defense, allowing the plant to recruit predators and parasitoids. Whereas this makes for a clear-cut categorization, in reality the functions may not be so discrete. Extrafloral nectar may serve a role in pollination, while floral nectar can be utilized by predators and parasitoids and thus can contribute to pl...
Wäckers, F.L.; Bonifay, C.
2004-01-01
Plants employ nectar for two distinct functions. Floral nectar has traditionally been viewed in the context of pollination. Extrafloral nectar on the other hand, can act as an indirect defense, allowing the plant to recruit predators and parasitoids. Whereas this makes for a clear-cut
Whole linted cottonseed meal (Gossypium hirsutum L. protein and fiber degradability in the rumen
Directory of Open Access Journals (Sweden)
Deborah Clea Ruy
1996-12-01
3 x 3 change-over design to evaluate the following treatments: A = 0% WLC; B = 6.6% WLC; and C = 15.0% WLC. Sorghum silage contributed with 70% in all three treatments. DM degradability at 48h incubation time was statistically different (p < 0.05 (A = 54.4%; B = 54.2% and C = 58.7%, as well as PB degradability at 12h (A = 40.3%; B = 47.7% and C = 53.1% and ADF degradability at 48h (A = 40.3%; B = 41.2% and C = 45.6%. Ruminal volume, turn overtime and ruminal pH weren’t affected by the experimental diets. Substitution of WLC for cottonseed meal up to 15% diet increased degradability of DM, CP and ADF of WLC.
Seed protein electrophoresis for identification of fine fibre cotton line in Gossypium hirsutum L
International Nuclear Information System (INIS)
Gao Guoqiang; Lv Tiexin; Su Xuehe; Liu Xiaoyong; Wu Defang; Zhu Doubei
2003-01-01
Gel electrophoresis was conducted to test seed ethanol resolvable protein in cotton. 13 lines were used, including a fine fibre cotton line (98301) in G. hirsutum L., 4 varieties in G. barbadense L. and 8 varieties in G. hirsutum L.. In results of the 98301 line, Zhongmiansuo 12 and Shiyuan 321, no different protein electro-phoresis band pattern was shown among different seeds belong to the same variety, respectively. In comparison among the 98301 seeds sampled from seven different growth sets in Shandong province, their protein band patterns were the same. On the gel plate, three special bands were distinctive to all the varieties in G. hirsutum L. and other three special bands were distinctive to all the varieties in G. barbadense L.. The three characteristic bands of G. hirsutum L. appeared in the protein band pattern of the 98301 line. It showed that the seed protein composition of the line was inclined to G. hirsutum L. mainly. And, a characteristic band of G. Barbadense L. in the band pattern of the 98301 line proved that the fine fibre cotton line derived from a hybrid between G. barbadense and G. hirsutum L.. The 98301 line was easily distinguished from other varieties in G. hirsutum L. by its distinctive band, i.e. band No.1, and another island cotton band, i.e. band No.10
Identification and characterization of microRNAs in Asiatic cotton (Gossypium arboreum L..
Directory of Open Access Journals (Sweden)
Min Wang
Full Text Available To date, no miRNAs have been identified in the important diploid cotton species although there are several reports on miRNAs in upland cotton. In this study, we identified 73 miRNAs, belonging to 49 families, from Asiatic cotton using a well-developed comparative genome-based homologue search. Several of the predicted miRNAs were validated using quantitative real time PCR (qRT-PCR. The length of miRNAs varied from 18 to 22 nt with an average of 20 nt. The length of miRNA precursors also varied from 46 to 684 nt with an average of 138 ±120 nt. For a majority of Asiatic cotton miRNAs, there is only one member per family; however, multiple members were identified for miRNA 156, 414, 837, 838, 1044, 1533, 2902, 2868, 5021 and 5142 families. Nucleotides A and U were dominant, accounted for 62.95%, in the Asiatic cotton pre-miRNAs. The Asiatic cotton pre-miRNAs had high negative minimal folding free energy (MFE and adjusted MFE (AMFE and high MFE index (MFEI. Many miRNAs identified in Asiatic cotton suggest that miRNAs also play a similar regulatory mechanism in diploid cotton.
Influence of mutagens on enzymes of germinating seeds of cotton (Gossypium hirsutum L.)
International Nuclear Information System (INIS)
Muthusamy, A.; Jayabalan, N.; Juliana, B.
2000-01-01
The activities of the enzymes amylases, protease and phosphatases were studied in cotton during germination. The seeds were treated with 100-500 Gy of gamma rays, 10-50 mM of EMS, CA and SA in two cultivated varieties viz.. MCU 5 and MCU 11. Activity pattern of amylases, protease and phosphatases in treated seeds were significantly altered from controls. The alteration were positively correlated with increasing dose/concentration of mutagens up to 300 Gy of gamma rays and 30 mM of EMS, CA and SA. The present study pave the ways to discuss the importance of the enzymes and mutagens in germination of cotton seeds. (author)
Muthusamy, Annamalai; Jayabalan, Narayanasamy
2014-12-01
The purpose of the investigation was to induce somaclonal variations by gamma rays (GR), ethylmethane sulphonate (EMS) and sodium azide (SA) during in vitro organogenesis of cotton. The shoot tip explants were irradiated with 5-50 Gray (Gy) GR (Cobalt 60), 0.5-5.0 mM EMS and SA separately, and inoculated on Murashige and Skoog (MS) medium fortified with plant growth regulator (PGR) for organogenesis. The plantlets with well-developed root systems were acclimatized and transferred into the experimental field to screen the somaclonal variations during growth and development. The number of somaclonal variations was observed in growth of irradiated/treated shoot tips, multiplication, plantlet regeneration and growth in vitro and ex vitro. The lower doses/concentrations of mutagenic treatments showed significant enhancement in selected agronomical characters and they showed decreased trends with increasing doses/concentrations of mutagenic agents. The results of the present study revealed the influence of lower doses/concentrations of mutagenic treatments on in vitro and ex vitro growth of cotton plantlets and their significant improvement in agronomical characters which needs further imperative stability analysis. The present observations showed the platform to use lower doses/concentrations of mutagenic agents to induce variability for enhanced agronomical characters, resistant and tolerant cotton varieties.
GhNAC18, a novel cotton (Gossypium hirsutum L.) NAC gene, is ...
African Journals Online (AJOL)
EVANS
especially inhibition of leaf senescence and plant stress responses in cotton. This study provides .... For exogenous application of hormone treatments, leaves of uniformly ...... with incompatible interactions between chili pepper and pathogens.
Gamma irradiation of the interspecific hybrids Gossypium hirsutum L. x G. barbadense L. Part 1
International Nuclear Information System (INIS)
Stoilova, A.
1990-01-01
The aim of the investigation is to combine the methods of hybridization and experimental mutagenesis and to widen the possibilities of interspecific hybridization for successful breeding work. Four hybrid combinations resulting from reciprocal crosses between the two species were studied. Seeds of long fibre F 1 plants from each combination were devided in four equal parts, three of which were irradiated with doses 15, 20 and 25 krad and one remained as control. The complex radiosensitivity evaluation of the four hybrid combinations investigated was based on the changes in the main biometrical indices comparing the control with 25 krad treatment and showed that the F 2 hybrids were either resistant or slightly sensitive to irradiation depending on the direction of crossing in respect to growth process, field germination and survival to the end of vegetation. 2 figs., 3 tabs., 14 refs
Zhou, Zhaolu; Cao, Chong; Cao, Lidong; Zheng, Li; Xu, Jun; Li, Fengmin; Huang, Qiliang
2018-04-05
The evaporation kinetics of pesticide droplets deposited on a leaf surface can affect their application efficiency. Evaporation of droplets on the hydrophobic leaves has received considerable attention, but little is known about hydrophilic leaf surfaces. In this study, the effect of surfactant concentration on the evaporation of droplets deposited on cotton leaves was investigated. The evaporation time is roughly decreased for concentrations ranging from 0% to 0.01% and increased from 0.01% to 0.10%. Contrary to the widely held belief that pesticide retention on target crops can rapidly be formed only with surfactant concentrations exceeding the CMC (critical micelle concentration), this study demonstrates that, on hydrophilic cotton leaves, fast evaporation of the droplet at surfactant concentrations of 0.01% (CMC) can reduce the volume quickly, lower the loss point and enhance pesticide retention. In addition, the evolution of droplet volume, height and contact angle on the cotton leaf surface were measured to confirm this conclusion. The result presented herein can be used to guide the use of surfactants and pesticides in agriculture. Copyright © 2018 Elsevier B.V. All rights reserved.
SSR-based association mapping of salt tolerance in cotton (Gossypium hirsutum L.).
Zhao, Y L; Wang, H M; Shao, B X; Chen, W; Guo, Z J; Gong, H Y; Sang, X H; Wang, J J; Ye, W W
2016-05-25
The identification of simple sequence repeat (SSR) markers associated with salt tolerance in cotton contributes to molecular assisted selection (MAS), which can improve the efficiency of traditional breeding. In this study, 134 samples of upland cotton cultivars were selected. The seedling emergence rates were tested under 0.3% NaCl stress. A total of 74 SSR markers were used to scan the genomes of these samples. To identify SSR markers associated with salt tolerance, an association analysis was performed between salt tolerance and SSR markers using TASSEL 2.1, based on the analysis of genetic structure using Structure 2.3.4. The results showed that the seedling emergence rates of 134 cultivars were significantly different, and 27 salt-sensitive and 10 salt-tolerant cultivars were identified. A total of 148 loci were found in 74 SSR markers involving 246 allelic variations, which ranged from 2 to 7 with an average of 3.32 per SSR marker. The gene diversity ranged from 0.0295 to 0.4959, with the average being 0.2897. The polymorphic information content ranged from0.0290 to 0.3729, with the average being 0.2381. This natural population was classified into two subgroups by Structure 2.3.4, containing 89 and 45 samples, respectively. Finally, eight SSR sites associated with salt tolerance ware found through an association analysis, with the rate of explanation ranging from 2.91 to 7.82% and an average of 4.32%. These results provide reference data for the use MAS for salt tolerance in cotton.
International Nuclear Information System (INIS)
Makhdum, M.I.; Din, S.U.
2007-01-01
Water is the most limiting factor in cotton production and numerous efforts are being made to improve crop drought tolerance. A field study was conducted with the objectives to determine the effects of different application rates of glycine betaine in field grown cotton at Central Cotton Research Institute, Multan. Four levels of glycine betaine (0.0, 1.0, 3.0 and 6.0 kg ha-1) were applied at three physiological growth stages i.e. at squaring, first flower and peak flowering. Cotton cultivar CIM-448 was used as test crop. Results showed that crop sprayed with glycine betaine at the rate of 6.0 kg ha-1 maintained 120.0, 62.1, 69.7 and 35.5 percent higher net CO/sub 2/ assimilation rate (PN), transpiration rate (E), stomatal resistance (gs) and water use efficiency (PN/E), respectively over that of untreated crop. Crop spayed with glycine betaine at peak flowering stage maintained higher PN, E, gs and PN/E compared to at other stages of growth. (author)
Directory of Open Access Journals (Sweden)
Miguel Mariano Espitia Camacho
2008-06-01
Full Text Available El cultivo del algodón es la principal actividad agrícola en la economía del Caribe colombiano en el segundo semestre del año y el principal abastecedor de fibra a la industria nacional desde hace aproximadamente 60 años. El objetivo de este trabajo fue estimar las correlaciones fenotípicas, genéticas y ambientales, entre 11 caracteres agronómicos y realizar un análisis de sendero para rendimiento de fibra. Se utilizaron los datos de la evaluación agronómica de 10 genotipos de algodón en ocho ambientes del Caribe colombiano. En cada ambiente se utilizó un diseño experimental de bloques completos al azar con cuatro repeticiones. Los resultados indicaron que las correlaciones genéticas fueron superiores a las fenotípicas y ambientales. El rendimiento de fibra (REF presentó las mayores correlaciones fenotípicas, genéticas y fenotipicas parciales con el porcentaje de fibra (PFI, el rendimiento de algodón - semilla (RAS y el peso de mota (PMO, con valores de r > 0,43 (PThe cotton crop is the main agricultural activity in the economy of the colombian Caribbean in the second semester of the year and the main supplier of fibre to national industry for about 60 years. The objective of this work was to estimate the phenotypic, genetic and environmental correlations, between 11 agronomic characters and to make a path analysis for fibre yield. Data of agronomic evaluation of 10 genotypes of cotton in eight environments of the colombian Caribbean were used. In each environment experimental design at random complete blocks with four repetitions were used. The results indicated that genetic correlations were superior to phenotypic and environmental correlations. Fibre yield (FIY presented the highest phenotypic, genetic and partial phenotypic correlations with ginning percentage (GP, seed-cotton yield (SCY and boll weight (BOW with values of r > 0,43 (P<0,01. The FIP (0,810 was the cause variable that showed the greatest direct effect on the REF. The YFI can be used as selection criteria to increase the YFI in cotton.
Directory of Open Access Journals (Sweden)
R. Victoria Filho
1982-06-01
Full Text Available Com o objetivo de se verificar o comportamento de misturas de dinitramine e diuron no controle de plantas daninhas na cultura do algodão, foram conduzidos dois experimentos de campo nos municípios paulistas de Casa Branca e Jaboticabal, em solo argiloso (3,6% m.o. e barrento (2,3% m.o., respectivamente. A variedade de algodão semeada foi a IAC -13-1 em Casa Branca (05-11-75 e a RM-4A em Jaboticabal (03-12-75. O delineamento experimental adotado foi o de blocos ao acaso com os tratamentos de dinitramine a 0,25 kg; 0,40 kg; 0,50 kg/ha; de diuron a 1,20 kg; 1,50 kg; 1,80 kg/ha, e das misturas de dinitramine e diuron nas combinações possíveis com essas doses além do tratamento de trifluralin a 1,00 kg/ha ou mistura com diuron a 1,20 kg/ha. Constou do experimento também um tratamento sem aplicação de herbicida, mantido no limpo por meios mecânicos. Quando foi considerado o controle geral das plantas daninhas, no ensaio de Casa Branca, os melhores resultados foramobtidos pelas misturas em comparação com as aplicações isoladas de dinitramine e de diuron sobre capim-colchão (Digitaria sanguinalis (L. Scop., capimpé-de-galinha (Eleusine indica (L. Gaertn., carrapicho-rasteiro (Acanthospermum australe (Loef O. Kúntze, poaia (Borreria alata (Aubl. D.C., poaia -branca (Richardia brasiliensis Gomez e guanxuma (Sida spp. Porém, no experimento de Jaboticabal, onde as plantas daninhas mais frequentes foram capim-colchão, capim-carrapicho (Cenchrus echinatus L., capim-oferecido (Pennisetum setosum L. Rich. Pers. carrapicho-rasteiro, poaia e guanxuma, os melhores índices de controle foram obtidos com trifluralin + diuron e com dinitramine a 0,25 kg; 0,40 kg; 0,50 kg/ha em mistura com diuron a 1,80 kg/ha. Não foram observados sintomas fitotóxicos à cultura na fase inicial de desenvolvimento; e, não houve diferença significativa na produção de algodão em caroço obtida.A field research was conducted to evaluate the effects of dinitramine and diuron mixtures on weed control in cotton at two experiments at Casa Branca - SP on a clay soil (3 ,6% organic matter and Jaboticabal - SP on a clay loam (2,3% organic matter. The cotton variety sowed was IAC-13 -1 at Casa Branca (nov, 05, 1975 and RM-4A at Jaboticabal (dec. 3, 1975. The experiment had a design of randomized blocks with the treatments dinitramine at 0.25 kg; 0.40 kg; 0.50 kg/ha; diuron at 1.20 kg; 1.50 kg; 1.80 kg/ha and ali dinitramine + diuron mixture s with this rates; one treatment with trifluralin + diuron at 1.00 + 1.20 kg/ha, and one hoeded treatment. The best weed control results on the clay soil were obta ined by the mixtures when compared with the dinitramine and diuron appl ication on large crabgrass (Digitaria sanguinallis (L. Scop., go ose gras s (Eleusine indica (L . Gaertn., Paraguay starbur (Acanthospermum australe ( Loef. O. Kuntze, Borreria alata (Aubl. D.C., Brasil callalily (Richardia brasiliensis Gomez and sidas (Sida spp. but on the clay loam soil were the most important weeds we re la r ge c rabg ras s , s outhe rn s andbur (Cenchrus echinatus L. , West Indies pennisetum (Pennisetum setosum (L. Rich. Pers, Paraguay sandbur, Brasil callalily and sidas the be st weed control results were obtained with trifluralin + diuron and with dinitramine at 0.25 kg; 0.40 kg; 0.50 kg in mixture with diuron at 1.80 kg/ha. The treatments used didn't present any phyto toxicity to cotton at the initial development and there wasn't significant difference in the total yield.
Transformation and evaluation of Cry1Ac+Cry2A and GTGene in Gossypium hirsutum L.
Directory of Open Access Journals (Sweden)
Agung Nugroho Puspito
2015-11-01
Full Text Available More than 50 countries around the globe cultivate cotton on a large scale. It is a major cash crop of Pakistan and is considered white gold because it is highly important to the economy of Pakistan. In addition to its importance, cotton cultivation faces several problems, such as insect pests, weeds, and viruses. In the past, insects have been controlled by insecticides, but this method caused a severe loss to the economy. However, conventional breeding methods have provided considerable breakthroughs in the improvement of cotton, but it also has several limitations. In comparison with conventional methods, biotechnology has the potential to create genetically modified plants that are environmentally safe and economically viable. In this study, a local cotton variety VH 289 was transformed with two Bt genes (Cry1Ac and Cry2A and a herbicide resistant gene (cp4 EPSPS using the Agrobacterium mediated transformation method. The constitutive CaMV 35S promoter was attached to the genes taken from Bacillus thuringiensis (Bt and to an herbicide resistant gene during cloning, and this promoter was used for the expression of the genes in cotton plants. This construct was used to develop the Glyphosate Tolerance Gene (GTGene for herbicide tolerance and insecticidal gene (Cry1Ac and Cry2A for insect tolerance in the cotton variety VH 289. The transgenic cotton variety performed 85% better compared with the non-transgenic variety. The study results suggest that farmers should use the transgenic cotton variety for general cultivation to improve the production of cotton.
STUDY OF GENE FLOW FROM GM COTTON (Gossypium hirsutum VARIETIES IN “EL ESPINAL” (TOLIMA, COLOMBIA.
Directory of Open Access Journals (Sweden)
Alejandro Chaparro Giraldo
2013-09-01
Full Text Available In 2009, 4088 hectares of genetically modified (GM cotton were planted in Tolima (Colombia, however there is some uncertainty about containment measures needed to prevent the flow of pollen and seed from regulated GM fields into adjacent fields. In this study, the gene flow from GM cotton varieties to conventional or feral cotton plants via seed and pollen was evaluated. ImmunostripTM, PCR and ELISA assays were used to detect gene flow. Fifty six refuges, 27 fields with conventional cotton and four feral individuals of the enterprise “Remolinos Inc.” located in El Espinal (Tolima were analyzed in the first half of 2010. The results indicated seeds mediated gene flow in 45 refuges (80,4 % and 26 fields with conventional cotton (96 %, besides a pollen mediated gene flow in one field with conventional cotton and nine refuges. All fields cultivated with conventional cotton showed gene flow from GM cotton. Two refuges and two feral individuals did not reveal gene flow from GM cotton.
Ding, Yuanhao; Ma, Yizan; Liu, Nian; Xu, Jiao; Hu, Qin; Li, Yaoyao; Wu, Yuanlong; Xie, Sai; Zhu, Longfu; Min, Ling; Zhang, Xianlong
2017-09-01
Male sterility caused by long-term high-temperature (HT) stress occurs widely in crops. MicroRNAs (miRNAs), a class of endogenous non-coding small RNAs, play an important role in the plant response to various abiotic stresses. To dissect the working principle of miRNAs in male sterility under HT stress in cotton, a total of 112 known miRNAs, 270 novel miRNAs and 347 target genes were identified from anthers of HT-insensitive (84021) and HT-sensitive (H05) cotton cultivars under normal-temperature and HT conditions through small RNA and degradome sequencing. Quantitative reverse transcriptase-polymerase chain reaction and 5'-RNA ligase-mediated rapid amplification of cDNA ends experiments were used to validate the sequencing data. The results show that miR156 was suppressed by HT stress in both 84021 and H05; miR160 was suppressed in 84021 but induced in H05. Correspondingly, SPLs (target genes of miR156) were induced both in 84021 and H05; ARF10 and ARF17 (target genes of miR160) were induced in 84021 but suppressed in H05. Overexpressing miR160 increased cotton sensitivity to HT stress seen as anther indehiscence, associated with the suppression of ARF10 and ARF17 expression, thereby activating the auxin response that leads to anther indehiscence. Supporting this role for auxin, exogenous Indole-3-acetic acid (IAA) leads to a stronger male sterility phenotype both in 84021 and H05 under HT stress. Cotton plants overexpressing miR157 suppressed the auxin signal, and also showed enhanced sensitivity to HT stress, with microspore abortion and anther indehiscence. Thus, we propose that the auxin signal, mediated by miRNAs, is essential for cotton anther fertility under HT stress. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Medrano, Enrique G; Bell, Alois A; Greene, Jeremy K; Roberts, Phillip M; Bacheler, Jack S; Marois, James J; Wright, David L; Esquivel, Jesus F; Nichols, Robert L; Duke, Sara
2015-08-01
In 1999, crop consultants scouting for stink bugs (Hemiptera spp.) in South Carolina discovered a formerly unobserved seed rot of cotton that caused yield losses ranging from 10 to 15% in certain fields. The disease has subsequently been reported in fields throughout the southeastern Cotton Belt. Externally, diseased bolls appeared undamaged; internally, green fruit contain pink to dark brown, damp, deformed lint, and necrotic seeds. In greenhouse experiments, we demonstrated transmission of the opportunistic bacterium Pantoea agglomerans by the southern green stink bug, Nezara viridula (L.). Here, green bolls were sampled from stink bug management plots (insecticide protected or nontreated) from four South Atlantic coast states (North Carolina, South Carolina, Georgia, and Florida) to determine disease incidence in the field and its association with piercing-sucking insects feeding. A logistic regression analysis of the boll damage data revealed that disease was 24 times more likely to occur (P = 0.004) in bolls collected from plots in Florida, where evidence of pest pressure was highest, than in bolls harvested in NC with the lowest detected insect pressure. Fruit from plots treated with insecticide, a treatment which reduced transmission agent numbers, were 4 times less likely to be diseased than bolls from unprotected sites (P = 0.002). Overall, punctured bolls were 125 times more likely to also have disease symptoms than nonpunctured bolls, irrespective of whether or not plots were protected with insecticides (P = 0.0001). Much of the damage to cotton bolls that is commonly attributed to stink bug feeding is likely the resulting effect of vectored pathogens. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.
Park, Wonkeun; Scheffler, Brian E; Bauer, Philip J; Campbell, B Todd
2012-06-15
Cotton is the world's primary fiber crop and is a major agricultural commodity in over 30 countries. Like many other global commodities, sustainable cotton production is challenged by restricted natural resources. In response to the anticipated increase of agricultural water demand, a major research direction involves developing crops that use less water or that use water more efficiently. In this study, our objective was to identify differentially expressed genes in response to water deficit stress in cotton. A global expression analysis using cDNA-Amplified Fragment Length Polymorphism was conducted to compare root and leaf gene expression profiles from a putative drought resistant cotton cultivar grown under water deficit stressed and well watered field conditions. We identified a total of 519 differentially expressed transcript derived fragments. Of these, 147 transcript derived fragment sequences were functionally annotated according to their gene ontology. Nearly 70 percent of transcript derived fragments belonged to four major categories: 1) unclassified, 2) stress/defense, 3) metabolism, and 4) gene regulation. We found heat shock protein-related and reactive oxygen species-related transcript derived fragments to be among the major parts of functional pathways induced by water deficit stress. Also, twelve novel transcripts were identified as both water deficit responsive and cotton specific. A subset of differentially expressed transcript derived fragments was verified using reverse transcription-polymerase chain reaction. Differential expression analysis also identified five pairs of duplicated transcript derived fragments in which four pairs responded differentially between each of their two homologues under water deficit stress. In this study, we detected differentially expressed transcript derived fragments from water deficit stressed root and leaf tissues in tetraploid cotton and provided their gene ontology, functional/biological distribution, and possible roles of gene duplication. This discovery demonstrates complex mechanisms involved with polyploid cotton's transcriptome response to naturally occurring field water deficit stress. The genes identified in this study will provide candidate targets to manipulate the water use characteristics of cotton at the molecular level.
Mao, Guangzhi; Ma, Qiang; Wei, Hengling; Su, Junji; Wang, Hantao; Ma, Qifeng; Fan, Shuli; Song, Meizhen; Zhang, Xianlong; Yu, Shuxun
2018-02-01
The young leaves of virescent mutants are yellowish and gradually turn green as the plants reach maturity. Understanding the genetic basis of virescent mutants can aid research of the regulatory mechanisms underlying chloroplast development and chlorophyll biosynthesis, as well as contribute to the application of virescent traits in crop breeding. In this study, fine mapping was employed, and a recessive gene (v 1 ) from a virescent mutant of Upland cotton was narrowed to an 84.1-Kb region containing ten candidate genes. The GhChlI gene encodes the cotton Mg-chelatase I subunit (CHLI) and was identified as the candidate gene for the virescent mutation using gene annotation. BLAST analysis showed that the GhChlI gene has two copies, Gh_A10G0282 and Gh_D10G0283. Sequence analysis indicated that the coding region (CDS) of GhChlI is 1269 bp in length, with three predicted exons and one non-synonymous nucleotide mutation (G1082A) in the third exon of Gh_D10G0283, with an amino acid (AA) substitution of arginine (R) to lysine (K). GhChlI-silenced TM-1 plants exhibited a lower GhChlI expression level, a lower chlorophyll content, and the virescent phenotype. Analysis of upstream regulatory elements and expression levels of GhChlI showed that the expression quantity of GhChlI may be normal, and with the development of the true leaf, the increase in the Gh_A10G0282 dosage may partially make up for the deficiency of Gh_D10G0283 in the v 1 mutant. Phylogenetic analysis and sequence alignment revealed that the protein sequence encoded by the third exon of GhChlI is highly conserved across diverse plant species, in which AA substitutions among the completely conserved residues frequently result in changes in leaf color in various species. These results suggest that the mutation (G1082A) within the GhChlI gene may cause a functional defect of the GhCHLI subunit and thus the virescent phenotype in the v 1 mutant. The GhChlI mutation not only provides a tool for understanding the associations of CHLI protein function and the chlorophyll biosynthesis pathway but also has implications for cotton breeding.
Ma, Zhiying; Liu, Jianfeng; Wang, Xingfen
2013-01-01
Cotton is an important world economic crop plant. It is considered that cotton is recalcitrant to in vitro proliferation. Somatic embryogenesis and plant regeneration has been successful by using hypocotyl, whereas it is highly genotype dependent. Here, a genotype-independent cotton regeneration protocol from shoot apices is presented. Shoot apices from 3- to 5-day-old seedlings of cotton are infected with an Agrobacterium strain, EHA105, carrying the binary vector pC-KSA contained phytase gene (phyA) and the marker gene neomycin phosphotransferase (NPTII), and directly regenerated as shoots in vitro. Rooted shoots can be obtained within 6-8 weeks. Plants that survived by leaf painting kanamycin (kan) were -further analyzed by DNA and RNA blottings. The transgenic plants with increased the phosphorus (P) acquisition efficiency were obtained following the transformation method.
Directory of Open Access Journals (Sweden)
Shazia Parveen
2017-05-01
Full Text Available Plant growth regulators like naphthalene acetic acid (NAA positively affect the growth and yield of crop plants. An experiment was conducted to check the foliar application of NAA on growth and yield components of cotton variety Bt.121 under field condition at research area of agriculture farm near Cholistan Institute of Desert Studies (CIDS, The Islamia University of Bahawalpur, Pakistan. The experiment was comprised of foliar application of NAA (1% viz. T0 (control, T1 (One spray of NAA, T2 (Two sprays of NAA, T3 (Three sprays of NAA, T4 (Four sprays of NAA. The first foliar spray was applied at 45 days after sowing (DAS and later on it was continued with 15 days interval with skilled labour by hand pump sprayer. The experiment was laid out in randomized complete block design and each treatment was replicated three times. Data recorded on growth, chlorophyll contents, yield and yield components showed a significant increase with the application of NAA. Furthermore, earliness index, mean maturity date and production rate index were also influenced with foliar application of NAA. On the basis of growth and yield parameters it can be concluded that four spray of NAA (1% can be applied commercially under field conditions.
Idris, Ali; Tuttle, John Richard; Robertson, Dominique Niki; Haigler, Candace H.; Brown, Judith K.
2010-01-01
inoculation resulted in systemic and persistent photo-bleaching of the leaves and bolls of the seven cultivars tested, however, the intensity of silencing was variable. CLCrV-VIGS-mediated expression of green fluorescent protein was used to monitor
International Nuclear Information System (INIS)
Abbas, Z.; Muhammad, S.; Murtaza, G.; Ahmad, I.; Shakeel, A.; Islam, M.; Ahmad, M.; Abdullah, M.
2015-01-01
Crop quality and production are affected by various fertilizers and water stress. In present research, the response of cotton variety CIM-496 to water stress and phosphorus fertilizer was investigated. Samples were collected after 90 days of planting. Kjeldahl method and thin layer chromatography (TLC) were used for the quantitative and qualitative analysis of total protein and phenolic compounds, respectively. Proteins were greatly affected by fertilizer treatment and water stress, but phenolic compounds remained unchanged upon fertilizer treatment. However, they were greatly affected by irrigation and water stress. Crop treated with 100 kg ha/sup -1/ P/sub 2/O/sub 5/ under water stress maintained high protein content as compared to unfertilized and no water stress treatments. However, phenolic compounds were found higher in fully irrigated plants as compared to water stress ones. Fertilizer treatments had no considerable effect on phenolic compounds. (author)
Chen, Zhifan; Zhao, Ye; Fan, Lidong; Xing, Liteng; Yang, Yujie
2015-12-01
Phytoremediation using economically valuable, large biomass, non-edible plants is a promising method for metal-contaminated soils. This study investigated cotton's tolerance for Cd and remediation potential through analyzing Cd bioaccumulation and localization in plant organs under different soil Cd levels. Results showed cotton presents good tolerance when soil Cd concentration ≤20.26 mg kg(-1). Cotton had good Cd accumulation ability under low soil Cd levels (soil Cd, while roots and stems were the main compartments of Cd storage. Cd complexation to other organic constituents in root and stem cell sap could be a primary detoxifying strategy. Therefore, cotton is a potential candidate for phytoremediation of Cd-contaminated soils.
International Nuclear Information System (INIS)
Stoilova, A.
1984-01-01
Two hybrid combinations between cv. Chirpan-433 (of the species G. hirsutum) and C-6030 and 5904-I (of the species G. barbadense) were studied. F 0 seeds were irradiated by 30 krad. Non-irradiated seeds were used as control. It was found that hybrid irradiation affected segregation of the characters in a different way. It retarded ripening, the negative effect being higher in the combination Chirpan-433x5904-N. In respect to productiveness and fibre lenght hybrid irradiation led to positive changes in the form-producing process. Hibrids of the combination Chirpan-433X5904-I responded more favourably to irradiation in respect to these two characters. Hybrid irradiation altered the type of segregation and created suplementary pool of forms with desired characters, increasing the possibilities of interspecific hybridization to combine the valuable economic characters of both species
Rai, Sandhya; Singh, Dileep Kumar; Annapurna, Kannepalli
2015-01-01
The soil sampled at different growth stages along the cropping period of cotton were analyzed using various molecular tools: restriction fragment length polymorphism (RFLP), terminal restriction length polymorphism (T-RFLP), and cloning-sequencing. The cluster analysis of the diazotrophic community structure of early sampled soil (0, 15, and 30 days) was found to be more closely related to each other than the later sampled one. Phylogenetic and diversity analysis of sequences obtained from the first (0 Day; C0) and last soil sample (180 day; C180) confirmed the data. The phylogenetic analysis revealed that C0 was having more unique sequences than C180 (presence of γ-Proteobacteria exclusively in C0). A relatively higher richness of diazotrophic community sequences was observed in C0 (S(ACE) : 30.76; S(Chao1) : 20.94) than C180 (S(ACE) : 18.00; S(Chao1) : 18.00) while the evenness component of Shannon diversity index increased from C0 (0.97) to C180 (1.15). The impact of routine agricultural activities was more evident based on diazotrophic activity (measured by acetylene reduction assay) than its structure and diversity. The nitrogenase activity of C0 (1264.85 ± 35.7 ηmol of ethylene production g(-1) dry soil h(-1) ) was statistically higher when compared to all other values (p structure/diversity and N2 fixation rates. Thus, considerable functional redundancy of nifH was concluded to be existing at the experimental site. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Lei Fang
Full Text Available Fiber strength is the key trait that determines fiber quality in cotton, and it is closely related to secondary cell wall synthesis. To understand the mechanism underlying fiber strength, we compared fiber transcriptomes from different G. barbadense chromosome introgression lines (CSILs that had higher fiber strengths than their recipient, G. hirsutum acc. TM-1. A total of 18,288 differentially expressed genes (DEGs were detected between CSIL-35431 and CSIL-31010, two CSILs with stronger fiber and TM-1 during secondary cell wall synthesis. Functional classification and enrichment analysis revealed that these DEGs were enriched for secondary cell wall biogenesis, glucuronoxylan biosynthesis, cellulose biosynthesis, sugar-mediated signaling pathways, and fatty acid biosynthesis. Pathway analysis showed that these DEGs participated in starch and sucrose metabolism (328 genes, glycolysis/gluconeogenesis (122 genes, phenylpropanoid biosynthesis (101 genes, and oxidative phosphorylation (87 genes, etc. Moreover, the expression of MYB- and NAC-type transcription factor genes were also dramatically different between the CSILs and TM-1. Being different to those of CSIL-31134, CSIL-35431 and CSIL-31010, there were many genes for fatty acid degradation and biosynthesis, and also for carbohydrate metabolism that were down-regulated in CSIL-35368. Metabolic pathway analysis in the CSILs showed that different pathways were changed, and some changes at the same developmental stage in some pathways. Our results extended our understanding that carbonhydrate metabolic pathway and secondary cell wall biosynthesis can affect the fiber strength and suggested more genes and/or pathways be related to complex fiber strength formation process.
Cotton is a world’s leading crop important to the world’s textile and energy industries, and a model species for studies of plant polyploidization, cellulose biosynthesis and cell wall biogenesis. Here, we report the construction and extensive analysis of a binary bacterial artificial chromosome (BI...
Romero-Perdomo, Felipe; Abril, Jorge; Camelo, Mauricio; Moreno-Galván, Andrés; Pastrana, Iván; Rojas-Tapias, Daniel; Bonilla, Ruth
The aim of this research was to evaluate whether the application of two plant growth-promoting (rhizo)bacteria might reduce nitrogen fertilization doses in cotton. We used strains Azotobacter chroococcum AC1 and AC10 for their proven ability to promote seed germination and cotton growth. These microorganisms were characterized by their plant growth-promoting activities. Then, we conducted a glasshouse study to evaluate the plant growth promoting ability of these strains with reduced doses of urea fertilization in cotton. Results revealed that both strains are capable of fixing nitrogen, solubilizing phosphorus, synthesizing indole compounds and producing hydrolytic enzymes. After 12 weeks, the glasshouse experiment showed that cotton growth was positively influenced due to bacterial inoculation with respect to chemical fertilization. Notably, we observed that microbial inoculation further influenced plant biomass (p<0.05) than nitrogen content. Co-inoculation, interestingly, exhibited a greater beneficial effect on plant growth parameters compared to single inoculation. Moreover, similar results without significant statistical differences were observed among bacterial co-inoculation plus 50% urea and 100% fertilization. These findings suggest that co-inoculation of A. chroococcum strains allow to reduce nitrogen fertilization doses up to 50% on cotton growth. Our results showed that inoculation with AC1 and AC10 represents a viable alternative to improve cotton growth while decreasing the N fertilizer dose and allows to alleviate the environmental deterioration related to N pollution. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
International Nuclear Information System (INIS)
Baloch, M.H.; Kumbher, M.B.; Jatoi, W.A.
2008-01-01
Combining abilities of cotton varieties were evaluated using a line x tester design with eight lines and 4 testers. Good performance combination was found between the varieties CRIS-134 and BH-147. The former was a good candidate for fibre length improvement and the latter, a good parent for yield improvement. The specific combining ability suggested that both additive and dominant genes controlled the characters. Hybrid performance per se may be used to predict the parental performance for specific combining ability and thus for hybrid crop development. (author)
Directory of Open Access Journals (Sweden)
Ullah Najeeb
2017-09-01
Full Text Available We investigated the role of ethylene in the response of cotton to high temperature using cotton genotypes with genetically interrupted ethylene metabolism. In the first experiment, Sicot 71BRF and 5B (a lintless variant with compromised ethylene metabolism were exposed to 45°C, either by instantaneous heat shock or by ramping temperatures by 3°C daily for 1 week. One day prior to the start of heat treatment, half the plants were sprayed with 0.8 mM of the ethylene synthesis inhibitor, aminoethoxyvinylglycine (AVG. In a subsequent experiment, Sicot 71BRF and a putatively heat-tolerant line, CIM 448, were exposed to 36 or 45°C for 1 week, and half the plants were sprayed with 20 μM of the ethylene precursor, 1-aminocyclopropane-1-carboxylic acid, (ACC. High temperature exposure of plants in both experiments was performed at the peak reproductive phase (65–68 days after sowing. Elevated temperature (heat shock or ramping to 45°C significantly reduced production and retention of fruits in all cotton lines used in this study. At the termination of heat treatment, cotton plants exposed to 45°C had at least 50% fewer fruits than plants under optimum temperature in all three genotypes, while plants at 36°C remained unaffected. Heat-stressed plants continued producing new squares (fruiting buds after termination of heat stress but these squares did not turn into cotton bolls due to pollen infertility. In vitro inhibition of pollen germination by high temperatures supported this observation. Leaf photosynthesis (Pn of heat-stressed plants (45°C measured at the end of heat treatments remained significantly inhibited, despite an increased leaf stomatal conductance (gs, suggesting that high temperature impairs Pn independently of stomatal behavior. Metabolic injury was supported by high relative cellular injury and low photosystem II yield of the heat-stressed plants, indicating that high temperature impaired photosynthetic electron transport. Both heat shock and ramping of heat significantly reduced ethylene release from cotton leaf tissues measured at the end of heat treatment but modulating ethylene production via AVG or ACC application had no significant effect on fruit production or retention in heat-stressed cotton plants. Instead, high temperature accelerated fruit abortion by impairing pollen development and/or restricting leaf photosynthesis.
Directory of Open Access Journals (Sweden)
F Shahriari Ahmadi
2013-04-01
Full Text Available Cotton is one of the most important world crops and is considered as a major cash crop in the North East of Iran. All selections in plant breeding are based on diversity and an increase in genetic diversity determines the range of selection. In the present study, 24 cultivars of cotton available at the research station for cotton in the East of Iran -Kashmar- were studied using the ISSR marker. A total number of 13 primers, with repeated simple sequences, were used for the amplification of genomic DNA. Overall, 128 bands were obtained, 109 of which showed polymorphism. To evaluate genetic similarity between cultivars, cluster analysis accompanied by the similarity coefficient developed by Jaccard and Nee (1972, were applied using the UPGMA method. Dendrogram analysis showed a high diversity in the cotton cultivars and two main groups with 70 percent genetic similarity dividing the cotton cultivars into two main groups; namely, tetraploid and diploid. The highest polymorphism percentage was related to 5' (CT8RC3' (100% and the lowest belonged to 5' (AG8YA3' and 5' (TC8G3' (25% primers. Based on the similarity matrix, the highest genetic similarity was found in Varamin and Khordad and the lowest in Avangard and Bakhtegan cultivars. Based on the obtained results, ISSR markers can be efficiently used for the investigation of genetic diversity among cotton cultivars.
Directory of Open Access Journals (Sweden)
Memoona Ramzan
2016-05-01
Full Text Available Biological control is a novel approach in crop protection. Bacteria, such as Bacillus spp. and Pseudomonas spp., are reported for this purpose and some of their products are already commercially available. In this study, the rhizosphere and phyllosphere of healthy cotton plants were used as a source of bacterial isolates with properties of potential biocontrol agents. The isolates were screened for phosphate solubilization activity, indole acetic acid (IAA production and antifungal activity. Two isolates, S1HL3 and S1HL4, showed phosphate solubilization and IAA production simultaneously, while another two, JS2HR4 and JS3HR2, demonstrated potential to inhibit fungal pathogens. These bacteria were identified as Pseudomonas aeruginosa (S1HL3, Burkholderia sp. (S1HL4 and Bacillus sp. (JS2HR4 and JS3HR2 based on biochemical and molecular characteristics. The isolates were tested against Cotton leaf curl virus (CLCuV in greenhouse conditions, both as individual bacterial isolates and consortia. Treated plants were healthy as compared to control plants, where up to 74% of the plants were symptomatic for CLCuV infection. Maximum inhibition of CLCuV was observed in the plants treated with a mixture of bacterial isolates: the viral load in the treated plants was only 0.4% vs. up to 74% in controls. This treatment consortium included P. aeruginosa S1HL3, Burkholderia sp. S1HL4 and Bacillus spp. isolates, JS2HR4 and JS3HR2. The principal-component biplot showed a highly significant correlation between the viral load percentage and the disease incidence.
Wang, Qi; Han, Shuo; Zhang, Lizhen; Zhang, Dongsheng; Werf, van der Wopke; Evers, Jochem B.; Sun, Hongquan; Su, Zhicheng; Zhang, Siping
2016-01-01
Trees are the dominant species in agroforestry systems, profoundly affecting the performance of understory crops. Proximity to trees is a key factor in crop performance, but rather little information is available on the spatial distribution of yield and yield components of crop species under the
Directory of Open Access Journals (Sweden)
Hamid Ashrafi
2015-07-01
Full Text Available Upland cotton ( L. has a narrow germplasm base, which constrains marker development and hampers intraspecific breeding. A pressing need exists for high-throughput single nucleotide polymorphism (SNP markers that can be readily applied to germplasm in breeding and breeding-related research programs. Despite progress made in developing new sequencing technologies during the past decade, the cost of sequencing remains substantial when one is dealing with numerous samples and large genomes. Several strategies have been proposed to lower the cost of sequencing for multiple genotypes of large-genome species like cotton, such as transcriptome sequencing and reduced-representation DNA sequencing. This paper reports the development of a transcriptome assembly of the inbred line Texas Marker-1 (TM-1, a genetic standard for cotton, its usefulness as a reference for RNA sequencing (RNA-seq-based SNP identification, and the availability of transcriptome sequences of four other cotton cultivars. An assembly of TM-1 was made using Roche 454 transcriptome reads combined with an assembly of all available public expressed sequence tag (EST sequences of TM-1. The TM-1 assembly consists of 72,450 contigs with a total of 70 million bp. Functional predictions of the transcripts were estimated by alignment to selected protein databases. Transcriptome sequences of the five lines, including TM-1, were obtained using an Illumina Genome Analyzer-II, and the short reads were mapped to the TM-1 assembly to discover SNPs among the five lines. We identified >14,000 unfiltered allelic SNPs, of which ∼3,700 SNPs were retained for assay development after applying several rigorous filters. This paper reports availability of the reference transcriptome assembly and shows its utility in developing intraspecific SNP markers in upland cotton.
Zahoor, Rizwan; Zhao, Wenqing; Abid, Muhammad; Dong, Haoran; Zhou, Zhiguo
2017-08-01
To evaluate the role of potassium (K) in maintaining nitrogen metabolism and osmotic adjustment development of cotton functional leaves to sustain growth under soil drought and rewatering conditions, the plants of two cotton cultivars Siza 3 (low-K sensitive) and Simian 3 (low-K tolerant), were grown under three different K rates (K0, K1, and K2; 0, 150, and 300kgK 2 Oha -1 , respectively) and exposed to drought stress with 40±5% soil relative water content (SRWC). The drought stress was applied at flowering stage by withholding water for eight days followed by rewatering to a well-watered level (75±5% SRWC). The results showed that drought-stressed plants of both cultivars showed a decrease in leaf relative water content (RWC) and osmotic potential in the functional leaves and developed osmotic adjustment with an increase in the contents of free amino acids, soluble sugars, inorganic K, and nitrate as compared to well-watered plants. In drought-stressed plants, nitrogen-metabolizing enzyme activities of nitrogen reductase (NR), glutamine synthetase (GS), and glutamate synthase (GOGAT) were diminished significantly (P≤0.05) along with decreased chlorophyll content and soluble proteins. However, drought-stressed plants under K application not only exhibited higher osmotic adjustment with greater accumulation of osmolytes but also regulated nitrogen metabolism by maintaining higher enzyme activities, soluble proteins, and chlorophyll content in functional leaves as compared to the plants without K application. Siza 3 showed better stability in enzyme activities and resulted in 89% higher seed cotton yield under K2 as compared to K0 in drought-stressed plants, whereas this increase was 53% in the case of Simian 3. The results of the study suggested that K application enhances cotton plants' potential for sustaining high nitrogen-metabolizing enzyme activities and related components to supplement osmotic adjustment under soil drought conditions. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Juan Francisco Avendaño Mora
2018-01-01
Full Text Available Cultivation of broccoli in Equador uses high doses of inorganic nitrogen fertilizers, which cause problems in the soil, the environment and the crop yield itself. In this work organic amendments were applied to Haplustolls soil by implementing the following trial treatments: castor bean meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, cotton seed meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, and control without organic fertilization. Results confirmed that applications of organic meals made from cotton seed and castor bean had a favorable effect on growth and yield of Broccoli in the canton Riobamba, Chimborazo province, Ecuador. Result gets into the hands of broccoli farmers give new alternatives of organic fertilization to restore physical, chemical and biological properties of the soil and will increase crop yields and help environmental preservation.
International Nuclear Information System (INIS)
Hussain, N.; Khan, M.B.; Khan, M.A.; Hameed, R.A.
2005-01-01
Response of varying herbicides at different levels: round up 490 G/L at the rate of 4.7 L ha/sup -1/ and 1.5 L ha/sup -1/ (Glyphosat) and Gramaxone 20 EC (Paraquat) at the rate of 2.5 L ha/sup -1/ against untreated (control, were investigated to cotton cultivar CIM-473 under field conditions during Kharif 2002 at Agronomic Research Area. Central Cotton Research Institute, Multan. Significant control of weeds and increase in yield and yield contributing factors were observed. It was indicated that maximum yield and weed control were obtained by using Round up (Glyphosate) at the rate of 4.7 L ha/sup -1/ as compared to other treatments including untreated (control). Average boll weight was not significant among treatments but significant against control. Maximum net profit was obtained from Round up 490 G/L when treated at the rate of 4.7 L ha/sup -1/ than all other treatments. (author)
Ganesan, M; Jayabalan, N
2005-10-01
Highly reproducible and simple protocol for cotton somatic embryogenesis is described here by using different concentrations of maltose, glucose, sucrose and fructose. Maltose (30 g/l) is the best carbon source for embryogenic callus induction and glucose (30 g/l) was suitable for induction, maturation of embryoids and plant regeneration. Creamy white embryogenic calli of hypocotyl explants were formed on medium containing MS basal salts, myo-inositol (100 mg/l), thiamine HCI (0.3 mg/l), picloram (0.3 mg/l), Kin (0.1 mg/l) and maltose (30 g/l). During embryo induction and maturation, accelerated growth was observed in liquid medium containing NH3NO4 (1 g/l), picloram (2.0 mg/l), 2 ip (0.2 mg/l), Kin (0.1 mg/l) and glucose (30 g/l). Before embryoid induction, large clumps of embryogenic tissue were formed. These tissues only produced viable embryoids. Completely matured somatic embryos were germinated successfully on the medium fortified with MS salts, myo-inositol (50 mg/l), thiamine HCl (0.2 mg/l), GA3 (0.2 mg/l), BA (1.0 mg/l) and glucose (30 g/l). Compared with earlier reports, 65% of somatic embryo germination was observed. The abnormal embryo formation was highly reduced by using glucose (30 g/l) compared to other carbon sources. The regenerated plantlets were fertile but smaller in height than the seed derived control plants.
Muthusamy, Annamalai; Jayabalan, Narayanasamy
2013-01-01
The present work describes the influence of gamma irradiation (GR), ethyl methane sulphonate (EMS) and sodium azide (SA) treatment on yield and protein content of selected mutant lines of cotton. Seeds of MCU 5 and MCU 11 were exposed to gamma rays (GR), ethyl methane sulphonate (EMS) and sodium azide (SA). Lower dose of gamma irradiation (100-500 Gy), 10-50 mM EMS and SA at lower concentration effectively influences in improving the yield and protein content. Significant increase in yield (258.9 g plant(-1)) and protein content (18.63 mg g(-1) d. wt.) as compared to parental lines was noted in M2 generations. During the subsequent field trials, number of mutant lines varied morphologically in terms of yield as well as biochemical characters such as protein. The selected mutant lines were bred true to their characters in M3 and M4 generations. The significant increase in protein content and profiles of the mutant lines with range of 10.21-18.63 mg g(-1). The SDS-PAGE analysis of mutant lines revealed 9 distinct bands of different intensities with range of 26-81 kDa. The difference in intensity of bands was more (41, 50 and 58 kDa) in the mutant lines obtained from in vitro mutation than in vivo mutation. Significance of such stimulation in protein content correlated with yielding ability of the mutant lines of cotton in terms of seed weight per plant. The results confirm that in cotton it is possible to enhance the both yield and biochemical characters by in vivo and in vitro mutagenic treatments.
Ganesan, M; Jayabalan, N
2006-06-01
In the present investigation, the influence of different forms of cytokinins, auxins and polyamines were tested for mass multiplication and regeneration of cotton. Initially, for the identification of effective concentration for multiple shoot induction, various concentrations of BAP, Kin and 2iP along with IAA and NAA were tested. Among tested concentrations, media fortified with MS salts; B5 vitamins; 30 g/l, glucose; 2.0 mg/l, 2iP; 2.0 mg/l, IAA and 0.7 % agar showed best response for multiplication of shoot tip explants (20 shoots per shoot tip explants). In nodal explants, maximum of 18.6 shoots were obtained in the media fortified with MS salts, B5 vitamins, 30 g/l, glucose, 2.0 mg/l, 2iP, 1.0 mg/l, NAA and 0.7 % agar. Effect of different concentrations of polyamines like spermidine and putrescine were also tested along with the above said multiplication media. Among the various treatments, 20 mg/l of putrescine showed best response and the multiple of shoots were increased to 26.5 shoots per shoot tip explants and 24.5 shoots per nodal explants. Elongation of shoots was achieved on multiple shoot induction medium. Significant number of roots were initiated in the medium supplemented with MS salts, vitamin B5 and IBA (2.0 mg/l). The frequency of root induction was increased by addition of, PVP (10 mg/l) along with root induction medium and after 2 weeks, the roots reached the maximum length of 22 cm. Further, these plantlets were hardened by using sand, soil and vermiculate in 1:1:1 ratio. The hardened plants were transferred to the environmental growth chamber for proper acclimatization. The hardened plants were then transferred to field for boll yielding and they exhibited 100% survival.
International Nuclear Information System (INIS)
Haidar, S.; Khan, I.A.; Mansoor, S.
2002-01-01
In both M1 and M2 plant height decreased with the increase in dose for both the mutagens. The 15 Krad and 0.15M EMS doses increased 122.7 and 128.3 gm seed cotton yield as compared to control respectively while all other doses of both mutagens decreased the yield of seed cotton. The EMS dose 0.10 M drastically decreased 184 gm seed cotton yield as compared to control. There was no larger effect of both mutagens on GOT % whereas staple length was slightly increased and micronaire value decreased as compared to control for all the doses of both mutagens. It was observed in M2 that mutation dose 10 Krad increased 165.6 gm seed cotton yield as compared to control but slight reduction in GOT % was observed. In M2 GOT were increased 3.5 % with 15 Krad and 3.6 % with EMS 0.10 M as compared to control. There were no larger effects for both mutagens in case of staple length, micronaire and uniformity ratio for all the doses as compared to control. respectively. In both M1 and M2 no plant was observed susceptible to cotton leaf curl virus and bacterial blight diseases of cotton
An ontogenetic study of a commercial cotton cultivar (FiberMax 1320), grown dryland, revealed that the dry weight (DW) of leaves reached a maximum at the 1st flower stage, and then declined as bolls opened. However, % pentane soluble hydrocarbon (HC) yield continued to increase throughout the growi...
Directory of Open Access Journals (Sweden)
Yuxiang Wu
Full Text Available The diploid species G. herbaceum (A1 and G. raimondii (D5 are the progenitors of allotetraploid cotton, respectively. However, hybrids between G. herbaceum and G. raimondii haven't been reported. In the present study, hybridization between G. herbaceum and G. raimondii was explored. Morphological, cytogenetic and molecular analyses were used to assess the hybridity. The interspecific hybrid plants were successfully obtained. Most of the morphological characteristics of the hybrids were intermediate between G. herbaceum and G. raimondii. However, the color of glands, anther cases, pollen and corolla, and the state of bracteoles in hybrids were associated with the G. herbaceum. The color of staminal columns and filaments in hybrids were associated with G. raimondii. Cytogenetic analysis confirmed abnormal meiotic behavior existed in hybrids. The hybrids couldn't produce boll-set. Simple sequence repeat results found that besides the fragments inherited from the two parents, some novel bands were amplified in hybrids, indicating that potential mutations and chromosomal recombination occurred between parental genomes during hybridization. These results may provide some novel insights in speciation, genome interaction, and evolution of the tetraploid cotton species.
Some Physical Characteristics of Microcrystalline Cellulose ...
African Journals Online (AJOL)
Purpose: The microcrystalline cellulose is an important ingredient in pharmaceutical, food, cosmetic and other industries. This study aimed at evaluating the physical characteristics of microcrystalline cellulose (CP-MCC), obtained from the raw cotton of Cochlospermum planchonii. Methods: CP-MCC was obtained from the ...
Directory of Open Access Journals (Sweden)
Fuad Calil
2007-09-01
Full Text Available
These experiments deal with the effects of outbreak of early, medium and late developing ramulosis on the IAC-13.l variety of cotton, which was seeded at three different intervals in Itauçu (Goiás—Brazil. The effects of the ramulosis on the height and weight of the plants, on the number of bolls, and on the weight of the cotton seeds and lints, were studied. The experiments were installed in a flat area of red latosoil. The experimental design was one of random blocks with six repetitions and the plants were classified, at the end of their vegetative growth, into the following categories: healthy, early ramulosis, medium ramulosis and late developing ramulosis. The early and medium ramulosis affected more significantly the studied parameters, and it was observed that varieties of cotton which were moderately resistant in relation to ramulosis, can be severely affected during growing seasons of heavy rains such as the 1975/76 season.
Estudaram-se os efeitos da incidência precoce, mediana e tardia de ramulose sobre o peso e altura das plantas, número de capulhos, peso das sementes e da pluma de algodoeiro do cultivar IAC-l3.l em três épocas de semeadura (21/10/75, 21/11/75 e 23/12/75 no município de Itauçu (GO. O experimento foi instalado em região plana com latossolo vermelho. Foram utilizados blocos casualizados com seis repetições e plantas no final do ciclo vegetativo foram classificadas em quatro tipos: sadias, com ramulose precoce, com ramulose mediana ou com ramulose tardia. Concluiu-se que a forma precoce e também a mediana foram as que afetaram mais significativamente os parâmetros aferidos, e que cultivares tidos como de razoável comportamento em relação à ramulose, podem ser severamente afetados em anos agrícolas muito chuvosos como foi o de 1975/76.
Directory of Open Access Journals (Sweden)
Freitas Joelson André de
2001-01-01
Full Text Available Dados da altura individual de dez plantas, obtidos de dez experimentos instalados em blocos casualizados com quatro repetições e quatro cultivares de algodoeiro herbáceo, foram estudados, para determinação do número mínimo de plantas/parcela, necessárias para caracterização da altura média de plantas de algodoeiro herbáceo. Foram estudados cinco tamanhos de amostra na parcela, cada uma, contendo 2, 4, 6, 8 e 10 plantas. Os coeficientes de variação experimental e amostral e as significâncias observadas nas análises de variâncias, indicaram que parcelas contendo seis ou mais plantas, permitiram boa caracterização do porte médio das variedades de algodoeiro testadas. Os resultados sugerem, portanto que, no processo de caracterização da altura média do algodoeiro herbáceo, a avaliação pode ser mais rápida, além de haver uma redução na mão-de-obra de coleta e manuseio dos dados, em decorrência de uma diminuição do número de plantas amostradas na parcela.
Respiratory carbon evolution by leaves under abiotic stress is implicated as a major limitation to crop productivity; however, respiration rates of fully expanded leaves are positively associated with plant growth rates. Given the substantial sensitivity of plant growth to drought, it was hypothesiz...
Zhou, Li; Wang, Na-Na; Gong, Si-Ying; Lu, Rui; Li, Yang; Li, Xue-Bao
2015-11-01
Soil salinity is one of the most serious threats in world agriculture, and often influences cotton growth and development, resulting in a significant loss in cotton crop yield. WRKY transcription factors are involved in plant response to high salinity stress, but little is known about the role of WRKY transcription factors in cotton so far. In this study, a member (GhWRKY34) of cotton WRKY family was functionally characterized. This protein containing a WRKY domain and a zinc-finger motif belongs to group III of cotton WRKY family. Subcellular localization assay indicated that GhWRKY34 is localized to the cell nucleus. Overexpression of GhWRKY34 in Arabidopsis enhanced the transgenic plant tolerance to salt stress. Several parameters (such as seed germination, green cotyledons, root length and chlorophyll content) in the GhWRKY34 transgenic lines were significantly higher than those in wild type under NaCl treatment. On the contrary, the GhWRKY34 transgenic plants exhibited a substantially lower ratio of Na(+)/K(+) in leaves and roots dealing with salt stress, compared with wild type. Growth status of the GhWRKY34 transgenic plants was much better than that of wild type under salt stress. Expressions of the stress-related genes were remarkably up-regulated in the transgenic plants under salt stress, compared with those in wild type. Based on the data presented in this study, we hypothesize that GhWRKY34 as a positive transcription regulator may function in plant response to high salinity stress through maintaining the Na(+)/K(+) homeostasis as well as activating the salt stress-related genes in cells. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
Zhang, Rui; Ding, Jian; Liu, Chunxiao; Cai, Caiping; Zhou, Baoliang; Zhang, Tianzhen; Guo, Wangzhen
2015-01-01
Flowering time is an important ecological trait that determines the transition from vegetative to reproductive growth. Flowering time in cotton is controlled by short-day photoperiods, with strict photoperiod sensitivity. As the CO-FT (CONSTANS-FLOWER LOCUS T) module regulates photoperiodic flowering in several plants, we selected eight CONSTANS genes (COL) in group I to detect their expression patterns in long-day and short-day conditions. Further, we individually cloned and sequenced their homologs from 25 different cotton accessions and one outgroup. Finally, we studied their structures, phylogenetic relationship, and molecular evolution in both coding region and three characteristic domains. All the eight COLs in group I show diurnal expression. In the orthologous and homeologous loci, each gene structure in different cotton species is highly conserved, while length variation has occurred due to insertions/deletions in intron and/or exon regions. Six genes, COL2 to COL5, COL7 and COL8, exhibit higher nucleotide diversity in the D-subgenome than in the A-subgenome. The Ks values of 98.37% in all allotetraploid cotton species examined were higher in the A-D and At-Dt comparison than in the A-At and D-Dt comparisons, and the Pearson’s correlation coefficient (r) of Ks between A vs. D and At vs. Dt also showed positive, high correlations, with a correlation coefficient of at least 0.797. The nucleotide polymorphism in wild species is significantly higher compared to G. hirsutum and G. barbadense, indicating a genetic bottleneck associated with the domesticated cotton species. Three characteristic domains in eight COLs exhibit different evolutionary rates, with the CCT domain highly conserved, while the B-box and Var domain much more variable in allotetraploid species. Taken together, COL1, COL2 and COL8 endured greater selective pressures during the domestication process. The study improves our understanding of the domestication-related genes/traits during cotton evolutionary process. PMID:25710777
Liu, Xueying; Teng, Zhonghua; Wang, Jinxia; Wu, Tiantian; Zhang, Zhiqin; Deng, Xianping; Fang, Xiaomei; Tan, Zhaoyun; Ali, Iftikhar; Liu, Dexin; Zhang, Jian; Liu, Dajun; Liu, Fang; Zhang, Zhengsheng
2017-12-01
Cotton is a significant commercial crop that plays an indispensable role in many domains. Constructing high-density genetic maps and identifying stable quantitative trait locus (QTL) controlling agronomic traits are necessary prerequisites for marker-assisted selection (MAS). A total of 14,899 SSR primer pairs designed from the genome sequence of G. raimondii were screened for polymorphic markers between mapping parents CCRI 35 and Yumian 1, and 712 SSR markers showing polymorphism were used to genotype 180 lines from a (CCRI 35 × Yumian 1) recombinant inbred line (RIL) population. Genetic linkage analysis was conducted on 726 loci obtained from the 712 polymorphic SSR markers, along with 1379 SSR loci obtained in our previous study, and a high-density genetic map with 2051 loci was constructed, which spanned 3508.29 cM with an average distance of 1.71 cM between adjacent markers. Marker orders on the linkage map are highly consistent with the corresponding physical orders on a G. hirsutum genome sequence. Based on fiber quality and yield component trait data collected from six environments, 113 QTLs were identified through two analytical methods. Among these 113 QTLs, 50 were considered stable (detected in multiple environments or for which phenotypic variance explained by additive effect was greater than environment effect), and 18 of these 50 were identified with stability by both methods. These 18 QTLs, including eleven for fiber quality and seven for yield component traits, could be priorities for MAS.
Pandeya, Devendra; Campbell, LeAnne M; Nunes, Eugenia; Lopez-Arredondo, Damar L; Janga, Madhusudhana R; Herrera-Estrella, Luis; Rathore, Keerti S
2017-12-01
This report demonstrates the usefulness of ptxD/phosphite as a selection system that not only provides a highly efficient and simple means to generate transgenic cotton plants, but also helps address many of the concerns related to the use of antibiotic and herbicide resistance genes in the production of transgenic crops. Two of the most popular dominant selectable marker systems for plant transformation are based on either antibiotic or herbicide resistance genes. Due to concerns regarding their safety and in order to stack multiple traits in a single plant, there is a need for alternative selectable marker genes. The ptxD gene, derived from Pseudomonas stutzeri WM88, that confers to cells the ability to convert phosphite (Phi) into orthophosphate (Pi) offers an alternative selectable marker gene as demonstrated for tobacco and maize. Here, we show that the ptxD gene in combination with a protocol based on selection medium containing Phi, as the sole source of phosphorus (P), can serve as an effective and efficient system to select for transformed cells and generate transgenic cotton plants. Fluorescence microscopy examination of the cultures under selection and molecular analyses on the regenerated plants demonstrate the efficacy of the system in recovering cotton transformants following Agrobacterium-mediated transformation. Under the ptxD/Phi selection, an average of 3.43 transgenic events per 100 infected explants were recovered as opposed to only 0.41% recovery when bar/phosphinothricin (PPT) selection was used. The event recovery rates for nptII/kanamycin and hpt/hygromycin systems were 2.88 and 2.47%, respectively. Molecular analysis on regenerated events showed a selection efficiency of ~ 97% under the ptxD/Phi system. Thus, ptxD/Phi has proven to be a very efficient, positive selection system for the generation of transgenic cotton plants with equal or higher transformation efficiencies compared to the commonly used, negative selection systems.
Directory of Open Access Journals (Sweden)
Nacer eBellaloui
2015-03-01
Full Text Available Cotton is an important crop in the world and is a major source of oil for human consumption and cotton meal for livestock. Cottonseed nutrition (seed composition: protein, oil, and minerals determine the quality of seeds. Therefore, maintaining optimum levels of cottonseed nutrition is critical. Physiological and genetic mechanisms controlling the levels of these constituents in cottonseed are still largely unknown. Our previous research conducted under greenhouse conditions showed that seed and leaf nutrition differed between fuzzless and fuzzy seed isolines. Therefore, the objective of this research was to investigate the seed fuzz phenotype (trait effects on seed protein, oil, N, C, S, and minerals in five sets of near-isogenic mutant cotton lines for seed fuzz in a two-year experiment under field condition to evaluate the stability of the effect of the trait on seed nutrition. The isolines (genotypes in each set differ for the seed fuzz trait (fuzzless/linted seed line, N lines, and fuzzy/linted seed line, F lines. Results showed that seed protein was higher in the fuzzy genotype in all sets, but seed oil was higher in fuzzless genotype in all sets. The concentrations of seed Ca and C were higher in all fuzzless genotypes, but N, S, B, Fe, and Zn were higher in most of the fuzzy genotypes. Generally, minerals were higher in leaves of F lines, suggesting the translocation of minerals from leaves to seeds was limited. The research demonstrated that fiber development could be involved in cottonseed composition. This may be due to the involvement of fiber development in carbon and nitrogen metabolism, and the mobility of nutrients from leaves (source to seed (sink. This information is beneficial to breeders to consider fuzzless cottonseed for potential protein and oil use and select for higher oil or higher protein content, and to physiologists to further understand the mobility of minerals to increase the quality of cottonseed nutrition for food and feed.
Directory of Open Access Journals (Sweden)
Luis Fernando Campuzano Duque
2015-07-01
Full Text Available For the last 15 years, Colombia has developed a research process leading to the expansion of its agricultural frontier at the flat well drained savannas of the Eastern Plains, by improving predominantly acid soils with liming to increase base saturation with depth, vertical liming —as its referred locally—, crop rotation with rice, corn, soybeans, and with the potential to include other crops like cotton in the rotation system. To achieve this, a pioneering research in Colombia was conducted to determine the adaptation of cotton in the acid conditions of the high plains improved sheets. An Agronomic evaluation test was developed using five elite genotypes of cotton in a design of a randomized complete block at four locations in soils with base saturation above 80 %. The results identified a genotype (LC-156, which presented an adaptation to the high plains, associated with an average yield of 2.2 t/ha of cottonseed, 1.5 t/ha of cotton fiber type medium-long, a percentage of fiber extraction above 36.0 %. The comparative advantage of this region for sustainable cotton production is given by the yield of cotton fiber —which ishigher than the national average—, to the 33.2 % reduction in production costs, the quality of long/medium-fiber destined for export and the absence of the pest insect of greatest economic impact in Colombia: the weevil (Anthonomus grandis Boheman.
Directory of Open Access Journals (Sweden)
Eduardo Zink
1969-01-01
Full Text Available São relatados os resultados das determinações do poder germinativo de sementes de sete variedades paulistas de algodoeiro, provenientes de ensaios de competição de variedades instalados nos Estados de São Paulo e Paraná, no ano agrícola de 1966/67. Os testes de germinação foram efetuados simultaneamente no Laboratório de Sementes, do Instituto Agronômico do Estado de São Paulo, e no Laboratório Central, da Divisão de Sementes e Mudas, da Secretaria da Agricultura do Estado de São Paulo. Com referência a plântulas normais e plântulas anormais B (infetadas verificaram-se, conforme o caso, diferenças significativas entre localidades, entre variedades, entre laboratórios e entre substratos, bem como diversas interações envolvendo as variáveis mencionadas.Seeds of seven varieties of cotton produced at different regions of the States of São Paulo and Paraná (Brazil were submitted to germination tests at two laboratories: Instituto Agronômico de Campinas (IAC at 20 - 30°C and Divisão de Sementes e Mudas (DSM at 30°C. The substrata used for the tests were cotton towels desinfected differently at each laboratory. The statistical analysis for numbers of normal and abnormal plants (infected showed significant differences between regions, varieties, laboratories and substrata. Several significant interactions including these variables were also detected.
Directory of Open Access Journals (Sweden)
Alves-Ferreira Marcio
2010-03-01
Full Text Available Abstract Background Normalizing through reference genes, or housekeeping genes, can make more accurate and reliable results from reverse transcription real-time quantitative polymerase chain reaction (qPCR. Recent studies have shown that no single housekeeping gene is universal for all experiments. Thus, suitable reference genes should be the first step of any qPCR analysis. Only a few studies on the identification of housekeeping gene have been carried on plants. Therefore qPCR studies on important crops such as cotton has been hampered by the lack of suitable reference genes. Results By the use of two distinct algorithms, implemented by geNorm and NormFinder, we have assessed the gene expression of nine candidate reference genes in cotton: GhACT4, GhEF1α5, GhFBX6, GhPP2A1, GhMZA, GhPTB, GhGAPC2, GhβTUB3 and GhUBQ14. The candidate reference genes were evaluated in 23 experimental samples consisting of six distinct plant organs, eight stages of flower development, four stages of fruit development and in flower verticils. The expression of GhPP2A1 and GhUBQ14 genes were the most stable across all samples and also when distinct plants organs are examined. GhACT4 and GhUBQ14 present more stable expression during flower development, GhACT4 and GhFBX6 in the floral verticils and GhMZA and GhPTB during fruit development. Our analysis provided the most suitable combination of reference genes for each experimental set tested as internal control for reliable qPCR data normalization. In addition, to illustrate the use of cotton reference genes we checked the expression of two cotton MADS-box genes in distinct plant and floral organs and also during flower development. Conclusion We have tested the expression stabilities of nine candidate genes in a set of 23 tissue samples from cotton plants divided into five different experimental sets. As a result of this evaluation, we recommend the use of GhUBQ14 and GhPP2A1 housekeeping genes as superior references for normalization of gene expression measures in different cotton plant organs; GhACT4 and GhUBQ14 for flower development, GhACT4 and GhFBX6 for the floral organs and GhMZA and GhPTB for fruit development. We also provide the primer sequences whose performance in qPCR experiments is demonstrated. These genes will enable more accurate and reliable normalization of qPCR results for gene expression studies in this important crop, the major source of natural fiber and also an important source of edible oil. The use of bona fide reference genes allowed a detailed and accurate characterization of the temporal and spatial expression pattern of two MADS-box genes in cotton.
Artico, Sinara; Nardeli, Sarah M; Brilhante, Osmundo; Grossi-de-Sa, Maria Fátima; Alves-Ferreira, Marcio
2010-03-21
Normalizing through reference genes, or housekeeping genes, can make more accurate and reliable results from reverse transcription real-time quantitative polymerase chain reaction (qPCR). Recent studies have shown that no single housekeeping gene is universal for all experiments. Thus, suitable reference genes should be the first step of any qPCR analysis. Only a few studies on the identification of housekeeping gene have been carried on plants. Therefore qPCR studies on important crops such as cotton has been hampered by the lack of suitable reference genes. By the use of two distinct algorithms, implemented by geNorm and NormFinder, we have assessed the gene expression of nine candidate reference genes in cotton: GhACT4, GhEF1alpha5, GhFBX6, GhPP2A1, GhMZA, GhPTB, GhGAPC2, GhbetaTUB3 and GhUBQ14. The candidate reference genes were evaluated in 23 experimental samples consisting of six distinct plant organs, eight stages of flower development, four stages of fruit development and in flower verticils. The expression of GhPP2A1 and GhUBQ14 genes were the most stable across all samples and also when distinct plants organs are examined. GhACT4 and GhUBQ14 present more stable expression during flower development, GhACT4 and GhFBX6 in the floral verticils and GhMZA and GhPTB during fruit development. Our analysis provided the most suitable combination of reference genes for each experimental set tested as internal control for reliable qPCR data normalization. In addition, to illustrate the use of cotton reference genes we checked the expression of two cotton MADS-box genes in distinct plant and floral organs and also during flower development. We have tested the expression stabilities of nine candidate genes in a set of 23 tissue samples from cotton plants divided into five different experimental sets. As a result of this evaluation, we recommend the use of GhUBQ14 and GhPP2A1 housekeeping genes as superior references for normalization of gene expression measures in different cotton plant organs; GhACT4 and GhUBQ14 for flower development, GhACT4 and GhFBX6 for the floral organs and GhMZA and GhPTB for fruit development. We also provide the primer sequences whose performance in qPCR experiments is demonstrated. These genes will enable more accurate and reliable normalization of qPCR results for gene expression studies in this important crop, the major source of natural fiber and also an important source of edible oil. The use of bona fide reference genes allowed a detailed and accurate characterization of the temporal and spatial expression pattern of two MADS-box genes in cotton.
Directory of Open Access Journals (Sweden)
Hafeez-ur-Rahman
2006-01-01
Full Text Available Heat tolerance is measured at tissue level by cellular membrane thermostability (CMT and at the whole plant level by the heat tolerance index (HTI. Eight upland cotton cultivars and 15 crosses were used to determine the type and extent of genetic variability associated with the expression of these traits between and within environments. Heat stress and non-stress conditions were used as the CMT environments and years for HTI. The wide variation in heterotic expression and combining ability effects observed for CMT and HTI suggest multigenic inheritance of these traits. Significant genetic variability across environments was evident but the traits were not highly heritable because of substantial environmental interaction. The available genetic variability included both additive and non-additive components, but the proportion of additive genetic variability was high for HTI. The parental cultivars CRIS-19 and CIM-448 were good donor parents for high CMT under heat-stressed conditions, and MNH-552 and N-Karishma under non-stressed conditions. Cultivar FH-634 was a good donor parent for HTI. The results show two types of general combining ability (GCA inheritance among high CMT parents: positive GCA inheritance expressed by CRIS-19 in the presence of heat stress and MNH-552 and N-Karishma in the absence of heat stress; and negative GCA inheritance expressed by FH-900 in the presence of heat stress. It was also evident that genes controlling high CMT in cultivar CRIS-19 were different from those present in the MNH-552, N-Karishma and FH-900 cultivars. Similarly, among high HTI parents, FH-634 showed positive and CIM-443 negative GCA inheritance. No significant relationship due to genetic causes existed between tissue and whole plant heat tolerance, diminishing the likelihood of simultaneous improvement and selection of the two traits.
Directory of Open Access Journals (Sweden)
Muhammad Sohail
2011-11-01
Full Text Available Cotton is more sensitive to low K availability than most other major field crops, and often shows symptoms of K deficiency in soils not considered K deficient. Field investigation was conducted at Sahiwal to study the effect of different rates of K and Na application on seed cotton yield, ionic ratio and quality characteristics of two cotton varieties. Ten soil K: Na ratios were developed after considering indigenous K, Na status in soil. The treatments of K+Na in kg ha-1 to give K:Na ratios were as: 210+ 60 (3.5:1 i.e. control, 225 + 60 (3.75:1, 240 + 60 (4:1, 255 + 60 (4.25:1, 270 + 60 (4.5:1, 210 + 75 (2.8:1, 225 + 75 (3:1, 240 + 75 (3.2:1, 255 + 75 (3.4:1 and 270 + 75 (3.6:1. Control treatment represented indigenous K, Na status of soil. The experiment continued until maturity. Maximum seed cotton yield of NIBGE-2 was observed at K: Na ratio of 3.6:1. Variety NIBGE-2 manifested greater seed cotton yield than MNH-786. Leaf K: Na ratio of two cotton varieties differed significantly (p < 0.01 due to varieties, rates of K and Na and their interaction. Variety NIBGE-2 maintained higher K: Na ratio than MNH-786 and manifested good fiber quality. There was significant relationship (R2 = 0.55, n = 10 between K: Na ratio and fiber length and significant relationship (R2 = 0.65, n = 10 between K concentration and fiber length for NIBGE-2. There was also significant relationship (R2 = 0.91, 0.78, n = 10 between boll number and seed cotton yield for both varieties. The increase in yield was attributed to increased boll weight.
Directory of Open Access Journals (Sweden)
L. Ali
2009-05-01
Full Text Available A pot study was conducted to investigate the growth response, ionic and water relations of two cotton varieties. Four levels of K and Na were developed after considering indigenous K, Na status in soil. The treatments of K + Na in mg kg-1 were adjusted as: 105 + 37.5, 135 + 30, 135 + 37.5 and 105 + 30 (control. Control treatment represented indigenous K and Na status of soil. Higher but non significant relative water contents were observed in treatments of135 + 30 mg kg-1 followed by 135 + 37.5 mg kg-1. The beneficial effects of Na with K application were observed greater in NIBGE-2 than in MNH-786. Both varieties varied non-significantly with respect to K:Na ratio in leaf, water potential and total chlorophyll contents. Significant relationship (R2=0.51, n= 4, average of four replicates was found between total dry weight and relative water contents in NIBGE-2.
Sajjad, Aamer; Anjum, Shakeel Ahmad; Ahmad, Riaz; Waraich, Ejaz Ahmad
2018-01-01
Delayed sowing of wheat (Triticum aestivum L.) in cotton-based system reduces the productivity and profitability of the cotton-wheat cropping system. In this scenario, relay cropping of wheat in standing cotton might be a viable option to ensure the timely wheat sowing with simultaneous improvement in wheat yields and system profitability. This 2-year study (2012-2013 and 2013-2014) aimed to evaluate the influence of sowing dates and relay cropping combined with different management techniques of cotton sticks on the wheat yield, soil physical properties, and the profitability of the cotton-wheat system. The experiment consisted of five treatments viz. (S1) sowing of wheat at the 7th of November by conventional tillage (two disc harrows + one rotavator + two plankings) after the removal of cotton sticks, (S2) sowing of wheat at the 7th of November by conventional tillage (two disc harrows + two plankings) after the incorporation of cotton sticks in the field with a rotavator, (S3) sowing of wheat at the 7th of November as relay crop in standing cotton with broadcast method, (S4) sowing of wheat at the 15th of December by conventional tillage (two disc harrows + one rotavator + two plankings) after the removal of cotton sticks, and (S5) sowing of wheat at the 15th of December by conventional tillage (two disc harrows + two plankings) after the incorporation of cotton sticks in the field with a rotavator. The highest seed cotton yield was observed in the S5 treatment which was statistically similar with the S3 and S4 treatments; seed cotton yield in the S1 and S2 treatments has been the lowest in both years of experimentation. However, the S2 treatment produced substantially higher root length, biological yield, and grain yield of wheat than the other treatments. The lower soil bulk density at 0-10-cm depth was recorded in the S2 treatment which was statistically similar with the S5 treatment during both years of experimentation. The volumetric water contents, net benefit, and benefit-cost ratio were the highest in the S3 treatment during both years of experimentation. Thus, relay cropping of wheat in standing cotton might be a viable option to improve the soil physical environment and profitability of the cotton-wheat cropping system.
Directory of Open Access Journals (Sweden)
Amarjeet Kumar Singh
Full Text Available Transgenic cotton was developed using two constructs containing a truncated and codon-modified cry1Ac gene (1,848 bp, which was originally characterized from Bacillus thuringiensis subspecies kurstaki strain HD73 that encodes a toxin highly effective against many lepidopteran pests. In Construct I, the cry1Ac gene was cloned under FMVde, a strong constitutively expressing promoter, to express the encoded protein in the cytoplasm. In Construct II, the encoded protein was directed to the plastids using a transit peptide taken from the cotton rbcSIb gene. Genetic transformation experiments with Construct I resulted in a single copy insertion event in which the Cry1Ac protein expression level was 2-2.5 times greater than in the Bacillus thuringiensis cotton event Mon 531, which is currently used in varieties and hybrids grown extensively in India and elsewhere. Another high expression event was selected from transgenics developed with Construct II. The Cry protein expression resulting from this event was observed only in the green plant parts. No transgenic protein expression was observed in the non-green parts, including roots, seeds and non-green floral tissues. Thus, leucoplasts may lack the mechanism to allow entry of a protein tagged with the transit peptide from a protein that is only synthesized in tissues containing mature plastids. Combining the two events through sexual crossing led to near additive levels of the toxin at 4-5 times the level currently used in the field. The two high expression events and their combination will allow for effective resistance management against lepidopteran insect pests, particularly Helicoverpa armigera, using a high dosage strategy.
International Nuclear Information System (INIS)
Zafar, Z. U.; Hussain, K.; Athar, H. U. R.
2015-01-01
Water stress reduces crop growth and productivity by affecting various physiological and biochemical processes. Although foliar application of osmoprotectants alleviates the detrimental effects of drought stress growth and productivity of crops, its economic benefits on large scale has not been explored yet. The studies were carried out to quantify the interactive effects of some osmoprotectantsand various watering regimes on cotton crop. The treatments consisted of water stress and osmoprotectant applications ((a) two watering regimes (well watered, 2689m /sup 3/ water; drought stressed, 2078m /sup 3/), and (b) three osmoprotectants (untreated check; water spray containing 0.1 percentage Tween-80; salicylic acid (100 mg L /sup -1/); proline (100 mg L /sup -1/); glycine betaine (100 mg L /sup -1/)) in split plot design. The crop was subjected to drought stress at day 45 after sowing, i.e. at the flowering stage. The solutions of osmoprotectants were foliarly applied after two weeks of imposition of water stress (at the peak flowering stage). The results showed that imposition of water stress caused substantial reduction in plant growth, biological yield, fruit production, and fiber characteristics as compared to fully irrigated cotton crop. However, the application of osmoprotectants was found effective in off-setting the negative impacts of drought stress. The exogenous application of salicylic acid (100 mgL /sup -1/) caused improvement by 47.9 percentage, 36.5 percentage, 17.4 percentage, 4.86 percentage and 9.9 percentage in main stem height, biological yield, fruit production, fiber length and seed cotton yield over an untreated check, respectively. The efficiency of various osmoprotectants was in order of salicylic acid > glycinebetaine > proline in alleviating the harmful effects of drought stress. The usage of osmoprotectants was also found most cost-effective and the value for money. The cost-benefit ratio was 1:9.1, 1:3.9 and 1:1.7 by spraying of salicylic acid, proline and glycinebetaine, respectively. The research study reveals that salicylic acid may be foliarly applied to sustain growth, productivity, fiber characteristics and ultimately accruing higher profits under water stress environment. (author)
Pandey, Dhananjay K; Chaudhary, Bhupendra
2016-05-13
Plant profilin genes encode core cell-wall structural proteins and are evidenced for their up-regulation under cotton domestication. Notwithstanding striking discoveries in the genetics of cell-wall organization in plants, little is explicit about the manner in which profilin-mediated molecular interplay and corresponding networks are altered, especially during cellular signalling of apical meristem determinacy and flower development. Here we show that the ectopic expression of GhPRF1 gene in tobacco resulted in the hyperactivation of apical meristem and early flowering phenotype with increased flower number in comparison to the control plants. Spatial expression alteration in CLV1, a key meristem-determinacy gene, is induced by the GhPRF1 overexpression in a WUS-dependent manner and mediates cell signalling to promote flowering. But no such expression alterations are recorded in the GhPRF1-RNAi lines. The GhPRF1 transduces key positive flowering regulator AP1 gene via coordinated expression of FT4, SOC1, FLC1 and FT1 genes involved in the apical-to-floral meristem signalling cascade which is consistent with our in silico profilin interaction data. Remarkably, these positive and negative flowering regulators are spatially controlled by the Actin-Related Protein (ARP) genes, specifically ARP4 and ARP6 in proximate association with profilins. This study provides a novel and systematic link between GhPRF1 gene expression and the flower primordium initiation via up-regulation of the ARP genes, and an insight into the functional characterization of GhPRF1 gene acting upstream to the flowering mechanism. Also, the transgenic plants expressing GhPRF1 gene show an increase in the plant height, internode length, leaf size and plant vigor. Overexpression of GhPRF1 gene induced early and increased flowering in tobacco with enhanced plant vigor. During apical meristem determinacy and flower development, the GhPRF1 gene directly influences key flowering regulators through ARP-genes, indicating for its role upstream in the apical-to-floral meristem signalling cascade.
We investigated DNA sequencing information from alleles (DNA amplified fragments) of two previously reported SSR markers (CIR316 and MUCS088) linked to root-knot nematode (RKN) resistance genes. Markers based on electrophoretic differences, including RFLPs, AFLPs and SSRs can sometimes mask underlyi...
Directory of Open Access Journals (Sweden)
G. Prem Kumar
2015-09-01
Full Text Available An efficient protocol was developed to control excessive phenolic compound secretion during callus culture of cotton. As cotton is naturally rich in phenolic compounds factors influencing the phenolic compound secretion, callus induction and proliferation were optimized for getting high frequency callus culture. Different carbon sources such as fructose, glucose, sucrose and maltose were tested at various concentrations to control phenolic secretion in callus culture. Among them, 3% maltose was found to be the best carbon source for effectively controlling phenolic secretion in callus induction medium. High frequency of callus induction was obtained on MSB5 medium supplemented with 3% Maltose, 2,4-D (0.90 μM and Kinetin (4.60 μM from both cotyledon and hypocotyl explants. The best result of callus induction was obtained with hypocotyl explant (94.90% followed by cotyledon explant (85.20%. MSB5 medium supplemented with 2,4-D (0.45 μM along with 2iP (2.95 μM gave tremendous proliferation of callus with high percentage of response. Varying degrees of colors and textures of callus were observed under different hormone treatments. The present study offers a solution for controlling phenolic secretion in cotton callus culture by adjusting carbon sources without adding any additives and evaluates the manipulation of plant growth regulators for efficient callus culture of SVPR-2 cotton cultivar.
Romanel, Elisson; Silva, Tatiane F; Corrêa, Régis L; Farinelli, Laurent; Hawkins, Jennifer S; Schrago, Carlos E G; Vaslin, Maite F S
2012-11-01
Small RNAs (sRNAs) are a class of non-coding RNAs ranging from 20- to 40-nucleotides (nts) that are present in most eukaryotic organisms. In plants, sRNAs are involved in the regulation of development, the maintenance of genome stability and the antiviral response. Viruses, however, can interfere with and exploit the silencing-based regulatory networks, causing the deregulation of sRNAs, including small interfering RNAs (siRNAs) and microRNAs (miRNAs). To understand the impact of viral infection on the plant sRNA pathway, we deep sequenced the sRNAs in cotton leaves infected with Cotton leafroll dwarf virus (CLRDV), which is a member of the economically important virus family Luteoviridae. A total of 60 putative conserved cotton miRNAs were identified, including 19 new miRNA families that had not been previously described in cotton. Some of these miRNAs were clearly misregulated during viral infection, and their possible role in symptom development and disease progression is discussed. Furthermore, we found that the 24-nt heterochromatin-associated siRNAs were quantitatively and qualitatively altered in the infected plant, leading to the reactivation of at least one cotton transposable element. This is the first study to explore the global alterations of sRNAs in virus-infected cotton plants. Our results indicate that some CLRDV-induced symptoms may be correlated with the deregulation of miRNA and/or epigenetic networks.
The instantaneous transpiration efficiency (ITE, the ratio of photosynthesis rate to transpiration) is an important variable for crops, because it ultimately affects dry mass production per unit of plant water lost to the atmosphere. The theory that stomata optimize carbon uptake per unit water used...
Directory of Open Access Journals (Sweden)
Armando M. Macêdo
2007-09-01
Full Text Available
In order to study the critical time that weeds compete with the cotton plant, five trial experiments were conducted from 1978-1981. Two of the trials were carried out in a dark red latosoil with 4.70% organic matter and 10.73% clay, at the Rio Verde Agricultural School in the state of Goiás, during the 1978—79 and 1979—80 planting seasons. The other three were carried out in dark red latosoil, with a loam clay texture, moderate acidity and a low proportion of organic matter, at the Experimental station in Goiânia, Goiás during the 1978—79, 1979—80 and 1980—81 planting seasons. The treatments designed were: weeding up to 2, 4, 6, 8 first weeks, and weeding during the whole cycle ,and weeding after the 2, 4, 6, 8 first weeks and no weeding at all during the cycle. The results showed that weed competition , when not controlled, determined a yield loss of 88.75% in Goiânia and 90.65% in Rio Verde. Regarding the group control, which was maintained without weed competition, the best yield was obtained when the cotton was maintained without competition during eight weeks after the emergence in Rio Verde and during 4, 6, 8 weeks in Goiânia. The critical competition period occurred between the fourth and sixth weeks after the emergence in Rio Verde and in the fourth week after the emergence in Goiânia.
Com a finalidade de estudar as épocas críticas de competição de plantas daninhas com o algodoeiro (Gossipium hirsutum L. , foram instalados cinco ensaios em área do Colégio Agrícola de Rio Verde — Goiás, no período de 1978 a 1981, sendo dois ensaios nos anos agrícolas de 1978/79 e 1979/80 em latossolo vermelho—escuro com 4,71% de matéria orgânica e 10,73% de argila. Os outros três ensaios foram instalados nos anos agrícolas 1978/79, 1979/80 e 1980/81, em área da Estação Experimental de Goiânia, Estado de Goiás, em latossolo vermelho-escuro distrófico textura franco argilosa, acidez moderada e baixo teor de matéria orgânica. Os tratamentos foram: capinas até 2, 4, 6, 8 primeiras semanas e durante todo o ciclo e capinas após 2, 4, 6, 8 primeiras semanas e todo o ciclo sem capinas. Os resultados mostraram que a competição das plantas daninhas com a cultura, quando não controlada, provocou 88,75% de perda na produção, em Goiânia, e 90,65% em Rio Verde. Em relação à testemunha, mantida livre de competição durante todo o ciclo, o melhor rendimento foi obtido quando se manteve a cultura livre de competição durante oito semanas após a emergência do algodoeiro, em Rio Verde, e durante 4, 6, 8 semanas na 6ª semana, em Rio Verde, e em Goiânia na 4ª semana após a emergência do algodoeiro.
Directory of Open Access Journals (Sweden)
José Janduí Soares
2006-07-01
Full Text Available O objetivo deste trabalho foi verificar o efeito da época de plantio na produção e ocorrência de pragas em culturas do algodoeiro. Foi analisada a influência da época de plantio no rendimento e na ocorrência de pragas nos cultivares de algodoeiro CNPA 7H e DeltapineAcala 90, em Formosa do Rio Preto, São Desidério e Luiz Eduardo Magalhães, no estado da Bahia, nos campos experimentais da Embrapa, instalados nas fazendas Independência, Mizote e Poletto, respectivamente. Quatro épocas foram avaliadas e os plantios foram feitos nos meses de novembro, dezembro e janeiro, safras 1998/1999 e 1999/2000, com intervalos de 15 dias entre cada plantio. Os dados foram submetidos à análise da variância e as médias comparadas pelo teste de Tukey a 5% de probabilidade. Realizou-se levantamentos semanais de 5 insetos-praga e pulverizações para manter a infestação abaixo dos níveis de controle. Por meio dos resultados obtidos, pode-se inferir que: a a época de plantio tem uma marcante influência na produção do algodoeiro; b a época de plantio do algodoeiro influencia a ocorrência de insetos-praga com reflexos em sua produtividade.The aim of this research was to determine the effect of planting date and the occurrence of pests on the cotton crop. The influence of the planting date on the output of the cotton CNPA 7H and Deltapine Acala 90, at Formosa do Rio Preto, São Desidério and Luiz Eduardo Magalhães, in the experimental fields of the Embrapa, in the state of Bahia, was analyzed. Four planting dates were evaluated. The plantings were in November, December and January, 1998/1999 and 1999/2000 crops, with intervals of 15 days between each planting. The data were submitted to analysis of variance and the averages compared by Tukey’s test at 5% probability. According to the results, the following conclusions can be inferred: a The planting date has a significant influence on the cotton production; b The cotton planting date influences the occurrence of pests, leading, thus, to asignificant decrease in the production.
Directory of Open Access Journals (Sweden)
Wilson Ferreira de Oliveira
2007-09-01
Full Text Available
Foram instalados nas dependências do Departamento Fitossanitário da Escola de Agronomia - UFG, ensaio “in vitro”, em BDA2 e a nível de Casa de Vegetação, objetivando testar a eficiência de diferentes dosagens de Iprodione + Thiran (Rovrin em comparação com PCNB (Brassicol 75 BR, TMTD (Rhodiauran 70 e Captan + Pencycuron (Monceren para o controle de Rhizoctonia solani Kuhn, na cultura do algodoeiro, através do tratamento de sementes. Os resultados obtidos, nas condições de realização dos ensaios, permitem concluir que os fungicidas Rovrin - 320 g.i.a., Monceren - 210 g.i.a., Rovrin - 240 g.i.a., Rovrin - 200 g.i.a., PCNB - 450 g.i.a./100 litros de água ou 100 kg de sementes mostraram-se eficientes e não diferiram estatisticamente entre si no controle de R. solani, enquanto que o produto TMTD (Rhodiauran 70 na dosagem de 280 g.i.a./100 litros de água ou 100 kg de sementes de algodoeiro não se mostrou eficiente no controle deste agente causal.
Aiming to test the efficiency of different dosages of Iprodione + Thiram (Rovrin in comparison with PCNB (Brassicol 75 BR, TMTD (Rhodiauran 70 and Captan + Pencycuron (Monceren for controlling Rhizoctonia solani Kuhn, in cotton plantation, through seeds treatment, was mounted essays “in vitro” at greenhouse level and BDA, in the Phytosanitary Department annexes of School of Agronomy-UFG. The results obtained, at essays conditions, permit to conclude that fungicides Rovrin - 320 g.i.a., Monceren - 210 g.i.a., Rovrin - 240 g.i.a., Rovrin - 200 g.i.a., PCNB - 450 g.i.a./l00 liters of water or 100kg of seeds, were efficient and statistically had no variation among them, in controlling R. solani, while chemical product TMTD (Rhodiauran 70, at dosage of 280 g.i.a./100 liters of water or 100 kg of cotton seeds, was not efficient in controlling this causal agent.
Directory of Open Access Journals (Sweden)
J.P. Laca-Buendia
1992-01-01
Full Text Available Com o objetivo de conhecer a eficiência do herbicida clethodim no controle de plantas daninhas gramíneas e seu comportamento seletivo na cultura do algodão, cv. IAC-20, foi instalado um experimento em solo aluvial de textura arenosa. Foram estudados os seguintes tratamentos: clethodim + óleo mineral nas doses de 0,84 0,96 e 0,108 kg/ha + 0,5 % v/v, sethoxydim + óleo mineral a 0,23 kg/ha + 0,5% v/v em pós-emergência, alachlor a 2,4 kg/ha em pós-emergência, trifluralin a 0,89 kg/ha em pós-plantio incorporado, uma testemunha capinada e outra sem capina. As espécies de plantas daninhas mais freqüentes foram: Cenchrus echinatus L. (capim-carrapicho, Eleusine indica (L. Gaertn. (capim-pé-de-galinha e Brachiaria plantaginea (Link. Hitch. (capim-marmelada. Nenhum dos herbicidas testados apresento injúria à cultura. Quanto à produção, esses herbicidas apresentaram diferenças significativas em relação à testemunha capinada (828 kg/ha, sendo que o tratamento com clethodim + óleo mineral a 0,108 kg/ha + 0,5% v/v (528 kg/ha foi o único que apresentou diferenças significativas com a testemunha sem capina (330 kg/ha. Na altura da planta, a testemunha capinada somente apresentou diferenças significativas em relação ao tratamento com trifluralin e a testemunha sem capina. O carrapicho-de-burro e o capim-pé-de-galinha foram eficientemente controlados pelo clethodim + óleo mineral, em todas as doses estudadas, e sethoxydim + óleo mineral, com controle acima de 80% aos 45 dias da aplicação. O capim-marmelada foi eficientemente controlado pelo clethodim + óleo mineral a 0,096 e 0,108 kg/ha + 0,5% v/v, com 86% e 94%, respectivamente, seguido de sethoxydim + óleo mineral com 83%, e trifluralin com 71% de controle, até 45 dias após aplicação. O total de gramíneas foi eficientemente controlado pelo clethodim + óleo mineral 0,108 kg/ha + 0,5% v/v com 94,2% seguido de clethodim + óleo mineral 0,096 kg/ha + 0,5% v/v, com 85% e sethoxydim + óleo mineral, com 83% de controle, até 45 dias após a aplicação.An experiment in the Porteirinha region, north of Minas Gerais state, Brazil, was performed with the cotton cultivar IAC-20 to find out the efficiency of clethodim 0.84, 0,96 and 0,108 kg/ha plus 0.5% mineral oil v/v, in comparison to sethoxidim 0.23 kg/ha plus 0.5% mineral oil v/v, all those treatments in post emergence; other treatments were in preplanting time and incorporated to the soil alachlor 2,4 kg/ha and trifluralin 0.89 kg/ha; as check were used no weeded plots and hoed plots. The weeds involved were Cenchrus echinatus L., Eleusine indica (L. Gaertn. And Brachiaria plantaginea (Link. Hitch. None of the tested herbicides were noxious to the cotton plants. The highest production in cotton was obtained from the check hoed plots (828 kg/ha; in the second place the clethodim 0.108 kh/ha gave 528 kg/ha, the only treatments statistically different from the no weeded plots wich gave 330 kg/ha. Clethodim gave good control of Cenchrus echinatus and Eleusine indica, with all doses. Brachiaria plantaginea was efficiently controlled (86% and more by clethodim. Clethodim followed by sethoxydim gave in general 83% and 85% control of all the grasses.
International Nuclear Information System (INIS)
Vasti, S.M.
1981-06-01
Disease resistant, high yielding and higher quality cotton varieties were developed. 42 interspecific hybrid progenies of earlier crosses between Gossypium barbadense and Gossypium tomentosum or Gossypium barbadense and Gossypium hirsutum were included. Out of these, 22 progenies in F 3 generation were irradiated by gamma radiation doses of 20 and 25 kR. A list is given of interspecific hybrid progenies, as are the lists of boll rot susceptible and resistant plants in the irradiated and non-irradiated populations and/or successful crosses made between 1977 and 1978
High-density linkage maps are vital to supporting the correct placement of scaffolds and gene sequences on chromosomes and fundamental to contemporary organismal research and scientific approaches to genetic improvement; high-density linkage maps are especially important in paleopolyploids with exce...
Pisani, Elena; Masiero, Mauro; Scrocco, Stefano
2015-01-01
In Peru the agro-export boom has determined a major shift of large farmers from traditional agro-industrial crops (coffee and cotton) to new agribusinesses (asparagus, oranges, avocados, apples). These dynamics have left room for the small farmers to enter the traditional agro-industrial sector, or into new niche markets as in the case of native cotton. On the North coast of Peru the cultivation of the native and naturally coloured cotton (Gos...
The Virescent Yellow leaf cotton line Seed Accession 30 (SA30) was crossed with four modern parental lines (DP5690, DES119, SG747 and MD51ne) to develop four sets of near isogenic lines (NILs) segregating for green and yellow leaves. Comparisons of these lines were made in the field in a two year re...
LTR-retrotransposons-based molecular markers in cultivated ...
African Journals Online (AJOL)
GRACE
2006-07-03
Jul 3, 2006 ... LTR-retrotransposons represent a standard component of the Gossypium Genome (Zaki and Abdel Ghany,. 2003). The analysis of the molecular existence and distribution of ancient and active LTR-retrotransposons, therefore, provides a comprehensive evaluation of the evolutionary history of Gossypium.
Spectral discrimination of two pigweeds from cotton with different leaf colors
To implement strategies to control Palmer amaranth (Amaranthus palmeri S. Wats.) and redroot pigweed (Amaranthus retroflexus L.) infestations in cotton (Gossypium hirsutum L.) production systems, managers need effective techniques to identify the weeds. Leaf light reflectance measurements have shown...
African Journals Online (AJOL)
User
formulated were cotton-seed Gossypium spp. meal replaced fish meal at graded levels of. 20%, 30%, 40% ... from capture fisheries, which has still not been able to ..... Marine Resource Occasional. ... Symposium on Tilapia in Aquaculture, Rio.
African Journals Online (AJOL)
DELL
Ife Journal of Science vol. 20, no. 1 (2018) ... INTRODUCTION. The cotton genus Gossypium (Family Malvaceae) .... substrate to evaluate the antioxidative activity of antioxidants. .... Lagos Teaching Hospital, Idi-Araba, Lagos. Antimicrobial ...
Federal Laboratory Consortium — The Udall lab is interested in genome evolution and cotton genomics.The cotton genus ( Gossypium) is an extraordinarily diverse group with approximately 50 species...
African Journals Online (AJOL)
Items 101 - 150 of 775 ... ... (watermelon) extract against lipid oxidation in fish during cooking, Abstract PDF ... Vol 8, No 2 (2015), Assessment of cotton-seed (Gossypium ... to Vigna unguiculata l (beans) grown on crude oil contaminated soil ...
Cottonseed oil and yield assessment via economic heterosis and ...
African Journals Online (AJOL)
user
2010-11-01
Nov 1, 2010 ... ISSN 1684–5315 ©2010 Academic Journals. Full Length ... Key words: Hybrid vigor, inbreeding depression, cottonseed traits, cottonseed oil, Gossypium hirsutum. ... in yield and superior performance than well-adapted.
Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.
2001-01-01
The effects of feeding Spodoptera a littoralis (Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor ((Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar
Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.
2001-01-01
The effects of feeding Spodoptera littoralis(Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor (Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar
Reproduction and pathogenicity of endemic populations of Rotylenchulus reniformis on cotton
The reniform nematode (Rotylenchulus reniformis) is the predominant parasitic nematode of upland cotton (Gossypium hirsutum) in the southern United States. Little is known about variability in geographic isolates of reniform nematode. In order to evaluate the comparative reproduction and pathogenici...
Regulation of auxin on secondary cell wall cellulose biosynthesis in developing cotton fibers
Cotton (Gossypium hirsutum L.) fibers are unicellular trichomes that differentiate from epidermal cells of developing cotton ovules. Mature fibers exhibit thickened secondary walls composed of nearly pure cellulose. Cotton fiber development is divided into four overlapping phases, 1) initiation sta...
African Journal of Biotechnology - Vol 2, No 5 (2003)
African Journals Online (AJOL)
Bioinformatic tools and guideline for PCR primer design · EMAIL FREE FULL TEXT ... shoot regeneration and localization of transgene expression in greenhouse ... in cotton Gossypium Spp. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Responses of reniform nematode and browntop millet to tillage, cover crop, and herbicides in cotton
Cropping practices that reduce competition from reniform nematode (Rotylenchulus reniformis) and browntop millet (Urochlora ramosum) may help minimize losses in cotton (Gossypium hirsutum). The impacts of tillage, rye cover crop, and preemergence and postemergence herbicides on cotton yields, renifo...
African Journal of Biotechnology - Vol 10, No 3 (2011)
African Journals Online (AJOL)
Isolation and identification of differentially expressed genes between Gossypium ... The effects of nitrogen deficiencies on the lipid and protein contents of Spirulina ... Nutritional evaluation of cookies produced from pigeon pea, cocoyam and ...
Directory of Open Access Journals (Sweden)
Tingting Lu
2017-08-01
Full Text Available Calcineurin B-like (CBL proteins, as calcium sensors, play pivotal roles in plant responses to diverse abiotic stresses and in growth and development through interaction with CBL-interacting protein kinases (CIPKs. However, knowledge about functions and evolution of CBLs in Gossypium plants is scarce. Here, we conducted a genome-wide survey and identified 13, 13 and 22 CBL genes in the progenitor diploid Gossypium arboreum and Gossypium raimondii, and the cultivated allotetraploid Gossypium hirsutum, respectively. Analysis of physical properties, chromosomal locations, conserved domains and phylogeny indicated rather conserved nature of CBLs among the three Gossypium species. Moreover, these CBLs have closer genetic evolutionary relationship with the CBLs from cocoa than with those from other plants. Most CBL genes underwent evolution under purifying selection in the three Gossypium plants. Additionally, nearly all G. hirsutum CBL (GhCBL genes were expressed in the root, stem, leaf, flower and fiber. Many GhCBLs were preferentially expressed in the flower while several GhCBLs were mainly expressed in roots. Expression patterns of GhCBL genes in response to potassium deficiency were also studied. The expression of most GhCBLs were moderately induced in roots after treatments with low-potassium stress. Yeast two-hybrid experiments indicated that GhCBL1-2, GhCBL1-3, GhCBL4-4, GhCBL8, GhCBL9 and GhCBL10-3 interacted with GhCIPK23, respectively. Our results provided a comprehensive view of the CBLs and valuable information for researchers to further investigate the roles and functional mechanisms of the CBLs in Gossypium.
Directory of Open Access Journals (Sweden)
L. S. P. Cruz
1978-01-01
Full Text Available Em ensaio de campo conduzido em 1975/76 procurou-se avaliar a ação de misturas de MSMA com diuron e de paraquat com diuron, aplicadas em pós-emergência, em jato dirigido, em duas épocas diferentes, no controle de algumas plantas daninhas de folhas largas em algodão: carrapicho- do-campo (Acanthospermum australe (Loef O. Kuntze , falsa-poaia (Borreria ala ta (Aubl DC, poaia-branca (Richardia brasiliensis Gomez e guanxuma (Sida spp . A vegetação natural da área do ensaio era formada ainda pela gramínea capim-de-colchão (Digitaria sanguinalis (L. Scop . Os resultados mostraram que as misturas de 2,00 kg e 2,70 kg/ha de MSMA com, respectivamente 0,30 kg e 0,40 kg/ha de diuron, e a mistura de 0.60 kg/ha de paraquat com 0,60 kg/ ha de diuron, foram eficientes no co ntro le daquelas dicotiledôneas, e também no da gramínea. Todos os tratamentos provocaram leves sintomas de fitotoxicidade nos algodoeiros, mas desapareceram depois e não prejudicaram o desenvolvimento vegetativo das plantas, assim como a produção de algodão em caroço.In a field trial carried out in 1975/76, a diuron mixtu re with MSMA and another with paraquat was tested on broadleaved weeds in cotton crops. The applications were done in postemergence, directed-spray, in two different periods. The broadleaved weeds observed in the trial were Acanthospermum australe , Borreria alata, Richardia brasiliensis, and Sida spp, also the grass Digitaria sanguinalis. Best results were obtained with the mixture of 0,60 kg/ha of paraquat with 0,60 kg/ha of diuron, and 2,70 kg/ha of MSMA with 0,40 kg/ ha of diuron, or 2,00 kg/ha of MSMA with 0,30 kg/ha of diuron. All the treatments caused sl ight symptons of toxic ity in cotton, which disappeared later and did not damage the production.
Directory of Open Access Journals (Sweden)
Gómez Zambrano Jairo
1996-12-01
Full Text Available
The work perfomed to characterize the elemental composition and functional groups of humic acids extracted from four lombricompost cow dung, filter press cake of sugar cane, coffee pulp and grass residue the total content of essential elements and its distribution in the humic and no humic fractions were determined. It was evalued the effect of two concentrations of humic acids (150 and 300 ppm upon seed germination of maize, cotton and tomat. There were found differences in the elemental composition (CHON and functional groups (COOH, OH phedic and carbony of the humic acids atributed to variations in composition of the original substrates. The lombricompost of cow dung showed higher oxidation values (O/H = 0.49 than the lombricompost of filter press cake of sugar cane (0.40 sugering a higher grade of humification of the first. The grass residue showed higher contribution to the CIC (COOH + OH = 9. O me/g than the coffe pulp (7. 1 me/g the total essential elements were concentrated in the remanent residue, with lower content in the water and 0.1M HCL solutions; the fulvic and humic fractions had very low content of these elements. The humic acid at the concentrations tested did not have any effect on the germination of maize and cotton, and depressed the germination of tomato seeds.
El trabajo se realizó con el fin de caracterizar por su composición elemental y contenido de grupos funcionales, los acidos húmicos extraídos de cuatro lombricompuestos (bovinaza, cachaza, pulpa de café y residuo de prado. Se determinó el contenido y distribución de los elementos esenciales totales en las fracciones húmicas y no de acidos húmicas. Se evaluó el efecto de dos concentraciones de acidos húmicos (150 y 300 ppm sobre la germinación de semillas de maíz, algodón y tomate. Se encontraron diferencias en el contenido elemental (CHON y grupos funcionales (COOH, OH fenólico y carbonilo atribuido a variaciones en la composición de los materiales de origen. La bovinaza (O/H = 0.49 mostró mayor oxidación que la cachaza (0.40 sugiriendo mayor grado de humificación de la primera. El residuo de prado mostró la mayor contribución a la CIC (COOH + OH = 9. O m.e/g y la pulpa de café la menor (7.1 m.e/g. Los elementos esenciales totales se distribuyeron con preferencia en el residuo remanente y en las fracciones solubles en agua y HCL 0.1M, con muy bajos contenidos en los fulvatos yacidos húmicos. No se encontró respuesta a la acción de los acidos húmicos sobre la germinación de semillas de maíz y algodón y se produjo efectos depresivos en los de tomate.
Loison , Romain
2015-01-01
Cotton lint is the first natural fiber used in the world. Cotton provides income to more than 10 million persons in West and Central Africa. In Cameroon, it is produced under rainfed conditions and water shortage is the major abiotic factor limiting yield and lint quality. In this context, a breeding program was initiated in 1950 by IRCT (Institut de Recherches du Coton et des Textiles Exotiques) to increase lint yield, fiber quality and disease resistance. After 60 years, this program has re...
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Damgaard, Christian; Strandberg, Morten Tune
2004-01-01
"DMU finder at det nye materiale om den molekulære karakterisering af 281-24-236x3006-210-23 bomulden, ikke giver anledning til at ændre den tidligere riskovurdering. Vedr. spørgsmål 1 er det i svaret fra anmelderen blevet tilfredsstillende redegjort for hvilket materiale der blev anvendt. Vedr s...
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Strandberg, Morten Tune; Damgaard, Christian
2004-01-01
"Mail: Vi har gennemgået det tilsendte supplerende materiale (Brev fra Skov- og Naturstyrelsen 02-03-2005) vedr. den genmodificerede insektresistente bomuld C/NL/04/01, der ansøges anvendt til import og videreforarbejdning, men ikke til dyrkning. Vi har ikke fundet nogen nye oplysninger der medfø...
Directory of Open Access Journals (Sweden)
N.E. de M. Beltrão
1983-06-01
Full Text Available Com a finalidade de verificar o comportamento do algodoeiro herbáceo, cultivar IAC-17, bem como o controle de plantas daninhas e aspectos competitivos do complexo floristico infestante sobre a cultura, na presença dos herbicidas diuron e sethoxydim, foi realizado um ensaio no município de Viçosa, Minas Gerais. O solo do local experimental, Podzólico Vermelho-Amarelo, apresenta textura argilosa, com 1,38% de carbono orgânico e de baixa fertilidade natural. O diuron foi aplicado em pré-emergência nas doses de 0,0; 0,8; 1,6 e 2,4 kg/ha e o sethoxydim, em pós-emergência, nas doses de 0, 150, 300, 450 e 600 g/ha. O ensaio foi instalado em blocos ao acaso, com 21 tratamentos em esquema fatorial (4 x 5 + 1, sendo 20 deles envolvendo o controle químico, resultantes de todas as combinações das doses desses herbicidas e uma testemunha relativa onde o controle foi realizado com o uso da enxada. Avaliaram-se várias características do crescimento e desen vol vimento da cul tura, tai s como área fol iar, índice de área folia r, ren dimento de algodão em rama, altura da plant a, diâmetro do caule etc.; e, por meio de mét odos sin ecológico s, a densidade populac ional e peso da fitomassa hidratada epí gea das esp éci es daninhas dominant es, e o total de todas as espécies. O diuron exerceu um elevado contro le de lat ifo liadas, como botão-de -ouro (Galin soga parvif lora Cav. e picão-preto (Biden spilosa L., nas doses de 1,6 e 2,4 kg/ ha. O sethoxydim mesmo na menor dose testada (150 g/h a controlou totalmente o capim-marmelada (Brachiaria planta ginea (Link. Hitch . Nenhum dos herbicidas controlou a falsa -serralha (Emilia sonc hi folia DC., porém referida planta daninha não reduziu o crescimento da cultura, mostrando- se de baixa força de competição. As plantas daninhas que apresentaram maiores forças de competição foram o botão-de-ouro, por apresentar maior densidade populacional, e o capim-marmelada, por ser de maior agressividade.To verify the behavior of the c. IAC -17, as well as, the control of weeds and competitive aspects of the infesting floristic complexes over the cotton culture under the presence of the herbicides, diuron and sethoxydium, atrial was contucted in Viçosa, Minas Gerais. The soil at the experimental site, Podzolic Red-yellow, had a clay texture wi th 1,38% of organic carbon an low natural fertility. Diuron was applied at pre -emergence time at the rates of 0, 0; 0, 8; 1,6 and 2,4 kg a.i. /ha and sethoxyd im at post-emergence at the rates of 0, 150, 300, 450 and 600 g a.i./ha. The trial was setup in a randomized blocks design with 2 1 treament sunder a factorial scheme (x 5 + 1 . Out of them, 20 composed all the combinations with different dosis of the two herbicides under study plus a relative control weeded with the aind of a mattock. Several traits concerning growth and plant development were evaluated, such as leaf area, leaf area in dex, seed -cotton yield, plant height, stem diameter. By means of syn ecological methods, th e population density, hydrated epigeous phytomase of dominant weed species, and the total of all species were evaluated. Diuron exerted a high control overlati foliates such as Galinsoga parviflora Cav . and Bidens pilosa L., at the rates of 1, 6 an d 2,4 kg a. i. /ha, seth oxydim, even using the lowvest tested rate (150 g. a. i. /h a fully controled Brachiaria plantaginea (Link. Hitch. None of th e herbicides was able to control Emilia sonchifolia DC. Th is species although being considered an important weed did not affect the normal crop development because of its low competition ability. The weeds showing highes trates of competition were G. parviflora (due to high population density an d B. plantaginea, because of its greater aggresivity.
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Strandberg, Morten Tune; Christensen, Christian Dam
2006-01-01
tolerante over for insektangreb fra larver af forskellige sommerfuglearter. Desuden indeholder bomulden et gen, der gør den tolerant overfor glufosinat-ammonium herbicider. Bomulden søges kun godkendt til import af frø samt forarbejdning og anvendelse til dyrefoder og fødevarer, men ikke til dyrkning eller...
Chloroplast DNA Structural Variation, Phylogeny, and Age of Divergence among Diploid Cotton Species
Li, Pengbo; Liu, Fang; Wang, Yumei; Xu, Qin; Shang, Mingzhao; Zhou, Zhongli; Cai, Xiaoyan; Wang, Xingxing; Wendel, Jonathan F.; Wang, Kunbo
2016-01-01
The cotton genus (Gossypium spp.) contains 8 monophyletic diploid genome groups (A, B, C, D, E, F, G, K) and a single allotetraploid clade (AD). To gain insight into the phylogeny of Gossypium and molecular evolution of the chloroplast genome in this group, we performed a comparative analysis of 19 Gossypium chloroplast genomes, six reported here for the first time. Nucleotide distance in non-coding regions was about three times that of coding regions. As expected, distances were smaller within than among genome groups. Phylogenetic topologies based on nucleotide and indel data support for the resolution of the 8 genome groups into 6 clades. Phylogenetic analysis of indel distribution among the 19 genomes demonstrates contrasting evolutionary dynamics in different clades, with a parallel genome downsizing in two genome groups and a biased accumulation of insertions in the clade containing the cultivated cottons leading to large (for Gossypium) chloroplast genomes. Divergence time estimates derived from the cpDNA sequence suggest that the major diploid clades had diverged approximately 10 to 11 million years ago. The complete nucleotide sequences of 6 cpDNA genomes are provided, offering a resource for cytonuclear studies in Gossypium. PMID:27309527
High levels of resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. We had previously determined that MIC-3 expression played a direct role in suppressing RKN egg...
Molecular cloning, structural analysis and expression of a zinc ...
African Journals Online (AJOL)
The results of prokaryotic expression of ZnBP and overexpression of the ZnBP gene in A. thaliana improve our understanding of the function of this gene. Future studies should investigate the molecular mechanisms involved in gland morphogenesis in cotton. Key words: Gossypium hirsutum, pigment gland, zinc binding ...
Detecting cotton boll rot with an electronic nose
South Carolina Boll Rot is an emerging disease of cotton, Gossypium hirsutum L., caused by the opportunistic bacteria, Pantoea agglomerans (Ewing and Fife). Unlike typical fungal diseases, bolls infected with P. agglomerans continue to appear normal externally, complicating early and rapid detectio...
Evaluating cotton seed gland initiation by microscopy
Gossypol is a terpenoid aldehyde found in cotton (Gossypium hirsutum L.) glands and helps protect the seed from pests and pathogens. However, gossypol is toxic to many animals, so the seed is used mainly in cattle feed, as ruminants are tolerant to the effects of gossypol. In order to develop strat...
Crop response to biochar under differing irrigation levels in the southeastern USA
Application of biochar to soils is hypothesized to increase crop yield. Crop productivity impacts of biochar application in Southeastern cropping systems consisting of peanut (Arachis hypogaea L.), corn (Zea mays L.), and cotton (Gossypium hirsutum L.) produced under varying rates of irrigation have...
The green stink bug, Chinavia hilaris (Say) (Hemiptera: Pentatomidae), is an economic pest of cotton, Gossypium hirsutum L. Numerous known non-crop hosts of C. hilaris that exist in field edges bordering cotton are sources of this stink bug in this crop. Sesbania punicea plants in a field border su...
Yield response and economics of shallow subsurface drip irrigation systems
Field tests were conducted using shallow subsurface drip irrigation (S3DI) on cotton (Gossypium hirsutum, L.), corn (Zea mays, L.), and peanut (Arachis hypogeae, L.) in rotation to investigate yield potential and economic sustainability of this irrigation system technique over a six year period. Dri...
Crop yield response to increasing biochar rates
The benefit or detriment to crop yield from biochar application varies with biochar type/rate, soil, crop, or climate. The objective of this research was to identify yield response of cotton (Gossypium hirsutum L.), corn (Zea mayes L.), and peanut (Arachis hypogaea L.) to hardwood biochar applied at...
Rainwater deficit and irrigation demand for row crops in Mississippi Blackland Prairie
Gary Feng; Ying Ouyang; Ardeshir Adeli; John Read; Johnie Jenkins
2018-01-01
Irrigation research in the mid-south United States has not kept pace with a steady increase in irrigated area in recent years. This study used rainfall records from 1895 to 2016 to determine rainwater deficit and irrigation demand for soybean [Glycine max (L.) Merr.], corn (Zea mays L.), and cotton (Gossypium hirsutum L.) in the Blackland Prairie region of Mississippi...
Cui, J.J.; Luo, J.Y.; Werf, van der W.; Ma, Y.; Xia, J.Y.
2011-01-01
Transgenic cotton (Gossypium hirsutum L.) varieties, adapted to China, have been bred that express two genes for resistance to insects. the Cry1Ac gene from Bacillus thuringiensis (Berliner) (Bt), and a trypsin inhibitor gene from cowpea (CpTI). Effectiveness of the double gene modification in
African Journal of Biotechnology - Vol 10, No 38 (2011)
African Journals Online (AJOL)
Lowering virus attack with improved yield and fiber quality in different cotton genotypes by early sown cotton (Gossypium hirsutum L.) EMAIL FREE FULL TEXT ... typhimurium in rainbow trout stored under aerobic, modified atmosphere and vacuum packed conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Insecticide use and practices among cotton farmers in northern ...
African Journals Online (AJOL)
Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...
Review: Genetic diversity and population structure of cotton ...
African Journals Online (AJOL)
Cotton (Gossypium spp.) is the world's leading natural fiber crop and is cultivated in diverse temperate and tropical areas. In this sense, molecular markers are important tools for polymorphism identification in genetic diversity analyses. The objective of this study was to evaluate genetic diversity and population structure in ...
Evaluation of elastic modulus and hardness of crop stalks cell walls by nano-indentation
Yan Wu; Siqun Wang; Dingguo Zhou; Cheng Xing; Yang Zhang; Zhiyong Cai
2010-01-01
Agricultural biomaterials such as crop stalks are natural sources of cellulosic fiber and have great potential as reinforced materials in bio-composites. In order to evaluate their potential as materials for reinforcement, the nano-mechanical properties of crop-stalk cell walls, i.e. those of cotton (Gossypium herbaceu) stalk, soybean (Glycine max) stalk, cassava (...
Construction of microsatellite-based linkage map and mapping of ...
Indian Academy of Sciences (India)
Gossypium tomentosum, a wild tetraploid cotton species with AD genomes, possesses genes conferring strong fibers and high heat tolerance. ... State Key Laboratory of Crop Genetics and Germplasm Enhancement, Cotton Research Institute, Nanjing Agricultural University, Nanjing 210095, People's Republic of China ...
Intragenomic diversity and geographical adaptability of diploid ...
African Journals Online (AJOL)
Cotton is one of the most important crops in Iran, and is cultivated in different regions of the country. Gossypium herbaceum is one of the A-genome cottons, which is a potentially important genetic resource for cotton breeding programs. Collecting native cultivars of this species growing in different regions is a vital step in ...
Mapping of genes for flower-related traits and QTLs for flowering ...
Indian Academy of Sciences (India)
Mapping of genes for flower-related traits and QTLs for flowering time in an interspecific population of Gossypium hirsutum × G. darwinii. Shuwen Zhang, Qianqian Lan, Xiang Gao, Biao Yang, Caiping Cai, Tianzhen Zhang and Baoliang Zhou. J. Genet. 95, 197–201. Table 1. Loci composition and recombination distances of ...
Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae)
The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...
Airborne multispectral detection of regrowth cotton fields
Regrowth of cotton, Gossypium hirsutum L., can provide boll weevils, Anthonomus grandis Boheman, with an extended opportunity to feed and reproduce beyond the production season. Effective methods for timely areawide detection of these potential host plants are critically needed to achieve eradicati...
The boll weevil, Anthonomus grandis grandis Boheman, is an important pest of cotton (Gossypium spp.) in South America, Mexico, and southernmost Texas in the United States. A key factor in the persistence of the boll weevil is its ability to survive the non-cotton season. Mechanisms facilitating this...
The boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), has been the most important pest of cotton (Gossypium spp.) wherever it occurs. Although eradication programs in the U.S. have reduced the range of this pest, the weevil remains an intractable problem in subtropical Tex...
Forensic pollen geolocation techniques used to identify the origin of boll weevil reinfestation
The boll weevil, Anthonomus grandis, entered the United States of America in the early 20th century and became a major pest in cotton, Gossypium spp. Shortly after the passage of Tropical Storm Erin on 16 August 2007 through the South Texas/Winter Garden boll weevil eradication zone, over 150 boll ...
Status of the boll weevil, Anthonomus grandis grandis Boheman, as a pest of cotton (Gossypium spp.) in the United States has diminished because of progress by eradication programs. However, this pest remains of critical importance in South America, and intractable populations in extreme South Texas ...
The southern green stink bug, Nezara viridula (L.) (Hemiptera: Pentatomidae), is a cosmopolitan pest of high-value cash crops, including cotton (Gossypium hirsutum L.; Malvales: Malvaceae). The pest can ingest and transmit disease-causing bacterial and fungal pathogens of cotton. We hypothesized t...
Recent studies have suggested that cottonseed (Gossypium spp.) has the potential to contribute to the effort against world hunger, particularly by providing a high-quality protein source. This report analyzed the diversity in protein content and other seed quality factors in the U.S. National Cotton...
Dicty_cDB: Contig-U04058-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 09 |pid:none) Gossypium thurberi ubiquitin-conju... 130 2e-29 CP000585_249( CP000585 |pid:none) Ostreococcus...83533.... 130 2e-29 (Q9SLE4) RecName: Full=Ubiquitin carrier protein E2 29; ... 130 2e-29 AY082009_1( AY0820
Application of mixed models for the assessment genotype and ...
African Journals Online (AJOL)
Application of mixed models for the assessment genotype and environment interactions in cotton ( Gossypium hirsutum ) cultivars in Mozambique. ... The cultivars ISA 205, STAM 42 and REMU 40 showed superior productivity when they were selected by the Harmonic Mean of Genotypic Values (HMGV) criterion in relation ...
Alleles conferring improved fiber quality from EMS mutagenesis of elite cotton genotypes
The elite gene pool of cotton (Gossypium spp.) has less diversity than those of most other major crops, making identification of novel alleles important to ongoing crop improvement. A total of 3,164 M5 lines resulting from ethyl methanesulfonate mutagenesis of two G. hirsutum breeding lines, TAM 94L...
The declining saturated thickness of the Ogallala Aquifer combined with the unpredictability of precipitation during the growing season in the Southern High Plains has resulted in elevated production risks associated with short-term crop water deficits. Cotton (Gossypium spp.) cultivars that can use...
Dicty_cDB: Contig-U04458-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available um L. Gossypium hi... 36 7.6 2 ( FG288839 ) 1108793284722 New World Screwworm Egg 9261 ESTs C... 28 7.7 4 ( ... 32 8.5 3 ( FG283787 ) 1108770637102 New World Screwworm Egg 9261 ESTs C... 28 8.
A Tobacco rattle virus (TRV) based virus-induced gene silencing (VIGS) assay was employed as a reverse genetic approach to study gene function in cotton (Gossypium hirsutum). This approach was used to investigate the function of Enoyl-CoA reductase (GhECR) in pathogen defense. Amino acid sequence al...
Methylation sensitive amplified polymorphism (MSAP) reveals that ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... Key words: Salt stress, alkali stress, Gossypium hirsutum L., DNA methylation, methylation sensitive amplified polymorphism (MSAP). INTRODUCTION. DNA methylation is one of the key epigenetic mecha- nisms among eukaryotes that can modulate gene expression without the changes of DNA sequence.
A comparison of soda and soda-AQ pulps from cotton stalks | Akgül ...
African Journals Online (AJOL)
In this study, cotton stalks (Gossypium hirsutum L.) were cooked using soda and soda-anthraquinone (AQ) process. Nine soda cooks were conducted by changing cooking conditions including active alkali charge and pulping time. Soda-AQ cooks were obtained by adding 0.075, 0.10, 0.15, 0.2% AQ (based on o.d stalks) to ...
Profitability of cover crops for single and twin row cotton
With the increased interest in cover crops, the impact of adoption on profitability of cash crops is a common question from producers. The objective of this study was to evaluate the profitability of cover crops for single and twin row cotton (Gossypium hirsutum L.) in Alabama. This experiment inclu...
Borssum Waalkes, van J.
1966-01-01
The Malvaceae have always enjoyed a vivid interest from botanists, in particular on account of the fact that many species have showy flowers and are appreciated as ornamentals throughout the world. In addition many species are of outstanding economical value, e.g. in the genera Gossypium and
Case Study: Transgenic Crop Controversy in Costa Rica
Hague, Steve S.
2009-01-01
Costa Rica has rich ecological resources and has been a steady political force in turbulent Central America. Most recently, it has become a battleground between pro- and anti-genetically modified organism (GMO) political forces. This case study examines the roles of U.S.-based cotton ("Gossypium hirsutum" L.) seed companies, anti-GMO…
Relationship between NDVI at early bloom and yield in germplasm evaluation trials
The use of high-throughput phenotyping (HTP) equipment is expanding as it offers the potential to increase the efficiency of making selections in cotton (Gossypium hirsutum L.) improvement programs. Measurements often being collected on HTP field equipment include normalized difference vegetative in...
Effect of nitrates on embryo induction efficiency in cotton ...
African Journals Online (AJOL)
Cotton (Gossypium hirsutum L.) cv Coker-312 callus culture was assessed in terms of its usefulness as a system for investigating the effect of nitrates from different chemical compounds of nitrogen on embryo induction percentage in calli as the plant growth and cell differentiation mainly based on nitrogen. Both sources and ...
Potentials for Use of Medicinal Plants in Female Reproductive ...
African Journals Online (AJOL)
USER
canadensis L.), and Chaste tree fruits (Vitex agnus- castus L.) are listed in the U. S. Pharmacopoeia and are available as dietary supplements to be used for premenstrual stress syndrome, as emmenagogue agents, and for gynaecological problems. Castor oil (Ricinus communis L.)18 and cotton bark root (Gossypium.
Linkage disequilibrium and association mapping of drought ...
African Journals Online (AJOL)
Drought stress is a major abiotic stress that limits crop production. Molecular association mapping techniques through linkage disequilibrium (LD) can be effectively used to tag genomic regions involved in drought stress tolerance. With the association mapping approach, 90 genotypes of cotton Gossypium hirsutum, from ...
Effect of different light quality on DNA methylation variation for brown ...
African Journals Online (AJOL)
DNA methylation plays an important role in regulating gene expression during plant development. We studied the effects of different light quality on DNA methylation patterns of brown cotton (Gossypium hirstum) by using the methylation sensitive amplified polymorphism (MSAP). We selected 66 pairs of MSAP selective ...
Cotton (Gossypium hirsutum L.) producers in Alabama and across the Cotton Belt are faced with a rapidly expanding problem that decreases yields and increases production costs: herbicide-resistant weeds. Producers are increasingly relying on production methods that raise production costs, such as add...
The P450 CYP82D109 gene codes for an early step enzyme in the gossypol pathway in Gossypium. The terminal leaves of RNAi plants had a 90% reduction in hemigossypolone and heliocides levels, and a 70% reduction in gossypol levels compared to wild-type (WT) plants. Previous studies comparing glanded...
Locally severe outbreaks of Fusarium wilt of cotton (Gossypium spp.) in South Georgia raised concerns about the genotypes of the causal pathogen, Fusarium oxysporum f. sp. vasinfectum. Vegetative complementation tests and DNA sequence analysis were used to determine genetic diversity among 492 F. ox...
Effects of 1,1-Dimethylpiperidinium Chloride on the Pests and Allelochemicals of Cotton and Pecan.
P. A. Hedin; J. N. Jenkins; J. C. McCarty; J. E. Mulrooney; W. L. Parrott; A. Borazjani; C. H. Graves; T. H. Filer
1984-01-01
The growth regulator, PIX (mepiquat chloride - 1,1-dimethyl-piperdinium chloride), when applied to cotton (Gossypium hirsutum L.) and pecan (Carya illinoensis Koch), caused internode shortening. PIX did not elicit an increase in resistance in cotton to the tobacco budworm (Heliothis virescens (Fab.)], or in pecan...
Amplified fragment length polymorphism (AFLP) and genealogy ...
African Journals Online (AJOL)
STORAGESEVER
2010-06-07
Jun 7, 2010 ... Pang CY, Du XM, Ma ZY (2006). Evaluation of the introgressed lines and screening for elite germplasm in Gossypium, Chin. Sci. Bull. 51(1):. 304-312. Pieter V, Rene H, Marjo B (1995). AFLP: a new technique for DNA fingerprinting. Nucleic Acids Res. 23(21): 4407-4414. Qian SY, Huang JQ, Zhou BL, Peng ...
• Actin polymerizes to form the cytoskeleton and organize polar growth in all eukaryotic cells. Species with numerous actin genes are especially useful for the dissection of actin molecular function due to redundancy and neofunctionalization. Here, we investigated the role of a cotton (Gossypium hi...
Genetic diversity in reproductive abiotic stress tolerance has been reported for cotton [Gossypium hirsutum (L.)] based upon the percentage of anther dehiscence of mature pollen in adverse environments. This study investigated the abiotic stress tolerance of mature pollen and identified genetic vari...
Area-wide management approach for tarnished plant bug in the Mississippi Delta
The tarnished plant bug, Lygus lineolaris (Palisot de Beauvois), is the major insect pest of cotton, Gossypium hirsutum (L.), within the Mid-South region. From 2001 to 2012, the tarnished plant bug has been the number one insect pest of cotton in Louisiana and Mississippi in eleven and nine of those...
African Journal of Biotechnology - Vol 12, No 33 (2013)
African Journals Online (AJOL)
An evaluation of some mutant cotton (Gossypium hirsutum L.) varieties from Azerbaijan in Southeast Anatolian region of Turkey · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EFE Lale, Fatih Killi, Sefer Mustafayev. http://dx.doi.org/10.5897/AJB11.1785 ...
Genetic diversity, population structure and marker trait associations ...
Indian Academy of Sciences (India)
Supplementary data: Genetic diversity, population structure and marker trait associations for seed quality traits in cotton (Gossypium hirsutum). Ashok Badigannavar and Gerald O. Myers. J. Genet. 94, 87–94. Table 1. List of cotton germplasm lines used in this study. Germplasm no. Cultivar. Region. Germplasm no. Cultivar.
Long-term effects of conservation systems on productivity for the old rotation
Winter legumes in cotton (Gossypium hirsutum L.) production is not new to the Southeast. In 1896, the Old Rotation experiment at Auburn University was established to study the feasibility of producing cotton in crop rotations with winter legumes managed as a green manure crop. Throughout the experim...
Xia, J.
1997-01-01
Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on
Determination of environmental influence on seed traits is critical for genetic improvement of seed quality in Upland cotton (Gossypium hirsutum L.). The objective of this study was to analyze the relative contribution of environment and genotype (G) for seed oil, nitrogen (N), and gossypol content...
Use of furrow irrigation in row crop production is a common practice through much of the Midsouth US and yet, nutrients can be transported off-site through surface runoff. A field study with cotton (Gossypium hirsutum, L.) was conducted to understand the impact of furrow tillage practices and nitrog...
Evaluation of various substrates and supplements for biological ...
African Journals Online (AJOL)
An experiment was conducted to determine the effects of different substrates namely wheat straw (Triticum aestivum), maize stover (Zea mays L), thatch grass (Hyparrhenia filipendula) and oil/protein rich supplements (maize bran, cottonseed hull [Gossypium hirsutum]) on biological efficiency of two oyster mushroom ...
Arabidopsis CDS blastp result: AK108458 [KOME
Lifescience Database Archive (English)
Full Text Available AK108458 002-143-D05 At4g35000.1 L-ascorbate peroxidase 3 (APX3) identical to ascorbat...e peroxidase 3 [Arabidopsis thaliana] GI:2444019, L-ascorbate peroxidase [Arabidopsis thaliana] gi|152379...1|emb|CAA66926; similar to ascorbate peroxidase [Gossypium hirsutum] gi|1019946|gb|AAB52954 2e-35 ...
Arabidopsis CDS blastp result: AK070842 [KOME
Lifescience Database Archive (English)
Full Text Available AK070842 J023074O14 At4g35000.1 L-ascorbate peroxidase 3 (APX3) identical to ascorbat...e peroxidase 3 [Arabidopsis thaliana] GI:2444019, L-ascorbate peroxidase [Arabidopsis thaliana] gi|1523791...|emb|CAA66926; similar to ascorbate peroxidase [Gossypium hirsutum] gi|1019946|gb|AAB52954 1e-112 ...
The induction of lycopene in germinating cottonseed with 2-(4-Methylphenoxy)Triethylamine (MPTA)
Cottonseed (Gossypium hirsutum Acala cultivar) were imbibed in H2O for 6 hr and seed coats removed. The seeds were imbibed for an additional 3 hr in H2O or 7.2x10**-4M 2-(4-methylphenoxy) triethylamine (MPTA) and germinated in the dark for 72 hr. The carotenoids were extracted and analyzed by HPLC...
Treatment of dark germinating cottonseed (Gossypium hirsutum Acala cultivar) with 0.72 mM 2(4-methylphenoxy) triethylamine (MPTA) resulted in a 18-fold increase in carotenoid biosynthesis. In comparison to H2O treated control seed germinating in the dark that formed 8.4 ug/g fr wt of lutein and 1.6 ...
Cotton Leaf Curl virus Disease (CLCuD) has caused enormous losses in cotton (Gossypium hirsutum) production in Pakistan. RNA interference (RNAi) is an emerging technique that could knock out CLCuD by targeting different regions of the pathogen genome that are important for replication, transcription...
The plasma membrane intrinsic proteins (PIP) are one of the five aquaporin protein subfamilies. Aquaporin proteins are known to facilitate water transport through biological membranes. In order to identify NIP aquaporin gene candidates in cotton (Gossypium hirsutum L.), in silico and molecular clon...
Lifescience Database Archive (English)
Full Text Available 7|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 74 3e-13 sp|O24339|CATA_SOLAP Catalase OS=Soldan...RLNVRPSI 492 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 73.2 bits (1
Lifescience Database Archive (English)
Full Text Available 04 sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 376 e-104 sp|O24339|CATA_SOLAP Catala...ALKPNPKSHIQENWRILDFFSHHP 180 Query: 619 ESMHMFSW 642 ES+HMF++ Sbjct: 181 ESLHMFTF 188 >sp|O24339|CATA_SOLAP
Lifescience Database Archive (English)
Full Text Available GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 432 e-121 sp|O24339|CATA_SOLAP Catalase OS=Soldanella al...t: 181 ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH 225 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina
Lifescience Database Archive (English)
Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le
Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...
African Journals Online (AJOL)
Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.
Irrigation water availability is decreasing due to declining water sources and greater competition. Many producers must now comply with annual pumping restrictions that may limit overall productivity of crops like corn (Zea mays L.). Cotton [Gossypium hirsutum (L.)] water demand is less than corn, b...
Identification of resistance to Aspergillus flavus infection in cotton germplasm
Natural resistance of in cottonseed to Aspergillus flavus infection has not been explored to date. A green fluorescent protein (GFP) expressing -70 strain was used to assess the resistance of seed from thirty five35 cotton varieties including representatives from Gossypium arboreum, G. barbadense, a...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 2e-27 ...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 5e-27 ...
Arabidopsis CDS blastp result: AK242585 [KOME
Lifescience Database Archive (English)
Full Text Available AK242585 J090010M20 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 1e-123 ...
Arabidopsis CDS blastp result: AK242890 [KOME
Lifescience Database Archive (English)
Full Text Available AK242890 J090079L19 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-48 ...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-25 ...
IDENTIFICATION AND CHARACTERIZATION OF NEW miRNAs IN ...
African Journals Online (AJOL)
Pathmanaban
2012-09-20
Sep 20, 2012 ... simplest and rapid method of identification of miRNAs is relied on in silico analysis. ... (NRs), are available for several plant species and can be used for ... Currently, there are 89 miRNAs deposited under. Gossypium at Plant ...
Feast and famine in plant genomes.
Jonathan F. Wendel; Richard C. Cronn; J. Spencer Jonhston; H. James. Price
2002-01-01
Plant genomes vary over several orders of magnitude in size, even among closely related species, yet the origin, genesis and significance of this variation are not clear. Because DNA content varies over a sevenfold range among diploid species in the cotton genus (Gossypium) and its allies, this group offers opportunities for exploring patterns and mechanisms of genome...
6,6'-Dimethoxygossypol: molecular structure, crystal polymorphism, and solvate formation
6,6´-Dimethoxygossypol (DMG) is a naturally produced derivative of gossypol that is found in relatively high concentration in some Gossypium barbadense cotton varieties. Like gossypol, DMG forms an equimolar solvate with acetic acid, but it was not clear if, like gossypol, the compound would form c...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Logo of the Indian Academy of Sciences .... Association of AFLP and SSR markers with agronomic and fibre quality traits in Gossypium hirsutum L. ... cDNA cloning and expression analysis of two distinct Sox8 genes in Paramisgurnus ... Allelic variations in Glu-1 and Glu-3 loci of historical and modern Iranian bread wheat ...
Sugar alcohols-induced oxidative metabolism in cotton callus culture
African Journals Online (AJOL)
Sugar alcohols (mannitol and sorbitol) may cause oxidative damage in plants if used in higher concentration. Our present experiment was undertaken to study physiological and metabolic responses in cotton (Gossypium hirsutum L.) callus against mannitol and sorbitol higher doses. Both markedly declined mean values of ...
Dicty_cDB: Contig-U09533-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5
Association of AFLP and SSR markers with agronomic and fibre ...
Indian Academy of Sciences (India)
We have attempted to tag yield and fibre quality traits with AFLP and SSR markers using F2 and F3 populations of a cross between two Gossypium hirsutum varieties, PS56-4 and RS2013. Out of 50 AFLP primer combinations and 177 SSR primer pairs tested, 32 AFLP and four SSR primers were chosen for genotyping F2 ...
Earthworm populations are affected from Long-Term Crop Sequences and Bio-Covers under No-Tillage
Earthworms are crucial for improving soil biophysical properties in cropping systems. Consequently, effects of cropping rotation and bio-covers were assessed on earthworm populations under no-tillage sites. Main effects of 6 different cropping sequences [corn (Zea mays), cotton (Gossypium hirsutum),...
Directory of Open Access Journals (Sweden)
Aruna Jyothi Kora
2018-03-01
Full Text Available Silver nanoparticles synthesized from gum kondagogu (5 nm were used to evaluate the antibacterial activity against Gram-positive and Gram-negative bacteria. To decipher the mode of antibacterial action of nanoparticles, a comprehensive study was carried out employing a variety of susceptibility assays: micro-broth dilution, antibiofilm activity, growth kinetics, cytoplasmic content leakage, membrane permeabilization, etc. The production of reactive oxygen species (ROS and cell surface damage during bacterial nanoparticle interaction were also demonstrated using dichlorodihydrofluorescein diacetate, N-acetylcysteine; and scanning electron microscopy and energy dispersive X-ray spectra. Further, the biocompatibility with HeLa cell line was also evaluated. Compared to earlier reports, the minimum inhibitory concentration values were lower by 3.2- and 16-folds for Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli strains, respectively. The minimum bactericidal concentration values were lower by 4 and 50-folds. Thus, the biogenic silver nanoparticles were found to be more potent bactericidal agents in terms of concentration. The nanoparticles exhibited significant antibiofilm activity against test strains at 2 μg mL−1, which can have implications in the treatment of drug resistant bacterial infections caused by biofilms. Growth curve in nanoparticle supplemented indicated a faster inhibition in Gram-negative bacteria as compared to Gram-positive. Treatment with nanoparticles caused cytoplasmic content leakage and membrane permeabilization in a dose dependent manner, an evidence for membrane damage. The observations noted in our study substantiated the association of ROS and membrane damage in the antibacterial action of silver nanoparticles. The promising antibacterial activity enables these nanoparticles as potential bactericidal material for various environmental and biomedical applications.
Directory of Open Access Journals (Sweden)
DANIEL LEÓN-CAMARGO
2015-06-01
Full Text Available Se caracterizó la interacción colibrí-planta en tres remanentes de bosque tropical seco (BsT, ubicados en el municipio de Chimichagua (Cesar, Colombia con base en la observación de las visitas a los recursos florales y en los análisis de las cargas de polen en el pico y en otras partes del cuerpo de las aves. Se registró la época de floración y la abundancia de flores producidas por las plantas utilizadas por los colibríes y se midió la cantidad y calidad del néctar. En cinco muestreos que cubrieron la variabilidad de la precipitación en la zona de estudio, se capturaron a 17 individuos. Se realizaron 218 observaciones (visitas de dos especies de colibríes Lepidopyga goudoti y Phaethornis anthophilus, los cuales visitaron a 31 especies de plantas. Para el caso de las observaciones sobre visitas de los colibríes a las plantas, Arrabidaea cf. corallina fue la más importante (IVIR=0.14840 en los tres remanentes de vegetación estudiados, seguida por Aphelandra pulcherrima (IVIR=0.05356 y Pogonopus speciosus (IVIR=0.02773. Otra especie importante pero con valores bajos fue Cochlospermum vitifolium. De acuerdo con los análisis de cargas de polen, el recurso más importante fue Pogonopus speciosus con un valor de IVIR=0.29643, seguido por Aphelandra pulcherrima (IVIR=0.09286 y Hemistylus cf. odontophylla (IVIR=0.03294. En el análisis general para los tres sitios (Tabla 3, los recursos más importantes para los colibríes fueron Pogonopus speciosus (IVIR=0.06207, Aphelandra pulcherrima (IVIR=0.06021 y Cochlospermum vitifolium (IVIR=0.01095. Lepidopyga goudoti utiliza 22 especies de plantas, mientras que P. anthophilus solamente utiliza siete. Las flores visitadas fueron en su mayoría tubulares con colores brillantes y contrastantes como el rojo, el morado y el violeta y se encontró buen ajuste entre su tamaño y la longitud y la forma del pico de los colibríes. También se presentaron visitas a flores de color blanco y amarillo como
Directory of Open Access Journals (Sweden)
Barsett Hilde
2005-09-01
Full Text Available Abstract An ethnopharmacological survey was carried out to collect information on the use of seven medicinal plants in rural areas in the nearby regions of Bamako, Mali. The plants were Opilia celtidifolia, Anthocleista djalonensis, Erythrina senegalensis, Heliotropium indicum, Trichilia emetica, Piliostigma thonningii and Cochlospermum tinctorium About 50 medical indications were reported for the use of these plants in traditional medicine. The most frequent ailments reported were malaria, abdominal pain and dermatitis. The highest number of usages was reported for the treatment of malaria (22%. The majority of the remedies were prepared from freshly collected plant material from the wild and from a single species only. They were mainly taken orally, but some applications were prepared with a mixture of plants or ingredients such as honey, sugar, salt, ginger and pepper. Decoction of the leaves was the main form of preparation (65% and leaf powder was mostly used for the preparation of infusions (13%. The part of the plants most frequently used was the leaves. There was a high degree of informant consensus for the species and their medicinal indications between the healers interviewed. The results of this study showed that people are still dependent on medicinal plants in these rural areas of Mali.
Togola, Adiaratou; Diallo, Drissa; Dembélé, Seydou; Barsett, Hilde; Paulsen, Berit Smestad
2005-09-27
An ethnopharmacological survey was carried out to collect information on the use of seven medicinal plants in rural areas in the nearby regions of Bamako, Mali. The plants were Opilia celtidifolia, Anthocleista djalonensis, Erythrina senegalensis, Heliotropium indicum, Trichilia emetica, Piliostigma thonningii and Cochlospermum tinctorium. About 50 medical indications were reported for the use of these plants in traditional medicine. The most frequent ailments reported were malaria, abdominal pain and dermatitis. The highest number of usages was reported for the treatment of malaria (22%). The majority of the remedies were prepared from freshly collected plant material from the wild and from a single species only. They were mainly taken orally, but some applications were prepared with a mixture of plants or ingredients such as honey, sugar, salt, ginger and pepper. Decoction of the leaves was the main form of preparation (65%) and leaf powder was mostly used for the preparation of infusions (13%). The part of the plants most frequently used was the leaves. There was a high degree of informant consensus for the species and their medicinal indications between the healers interviewed. The results of this study showed that people are still dependent on medicinal plants in these rural areas of Mali.
Directory of Open Access Journals (Sweden)
Reynaldo Linares-Palomino
2013-05-01
Full Text Available Se realizó un estudio de los patrones de distribución espacial de cuatro especies de árboles características de los bosques secos del Parque Nacional Cerros de Amotape en el noroeste peruano, inventariando seis parcelas de una hectárea cada una. Para ello se utilizó la versión modificada de la estadística K de Ripley. Eriotheca ruizii (K. Schum. A. Robyns (Bombacaceae, Bursera graveolens (Kunth Triana & Planch. (Burseraceae, Caesalpinia glabrata Kunth (Leguminosae y Cochlospermum vitifolium (Willd. Spreng. (Cochlospermaceae presentan patrones que no son significantemente diferentes de un patrón completamente al azar en 11 de los 17 casos analizados. Al nivel de la escala espacial analizada, esto está en desacuerdo con el postulado general para bosques tropicales de que las especies vegetales tienden a encontrarse agrupadas. Estos resultados se analizan y discuten a la luz de los diversos factores que influyen en producirlos.
Weed flora, yield losses and weed control in cotton crop
Jabran, Khawar
2016-01-01
Cotton (Gossypium spp.) is the most important fiber crop of world and provides fiber, oil, and animals meals. Weeds interfere with the growth activities of cotton plants and compete with it for resources. All kinds of weeds (grasses, sedges, and broadleaves) have been noted to infest cotton crop. Weeds can cause more than 30% decrease in cotton productivity. Several methods are available for weed control in cotton. Cultural control carries significance for weed control up to a certain extent....
Liu, Hongwei; Yin, Shuli; An, Likang; Zhang, Genwei; Cheng, Huicai; Xi, Yanhua; Cui, Guanhui; Zhang, Feiyan; Zhang, Liping
2016-07-20
Bacillus subtilis BSD-2, isolated from cotton (Gossypium spp.), had strong antagonistic activity to Verticillium dahlia Kleb and Botrytis cinerea. We sequenced and annotated the BSD-2 complete genome to help us the better use of this strain, which has surfactin, bacilysin, bacillibactin, subtilosin A, Tas A and a potential class IV lanthipeptide biosynthetic pathways. Copyright © 2016 Elsevier B.V. All rights reserved.
Santos, Karen B dos; Meneguim, Ana M; Santos, Walter J dos; Neves, Pedro M O J; Santos, Rachel B dos
2010-01-01
The cotton plant, Gossypium hirsutum, hosts various pests that damage different structures. Among these pests, Spodoptera cosmioides (Walker) and Spodoptera eridania (Cramer) (Lepidoptera: Noctuidae) are considered important. The objectives of this study were to characterize and to quantify the potential damage of S. eridania and S. cosmioides feeding on different structures of cotton plants. For this purpose, newly-hatched larvae were reared on the following plant parts: leaf and flower bud;...
African Journals Online (AJOL)
Département de Biologie et Physiologie Végétales, Faculté des Sciences, Université de Yaoundé Yaoundé I, B.P.. 812 Yaoundé — Cameroun. RÉSUMÉ. Les travaux de recherche sont réalisés au Cameroun de Juillet 2001 à Septembre 2003 sur les plantules d'une glycophyte tolérante ; Gossypium hirsutum (Malvaceae).
Using Winter Annual Cover Crops in a Virginia No-till Cotton Production System
Daniel, James B. II
1997-01-01
Cotton (Gossypium hirsutum L.) is a low residue crop, that may not provide sufficient surface residue to reduce erosion and protect the soil. A winter annual cover crop could alleviate erosion between cotton crops. Field experiments were conducted to evaluate selected winter annual cover crops for biomass production, ground cover, and N assimilation. The cover crop treatments were monitored under no-till and conventional tillage systems for the effects on soil moisture, cotton yield and qu...
Zhao, Ge; Song, Yun; Wang, Caixiang; Butt, Hamama Islam; Wang, Qianhua; Zhang, Chaojun; Yang, Zuoren; Liu, Zhao; Chen, Eryong; Zhang, Xueyan; Li, Fuguang
2016-12-01
Jasmonates control many aspects of plant biological processes. They are important for regulating plant responses to various biotic and abiotic stresses, including drought, which is one of the most serious threats to sustainable agricultural production. However, little is known regarding how jasmonate ZIM-domain (JAZ) proteins mediate jasmonic acid signals to improve stress tolerance in cotton. This represents the first comprehensive comparative study of TIFY transcription factors in both diploid A, D and tetraploid AD cotton species. In this study, we identified 21 TIFY family members in the genome of Gossypium arboretum, 28 members from Gossypium raimondii and 50 TIFY genes in Gossypium hirsutum. The phylogenetic analyses indicated the TIFY gene family could be divided into the following four subfamilies: TIFY, PPD, ZML, and JAZ subfamilies. The cotton TIFY genes have expanded through tandem duplications and segmental duplications compared with other plant species. Gene expression profile revealed temporal and tissue specificities for TIFY genes under simulated drought conditions in Gossypium arboretum. The JAZ subfamily members were the most highly expressed genes, suggesting that they have a vital role in responses to drought stress. Over-expression of GaJAZ5 gene decreased water loss, stomatal openings, and the accumulation of H 2 O 2 in Arabidopsis thaliana. Additionally, the results of drought tolerance assays suggested that this subfamily might be involved in increasing drought tolerance. Our study provides new data regarding the genome-wide analysis of TIFY gene families and their important roles in drought tolerance in cotton species. These data may form the basis of future studies regarding the relationship between drought and jasmonic acid.
Effect of ionization radiation (γ-rays 60Co) on germination of cotton
International Nuclear Information System (INIS)
Lall, S.B.; Bhute, M.G.
1974-01-01
Effect of ionization radiation (γ-rays 60 Co) on germination of cotton varieties viz. AK 235 and 197/3, also B 147 and B 296-7 belonging to Gossypium arboreum and Gossypium hirsutum respectively under field and laboratory conditions were studied. Materials under study were tried in two radiation doses i.e. 10,000 r and 20,000 r in two (R1 and R2) generations. In laboratory and field condition, both doses (10,000r and 20,000r) depressed the germination percentage in R1 generation of radiation to greater degree in almost all the varieties of cotton. Maximum depression was noted under field condition in both the varieties belonging to Gossypium arboreum species in R1 generation under 20,000 r. In R2 generation, depressing effect on germination capacity of seed is reduced to much extent in field condition in almost of all the varieties. The germination percentage has increased over control in R2 generation in both doses in laboratory conditions in all the varieties used in this experiment. (author)
Choat, Brendan; Ball, Marilyn C; Luly, Jon G; Donnelly, Christine F; Holtum, Joseph A M
2006-05-01
Diurnal and seasonal patterns of leaf gas exchange and water relations were examined in tree species of contrasting leaf phenology growing in a seasonally dry tropical rain forest in north-eastern Australia. Two drought-deciduous species, Brachychiton australis (Schott and Endl.) A. Terracc. and Cochlospermum gillivraei Benth., and two evergreen species, Alphitonia excelsa (Fenzal) Benth. and Austromyrtus bidwillii (Benth.) Burret. were studied. The deciduous species had higher specific leaf areas and maximum photosynthetic rates per leaf dry mass in the wet season than the evergreens. During the transition from wet season to dry season, total canopy area was reduced by 70-90% in the deciduous species and stomatal conductance (g(s)) and assimilation rate (A) were markedly lower in the remaining leaves. Deciduous species maintained daytime leaf water potentials (Psi(L)) at close to or above wet season values by a combination of stomatal regulation and reduction in leaf area. Thus, the timing of leaf drop in deciduous species was not associated with large negative values of daytime Psi(L) (greater than -1.6 MPa) or predawn Psi(L) (greater than -1.0 MPa). The deciduous species appeared sensitive to small perturbations in soil and leaf water status that signalled the onset of drought. The evergreen species were less sensitive to the onset of drought and g(s) values were not significantly lower during the transitional period. In the dry season, the evergreen species maintained their canopies despite increasing water-stress; however, unlike Eucalyptus species from northern Australian savannas, A and g(s) were significantly lower than wet season values.
Azokou, Alain; Koné, Mamidou W; Koudou, Benjamin G; Tra Bi, Honora F
2013-01-01
Mosquitoes increased resistance to insecticides, and environmental concerns about the use of insecticides, pose a major challenge in the search for new molecules to deplete and incapacitate mosquito populations. Plants are the valuable source as practices consisting in exploiting plant materials as repellents, and are still in wide use throughout developing countries. The aim of the present study was to screen plants from Cτte d'Ivoire for larvicidal activity against mosquitoes. Resistant and sensitive larvae (III and IV instar) of Anopheles gambiae and Culex quinquefasciatus were exposed to crude ethanol extracts (90%) of 45 plants and viability observed after 30 min, 6, 12 and 24 h postincubation. After partition of active extracts, each fraction (hexane and chloroform washed with NaCl 1%, tannins and aqueous) was tested using the same protocol at various concentrations (1000- 31.2 ppm). Of 49 extracts tested, 7 exhibited high potential (LC50 = 80 to 370 ppm) against resistant and sensitive III and IV instar larvae of An. gambiae and Cx. quinquefasciatus. These extracts were from Cissus populnea, Cochlospermum planchonii, Heliotropium indicum, Phyllanthus amarus, Vitex grandifolia and Alchornea cordifolia. However, three most active plant species (LC50 = 80- 180 ppm) were Cs. populnea, Cm. planchonii and P. amarus Their hexane and chloroform fractions showed high larvicidal activity. This study demonstrated that plants from Cτte d'Ivoire have a real potential for malaria, yellow fever, filarial and dengue vector control. Those could be used as sources or provide lead compounds for the development of safe plant-based biocides.
Hildebrandt, Patrick; Cueva, Jorge; Espinosa, Carlos Iván; Stimm, Bernd; Günter, Sven
2017-01-01
Seasonally dry forests in the neotropics are heavily threatened by a combination of human disturbances and climate change; however, the severity of these threats is seldom contrasted. This study aims to quantify and compare the effects of deforestation and climate change on the natural spatial ranges of 17 characteristic tree species of southern Ecuador dry deciduous forests, which are heavily fragmented and support high levels of endemism as part of the Tumbesian ecoregion. We used 660 plant records to generate species distribution models and land-cover data to project species ranges for two time frames: a simulated deforestation scenario from 2008 to 2014 with native forest to anthropogenic land-use conversion, and an extreme climate change scenario (CCSM4.0, RCP 8.5) for 2050, which assumed zero change from human activities. To assess both potential threats, we compared the estimated annual rates of species loss (i.e., range shifts) affecting each species. Deforestation loss for all species averaged approximately 71 km2/year, while potential climate-attributed loss was almost 21 km2/year. Moreover, annual area loss rates due to deforestation were significantly higher than those attributed to climate-change (P < 0.01). However, projections into the future scenario show evidence of diverging displacement patterns, indicating the potential formation of novel ecosystems, which is consistent with other species assemblage predictions as result of climate change. Furthermore, we provide recommendations for management and conservation, prioritizing the most threatened species such as Albizia multiflora, Ceiba trichistandra, and Cochlospermum vitifolium. PMID:29267357
Manchego, Carlos E; Hildebrandt, Patrick; Cueva, Jorge; Espinosa, Carlos Iván; Stimm, Bernd; Günter, Sven
2017-01-01
Seasonally dry forests in the neotropics are heavily threatened by a combination of human disturbances and climate change; however, the severity of these threats is seldom contrasted. This study aims to quantify and compare the effects of deforestation and climate change on the natural spatial ranges of 17 characteristic tree species of southern Ecuador dry deciduous forests, which are heavily fragmented and support high levels of endemism as part of the Tumbesian ecoregion. We used 660 plant records to generate species distribution models and land-cover data to project species ranges for two time frames: a simulated deforestation scenario from 2008 to 2014 with native forest to anthropogenic land-use conversion, and an extreme climate change scenario (CCSM4.0, RCP 8.5) for 2050, which assumed zero change from human activities. To assess both potential threats, we compared the estimated annual rates of species loss (i.e., range shifts) affecting each species. Deforestation loss for all species averaged approximately 71 km2/year, while potential climate-attributed loss was almost 21 km2/year. Moreover, annual area loss rates due to deforestation were significantly higher than those attributed to climate-change (P < 0.01). However, projections into the future scenario show evidence of diverging displacement patterns, indicating the potential formation of novel ecosystems, which is consistent with other species assemblage predictions as result of climate change. Furthermore, we provide recommendations for management and conservation, prioritizing the most threatened species such as Albizia multiflora, Ceiba trichistandra, and Cochlospermum vitifolium.
Tracheal relaxation of five medicinal plants used in Mexico for the treatment of several diseases.
Sánchez-Recillas, Amanda; Mantecón-Reyes, Paul; Castillo-España, Patricia; Villalobos-Molina, Rafael; Ibarra-Barajas, Maximiliano; Estrada-Soto, Samuel
2014-03-01
To assess the relaxant effect of several organic extracts obtained from Agastache mexicana (A. mexicana), Cochlospermum vitifolium (C. vitifolium), Cordia morelosana (C. morelosana), Lepechinia caulescens (L. caulescens) and Talauma mexicana (T. mexicana) used in Mexican traditional medicine for the treatment of several diseases. Extracts were obtained by maceration at room temperature using hexane, dichloromethane and methanol for each plant material. The organic extracts were evaluated ex vivo to determine their relaxant activity on the contractions induced by carbachol (cholinergic receptor agonist, 1 μ mol/L) in isolated rat tracheal rings. A total of 15 extracts were evaluated (three for each species). All test samples showed significant relaxant effect, in a concentration-dependent manner, on the contractions induced by 1 μ mol/L carbachol, with exception of extracts from C. morelosana. Active extracts were less potent than theophylline [phosphodiesterase inhibitor, EC50: (28.79±0.82) μg/mL] that was used as positive control. Concentration-response curves revealed that the extracts with more significant effects were dichloromethanic extracts of T. mexicana [Emax: (103.03±3.32)% and EC50: (159.39±3.72) μg/mL) and C. vitifolium [Emax: (106.58±2.42)% and EC50: (219.54±7.61) μg/mL]. Finally, hexanic and dichloromethanic extracts from A. mexicana were fully effective but less potent than T. mexicana and C. vitifolium. Less polar extracts obtained from A. mexicana, T. mexicana and C. vitifolium exhibited greater relaxant effect on tracheal rat rings, which allows us to suggest them as sources for the isolation of bioactive molecules with potential therapeutic value in the treatment of asthma. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Xiaoyan Wang
Full Text Available Extensive studies on floral transition in model species have revealed a network of regulatory interactions between proteins that transduce and integrate developmental and environmental signals to promote or inhibit the transition to flowering. Previous studies indicated FLOWERING PROMOTING FACTOR 1 (FPF1 gene was involved in the promotion of flowering, but the molecular mechanism was still unclear. Here, FPF1 homologous sequences were screened from diploid Gossypium raimondii L. (D-genome, n = 13 and Gossypium arboreum L. genome (A-genome, n = 13 databases. Orthologous genes from the two species were compared, suggesting that distinctions at nucleic acid and amino acid levels were not equivalent because of codon degeneracy. Six FPF1 homologous genes were identified from the cultivated allotetraploid Gossypium hirsutum L. (AD-genome, n = 26. Analysis of relative transcripts of the six genes in different tissues revealed that this gene family displayed strong tissue-specific expression. GhFPF1, encoding a 12.0-kDa protein (Accession No: KC832319 exerted more transcripts in floral apices of short-season cotton, hinting that it could be involved in floral regulation. Significantly activated APETALA 1 and suppressed FLOWERING LOCUS C expression were induced by over-expression of GhFPF1 in the Arabidopsis Columbia-0 ecotype. In addition, transgenic Arabidopsis displayed a constitutive shade-avoiding phenotype that is characterized by long hypocotyls and petioles, reduced chlorophyll content, and early flowering. We propose that GhFPF1 may be involved in flowering time control and shade-avoidance responses.
Directory of Open Access Journals (Sweden)
Rachel Benetti Queiroz-Voltan
1995-01-01
Full Text Available Estudaram-se as alterações anatômicas em plantas de algodoeiro com sintomas de murchamento avermelhado em dezembro de 1993-fevereiro de 94. Analisaram-se amostras de raiz, caule e folha de Gossypium hirsutum L. 'IAC 20' provenientes de áreas de ocorrência do sintoma. Estimou-se o número de glândulas secretoras das folhas dos cultivares IAC 20 e CNPA ITA 90 (que se tem mostrado resistente. Observou-se que as células parenquimáticas apresentavam, no interior, substâncias insolúveis em água, cuja concentração aumentava à medida do grau do sintoma. As folhas apresentaram uma concentração maior dessas substâncias em relação ao restante do corpo vegetal. Os núcleos das células do parênquima paliçádico encontravam-se aumentados e os cloroplastos do mesofilo, parcialmente destruídos. As plantas com alto grau de sintoma apresentavam também um número maior de glândulas secretoras nas folhas.Anatomical alterations in cotton plants (Gossypium hirsutum L. with reddish withering symptons observated between December/93 to February/94 were studied. Samples of root, stem and leaf of Gossypium hirsutum L. 'IAC 20' collected in several sites with symptoms occurrence were analised. The number of secretory glands in the leaves of cultivar IAC 20, and for the resistent cultivar CNPA ITA 90 was estimated. The parenchyma cells included insoluble substances, and these concentrations increased with the crescent symptoms. The leaves presented higher concentration of these substances than the remaining plant body. The nucleus of palisade parenchyma cells was increased and the chloroplasts partially destroyed. The leave secretory glands number increases proportionally to the advance of the symptoms.
DEFF Research Database (Denmark)
Zhang, Xiao-ming; Yang, Nian-wan; Wan, Fang-hao
2014-01-01
theophrasti Medicus), sunflower (Helianthus annuus L.), sweet potato (Ipomoea batatas L.), soybean (Glycine max L.), and maize (Zea mays L.). The whitefly species identity was repeatedly tested and confirmed; seasonal dynamics on the various host plants was standardized by the quartile method. B. tabaci MED......The density seasonal dynamics of Bemisia tabaci MED were evaluated over two-years in a cotton-growing area in Langfang, Hebei Province, northern China on cotton (Gossypium hirsutum L.) and six other, co-occurring common plants: common ragweed (Ambrosia artemisiifolia L.), piemarker (Abutilon...
2012-01-01
Background Cotton is the world’s most important natural textile fiber and a significant oilseed crop. Decoding cotton genomes will provide the ultimate reference and resource for research and utilization of the species. Integration of high-density genetic maps with genomic sequence information will largely accelerate the process of whole-genome assembly in cotton. Results In this paper, we update a high-density interspecific genetic linkage map of allotetraploid cultivated cotton. An additional 1,167 marker loci have been added to our previously published map of 2,247 loci. Three new marker types, InDel (insertion-deletion) and SNP (single nucleotide polymorphism) developed from gene information, and REMAP (retrotransposon-microsatellite amplified polymorphism), were used to increase map density. The updated map consists of 3,414 loci in 26 linkage groups covering 3,667.62 cM with an average inter-locus distance of 1.08 cM. Furthermore, genome-wide sequence analysis was finished using 3,324 informative sequence-based markers and publicly-available Gossypium DNA sequence information. A total of 413,113 EST and 195 BAC sequences were physically anchored and clustered by 3,324 sequence-based markers. Of these, 14,243 ESTs and 188 BACs from different species of Gossypium were clustered and specifically anchored to the high-density genetic map. A total of 2,748 candidate unigenes from 2,111 ESTs clusters and 63 BACs were mined for functional annotation and classification. The 337 ESTs/genes related to fiber quality traits were integrated with 132 previously reported cotton fiber quality quantitative trait loci, which demonstrated the important roles in fiber quality of these genes. Higher-level sequence conservation between different cotton species and between the A- and D-subgenomes in tetraploid cotton was found, indicating a common evolutionary origin for orthologous and paralogous loci in Gossypium. Conclusion This study will serve as a valuable genomic resource
Turner, K E; Belesky, D P; Cassida, K A; Zerby, H N
2014-10-01
The experiment evaluated traditional U.S. sheep (Suffolk), hair sheep (Katahdin), and meat goat (Boer crossbred; Goat) carcass and meat quality parameters when finished on pasture with and without supplemental whole cottonseed (Gossypium hirsutum L.). Supplemented animals had greater ribeye area (PGoat. Goat LM had less (Pgoats would be acceptable for most ethnic markets in the USA. Omega6:Omega3 ratios in chevon and lamb were within the guidelines for meats that can improve human diets and health. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Cristina Schetino Bastos
2007-09-01
Full Text Available
O objetivo deste trabalho foi o de avaliar a adaptabilidade e a estabilidade de cultivares de algodão (Gossypium hirsutum L., utilizando a metodologia proposta por Eberhart & Russell (1966. Para tanto, onze variedades de algodão foram avaliadas em sete locais do Estado do Mato Grosso, Brasil, em dois anos agrícolas (2002/2003 e 2003/2004. O delineamento experimental empregado foi o de blocos casualizados com quatro repetições e as características avaliadas foram a produtividade de algodão em caroço e a porcentagem de fibra. Com relação à produção de algodão em caroço, as cultivares BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá e Delta Opal demonstraram ampla adaptabilidade e estabilidade para as regiões produtoras do Estado. Entretanto, considerando a porcentagem de fibra, não foram encontradas cultivares de algodão com ampla adaptabilidade e estabilidade nos ambientes estudados.
PALAVRAS-CHAVE: Gossypium hirsutum; fibra; estabilidade.
The objective of this work was to evaluate the stability and adaptability of cotton (Gossypium hirsutum L. cultivars using the method of Eberhart & Russell (1966. Eleven varieties of cotton were tested at seven locations in Mato Grosso State, Brazil, in two growing seasons (2002/2003 and 2003/2004. The experimental design was the randomized complete blocks with four replications and the evaluated traits were lint percentage and seed cotton yield. For seed cotton yield, BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá and Delta Opal showed broad adaptability and stability in Mato Grosso State. However, for lint percentage there were not found cotton cultivars with both broad adaptability and stability for the studied environments.
Physiological response of wheat, maize and cotton to gamma irradiation
International Nuclear Information System (INIS)
Sharabash, M.T.M.; Gaweesh, S.S.M.; Orabi, I.O.A.; Hammad, A.H.A.
1988-01-01
Grains of wheat triticum aestivum vulgare cv. Giza 155, maize Zea mays cv. double hybrid strain 17 S and cotton seeds Gossypium barbadence cv. Giza 67 were irradiated with successive doses of gamma rays from 0 to 64 Krad. Irradiating wheat grains with 1 Krad, maize grains with 0.5 Krad and cotton seeds with 4 Krad stimulated their germination and enhanced the growth of seedlings and their chlorophyll content. Also, these doses activated Alpha- and Beta-Amylase in the seeds. Higher doses had suppression effects. Peroxidase value in the seedlings of the three species was accelerated progressively in concomitant with the increase in the dosage
Gutiérrez M, Margaret; Trujillo, Baltazar; Pérez, Delis; Márques, Alexis; Pacheco, William
2009-01-01
Con el objetivo de rescatar la variabilidad genética del género Gossypium en Venezuela, se realizaron dos expediciones de colecta en los estados Falcón (formaciones climásicas y sucesionales de espinares) y Aragua (zona costera). Fueron colectados 23 ejemplares nativos de crecimiento subespontáneo; para la clasificación botánica se utilizaron los descriptores color de planta y hoja, número de lóbulos, forma de las hojas, color de los pétalos, presencia de "Petal Spot" (mancha púrpura en la ba...
Plant remains of archaeological site Casa Vieja, Callango (Ica
Directory of Open Access Journals (Sweden)
José Roque
2013-06-01
Full Text Available A paleoethnobotanical study was carried out at the Middle Horizon archaeological site of Casa Vieja, located in Callango within the Lower Ica Valley. A total of 23 species were identified, all determined to be of the Magnoliopyta Division, 78 % (or 18 species were Magnoliopsid and 22% (or 15 species Liliopsid. The Fabaceae are the best represented family with 6 species. Most of the analyzed samples correspond to seeds of Gossypium barbadense “cotton”. Seventy percent of the species were probably used as food; 48% for artifact-making and construction and 52% for medicinal and curative purposes.
Dicty_cDB: Contig-U01957-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Synthetic construct DNA, clone: pF... 41 0.074 AB241241_1( AB241241 |pid:none) Symbiotic...me: Full=Rac-like GTP-binding protein 3; AltName: ... 38 0.82 AB241244_1( AB241244 |pid:none) Symbiotic prot... DQ667981 |pid:none) Gossypium hirsutum small GTPase (R... 40 0.13 AB241245_1( AB241245 |pid:none) Symbiot...ic protist of Reticuliterme... 40 0.17 BX538352_67( BX538352 |pid:none) Cryptospori
Huang, Yu; Wei, Xiaoyang; Zhou, Shiguang; Liu, Mingyong; Tu, Yuanyuan; Li, Ao; Chen, Peng; Wang, Yanting; Zhang, Xuewen; Tai, Hongzhong; Peng, Liangcai; Xia, Tao
2015-04-01
In this study, steam explosion pretreatment was performed in cotton stalks, leading to 5-6 folds enhancements on biomass enzymatic saccharification distinctive in Gossypium barbadense and Gossypium hirsutum species. Sequential 1% H2SO4 pretreatment could further increase biomass digestibility of the steam-exploded stalks, and also cause the highest sugar-ethanol conversion rates probably by releasing less inhibitor to yeast fermentation. By comparison, extremely high concentration alkali (16% NaOH) pretreatment with raw stalks resulted in the highest hexoses yields, but it had the lowest sugar-ethanol conversion rates. Characterization of wall polymer features indicated that biomass saccharification was enhanced with steam explosion by largely reducing cellulose DP and extracting hemicelluloses. It also showed that cellulose crystallinity and arabinose substitution degree of xylans were the major factors on biomass digestibility in cotton stalks. Hence, this study has provided the insights into cell wall modification and biomass process technology in cotton stalks and beyond. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Jawdat, D.; Karajoli, I.
2007-05-01
Seeds from six varieties of Gossypium hirusutum and from one variety of Gossypium barbadense were cultured in plastic containers (20 x 60 x 30 cm) with compost (Terfgroup, Netherlands). Germination readings were taken 14 days after culture, where plants with first true leaf was chosen for readings. The highest percentages of germinations were 83.3 (C6040) and 80 % (Rakka 5). Seeds of Rakka 5 were subjected to gamma radiation (60 C o) with radiation activity of 4 kci using the Gamma cell (Isolvated, made in Russia) at the Radiation Technology department at the AECS. The following doses were used in a rate of 1.8548 KGry/h: 100,150, 200, 250, 300, 350,400 and 500 Gry. On the other hand, seeds of C6040 were subjected to 100,150,200, 250 and 300 Gry. The results indicated the effects of gamma radiation doses on germination rate, plant height, distance between cotyledons leaves and first true leaf and flowering time.(author)
Plantas medicinais referenciadas por raizeiros no município de Jataí, estado de Goiás
Directory of Open Access Journals (Sweden)
L.F. SOUZA
Full Text Available RESUMO Este trabalho objetivou pesquisar as plantas medicinais referenciadas por raizeiros do município de Jataí-GO, evidenciando o Valor de Uso Reportado (VUR e a conexão com os níveis filogenéticos atuais. Com cerca de 200 anos de história, Jataí localiza-se no Planalto Central do Brasil, Sudoeste de Goiás (17°52’53’’S e 51°42’52’’W, tendo atualmente, como principal fonte de renda o agronegócio. Para a seleção dos raizeiros e coleta dos dados aplicou-se o método bola de neve e a técnica de entrevistas semiestruturadas. Determinou-se a etnoespécie, parte usada, uso, modo de preparo, sintomas / doenças relacionando aos sistemas corporais. Foram reportadas 515 referências etnobotânicas para 112 etnoespécies principalmente dos clados Fabídeas, Lamídeas, e Campanulídeas. Sobressaíram as etnoespécies Pé-de-perdiz (Croton antisyphilliticus, Sangra-dágua (C. urucurana, Pau-terra-de-folha-larga (Qualea grandiflora, Erva-de-Santa Maria (Chenopodium album, Amaro-leite (Operculina alata, Algodãozinho-do-campo (Cochlospermum regium, Cavalinha (Equisetum hiemale e Jaborandi (Piper aduncum, com VUR maior que 10. Os sistemas corporais mais importantes com relação ao número de etnoespécies relatadas foram respiratório, digestivo, circulatório e tegumentar. As etnoespécies mais versáteis em uso nos sistemas corporais foram Copaíba (Copaifera langsdorffii, Pé-de-perdiz (Croton antisyphiliticus, Cavalinha (Equisetum hiemale, Alecrim (Rosmarinus officinalis e Fruta-de-lobo (Solanum paniculatum. A prática da medicina tradicional em Jataí evidencia a conexão entre a escolha de plantas e os níveis filogenéticos derivados. Algumas destas etnoespécies estão na listagem de plantas medicinais que o Ministério da Saúde do Brasil escolheu para a realização de monografias, fato que fortalece o valor do conhecimento do uso da flora nas práticas da medicina tradicional.
Lu, Pu; Magwanga, Richard Odongo; Lu, Hejun; Kirungu, Joy Nyangasi; Wei, Yangyang; Dong, Qi; Wang, Xingxing; Cai, Xiaoyan; Zhou, Zhongli; Wang, Kunbo; Liu, Fang
2018-04-12
Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs) are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 ( TOM1 ), a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum , 9 in Gossypium arboreum , and 11 in Gossypium raimondii . The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY) values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM) was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H₂O₂. The low malondialdehyde (MDA) level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM) can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress-tolerant cotton
Directory of Open Access Journals (Sweden)
Pu Lu
2018-04-01
Full Text Available Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 (TOM1, a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum, 9 in Gossypium arboreum, and 11 in Gossypium raimondii. The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H2O2. The low malondialdehyde (MDA level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress
Nature Relation Between Climatic Variables and Cotton Production
Directory of Open Access Journals (Sweden)
Zakaria M. Sawan
2014-08-01
Full Text Available This study investigated the effect of climatic variables on flower and boll production and retention in cotton (Gossypium barbadense. Also, this study investigated the relationship between climatic factors and production of flowers and bolls obtained during the development periods of the flowering and boll stage, and to determine the most representative period corresponding to the overall crop pattern. Evaporation, sunshine duration, relative humidity, surface soil temperature at 1800 h, and maximum air temperature, are the important climatic factors that significantly affect flower and boll production. The least important variables were found to be surface soil temperature at 0600 h and minimum temperature. There was a negative correlation between flower and boll production and either evaporation or sunshine duration, while that correlation with minimum relative humidity was positive. Higher minimum relative humidity, short period of sunshine duration, and low temperatures enhanced flower and boll formation.
Remote sensing techniques for monitoring the Rio Grande Valley cotton stalk destruction program
Energy Technology Data Exchange (ETDEWEB)
Richardson, A.J.; Gerbermann, A.H.; Summy, K.R.; Anderson, G.L. (Department of Agriculture, Weslaco, TX (United States))
1993-09-01
Post harvest cotton (Gossypium hirsutum L.) stalk destruction is a cultural practice used in the Rio Grande Valley to suppress over wintering populations of boll weevils (Anthonomus grandis Boheman) without using chemicals. Consistent application of this practice could substantially reduce insecticide usage, thereby minimizing environmental hazards and increasing cotton production profits. Satellite imagery registered within a geographic information system was used to monitor the cotton stalk destruction program in the Rio Grande Valley. We found that cotton stalk screening procedures based on standard multispectral classification techniques could not reliably distinguish cotton from sorghum. Greenness screening for cotton plant stalks after the stalk destruction deadline was possible only where ground observations locating cotton fields were available. These findings indicate that a successful cotton stalk destruction monitoring program will require satellite images and earth referenced data bases showing cotton field locations.
Han, Lide; Yang, Jian; Zhu, Jun
2007-06-01
A genetic model was proposed for simultaneously analyzing genetic effects of nuclear, cytoplasm, and nuclear-cytoplasmic interaction (NCI) as well as their genotype by environment (GE) interaction for quantitative traits of diploid plants. In the model, the NCI effects were further partitioned into additive and dominance nuclear-cytoplasmic interaction components. Mixed linear model approaches were used for statistical analysis. On the basis of diallel cross designs, Monte Carlo simulations showed that the genetic model was robust for estimating variance components under several situations without specific effects. Random genetic effects were predicted by an adjusted unbiased prediction (AUP) method. Data on four quantitative traits (boll number, lint percentage, fiber length, and micronaire) in Upland cotton (Gossypium hirsutum L.) were analyzed as a worked example to show the effectiveness of the model.
Host plants of leaf worm, Spodoptera litura (Fabricius (Lepidoptera: noctuidae in Pakistan
Directory of Open Access Journals (Sweden)
Munir Ahmad
2013-04-01
Full Text Available Spodoptera litura is a notorious leaf feeding insect pest of more than one hundred plants around the Asia-Pacific region. Host plant survey for two years from three different locations in cotton belt revealed 27 plant species as host plants of S. litura belonging to 25 genera of 14 families including cultivated crops, vegetables, weeds, fruits and ornamental plants. Major host plants on which it thrived for maximum period were Gossypium hirsutum L., Ricinus communis L., Brassica oleracea var. botrytis L., Colocasia esculenta L., Trianthema portulacastrum L. and Sesbania sesban L.. Eggs were also collected from tree plants but larvae did not complete their development. Reliance of S. litura on major plant species of cultivated crops necessitates their regular monitoring especially during March to April for their population abundance and early warning for their management on commercial crops like cotton.
Singh, Bir; Cheek, Hannah D; Haigler, Candace H
2009-07-01
Use of a synthetic auxin (naphthalene-1-acetic acid, NAA) to start (Gossypium hirsutum) ovule/fiber cultures hindered fiber secondary wall cellulose synthesis compared with natural auxin (indole-3-acetic acid, IAA). In contrast, NAA promoted fiber elongation and ovule weight gain, which resulted in larger ovule/fiber units. To reach these conclusions, fiber and ovule growth parameters were measured and cell wall characteristics were examined microscopically. The differences in fiber from NAA and IAA culture were underpinned by changes in the expression patterns of marker genes for three fiber developmental stages (elongation, the transition stage, and secondary wall deposition), and these gene expression patterns were also analyzed quantitatively in plant-grown fiber. The results demonstrate that secondary wall cellulose synthesis: (1) is under strong transcriptional control that is influenced by auxin; and (2) must be specifically characterized in the cotton ovule/fiber culture system given the many protocol variables employed in different laboratories.
Directory of Open Access Journals (Sweden)
Yongjun Mei
Full Text Available Genetic architecture of branch traits has large influences on the morphological structure, photosynthetic capacity, planting density, and yield of Upland cotton (Gossypium hirsutum L.. This research aims to reveal the genetic effects of six branch traits, including bottom fruit branch node number (BFBNN, bottom fruit branch length (BFBL, middle fruit branch node number (MFBNN, middle fruit branch length (MFBL, upper fruit branch node number (UFBNN, and upper fruit branch length (UFBL. Association mapping was conducted for these traits of 39 lines and their 178 F1 hybrids in three environments. There were 20 highly significant Quantitative Trait SSRs (QTSs detected by mixed linear model approach analyzing a full genetic model with genetic effects of additive, dominance, epistasis and their environment interaction. The phenotypic variation explained by genetic effects ranged from 32.64 ~ 91.61%, suggesting these branch traits largely influenced by genetic factors.
Induced mutations for improvement of desi cotton
International Nuclear Information System (INIS)
Waghmare, V.N.; Mohan, Punit; Singh, Phundan; Gururajan, K.N.
2000-01-01
Desi cotton varieties of Gossypium arboreum have wide adaptability and are relatively tolerant to biotic (insect pests and diseases) and abiotic (moisture and salt) stresses. Desi varieties have got potential to yield even under adverse and low input situations. Most of them are synchronous in maturity and possess consistent fibre properties. Despite such merits, very little attention has been paid for improvement of desi cotton. The present area under arboreum varieties is 17.0% (15.30 lakh ha.) against 65% (35.75 lakh ha) during 1947-48. Deliberate attempts are required to improve G. arboreum for its economic and quality characters to compete with upland varieties in rainfed cotton ecology
Using cotton plant residue to produce briquettes
Energy Technology Data Exchange (ETDEWEB)
Coates, W. [University of Arizona, Tucson, AZ (United States). Bioresources Research Facility
2000-07-01
In Arizona, cotton (Gossypium) plant residue left in the field following harvest must be buried to prevent it from serving as an overwintering site for insects such as the pink bollworm. Most tillage operations employed to incorporate the residue into the soil are energy intensive and often degrade soil structure. Trials showed that cotton plant residue could be incorporated with pecan shells to produce commercially acceptable briquettes. Pecan shell briquettes containing cotton residue rather than waste paper were slightly less durable, when made using equivalent weight mixtures and moisture contents. Proximate and ultimate analyses showed the only difference among briquette samples to be a higher ash content in those made using cotton plant residue. Briquettes made with paper demonstrated longer flame out time, and lower ash percentage, compared to those made with cotton plant residue. (author)
Differential Gene Expression of Longan Under Simulated Acid Rain Stress.
Zheng, Shan; Pan, Tengfei; Ma, Cuilan; Qiu, Dongliang
2017-05-01
Differential gene expression profile was studied in Dimocarpus longan Lour. in response to treatments of simulated acid rain with pH 2.5, 3.5, and a control (pH 5.6) using differential display reverse transcription polymerase chain reaction (DDRT-PCR). Results showed that mRNA differential display conditions were optimized to find an expressed sequence tag (EST) related with acid rain stress. The potential encoding products had 80% similarity with a transcription initiation factor IIF of Gossypium raimondii and 81% similarity with a protein product of Theobroma cacao. This fragment is the transcription factor activated by second messenger substances in longan leaves after signal perception of acid rain.
Dicty_cDB: Contig-U05261-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library
Dicty_cDB: Contig-U05216-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 064701 ) WNEL14b1 Wheat EST endosperm library Triticum aes... 40 0.032 2 ( AC200123 ) Zea mays chromosome 4 ... CF-24-HW fat cDNA... 36 0.055 2 ( EG551033 ) MM04K05_RP Sugar Beet germination cDNA library Be... 36 0.055 2 ( AG332587 ) Mus muscul...7 2 ( AZ506962 ) 1M0348D20F Mouse 10kb plasmid UUGC1M library Mus ... 40 0.057 2 ( BB898919 ) Macaca fascicul...V968176 ) GC06167 Gracilaria changii cDNA library Gracilari... 46 0.014 2 ( AG430324 ) Mus musculus molossin..._IpSto_12_p10 Stomach cDNA library Ictalurus p... 32 0.76 2 ( DX535456 ) GH_MBb0065G22f GH_MBb Gossypium hirsutum genomic
Dicty_cDB: Contig-U05935-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available MOF-029C10, gen... 42 5.6 1 ( CT497775 ) A BAC library has been constructed from cultivar ... 42 5.6 1 ( CC2...... 42 5.6 1 ( CK278923 ) EST725001 potato abiotic stress cDNA library Sola... 42... 5.6 1 ( CK276546 ) EST722624 potato abiotic stress cDNA library Sola... 42 5.6 1 ( CK256717 ) EST740354 potato callus cDNA library...14 ) GR_Sa0007H24.b1 Gossypium raimondii WGS library G... 42 5.6 1 ( DU663768 ) OG_ABa0072K07.r OG_ABa Oryza granulata genomic...) Macropus eugenii clone ME_KBa-598C23, WORKING DRA... 42 5.6 1 ( AY714860 ) Unculture
Dicty_cDB: Contig-U15577-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 ( DX391817 ) GE__Sa0055E06.b1 Gossypium exiguum WGS library Go... 46 6.0 1 ( DU796002 ) APKH661.g2 HF770_12-21-03 unculture...m low-mole... 40 0.46 3 ( BQ608181 ) BRY_4083 wheat EST endosperm library Triticum aes... 40 0.49 2 ( B...( BQ606727 ) BRY_2596 wheat EST endosperm library Triticum aes... 40 0.58 2 ( EA234432 ) Sequence 98747 from...60 2 ( BQ608481 ) BRY_4386 wheat EST endosperm library Triticum aes... 40 0.60 2 ( BJ235142 ) Triticum aesti...eat developing grains cDNA li... 40 0.60 2 ( BQ609229 ) BRY_5153 wheat EST endosperm library Triticu
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
Biological fabrication of cellulose fibers with tailored properties
Natalio, Filipe; Fuchs, Regina; Cohen, Sidney R.; Leitus, Gregory; Fritz-Popovski, Gerhard; Paris, Oskar; Kappl, Michael; Butt, Hans-Jürgen
2017-09-01
Cotton is a promising basis for wearable smart textiles. Current approaches that rely on fiber coatings suffer from function loss during wear. We present an approach that allows biological incorporation of exogenous molecules into cotton fibers to tailor the material’s functionality. In vitro model cultures of upland cotton (Gossypium hirsutum) are incubated with 6-carboxyfluorescein-glucose and dysprosium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-glucose, where the glucose moiety acts as a carrier capable of traveling from the vascular connection to the outermost cell layer of the ovule epidermis, becoming incorporated into the cellulose fibers. This yields fibers with unnatural properties such as fluorescence or magnetism. Combining biological systems with the appropriate molecular design offers numerous possibilities to grow functional composite materials and implements a material-farming concept.
Directory of Open Access Journals (Sweden)
Danilo Henrique da Matta
2017-04-01
Full Text Available The carabids (Coleoptera: Carabidae are recognized as polyphagous predators and important natural enemies of insect pests. However, little is known about the feeding habits of these beetles. In this work, we determine the types of food content in the digestive tracts of nine species of Carabidae associated with herbaceous plants and different growth stages of coloured cotton. The food contents were evaluated for beetles associated with the coloured cotton cv. BRS verde, Gossypium hirsutum L. latifolium Hutch., adjacent to weed plants and the flowering herbaceous plants (FHPs Lobularia maritima (L., Tagetes erecta L., and Fagopyrum esculentum Moench. The digestive tract analysis indicated various types of diets and related arthropods for Abaris basistriata, Galerita brasiliensis, Scarites sp., Selenophorus alternans, Selenophorus discopunctatus and Tetracha brasiliensis. The carabids were considered to be polyphagous predators, feeding on different types of prey.
Sato, Daisuke; Awad, Ayman A; Takeuchi, Yasutomo; Yoneyama, Koichi
2005-01-01
The germination stimulants for root parasitic plants Striga and Orobanche produced by cotton (Gossypium hirsutum L.) were examined in detail. Seeds of cotton were germinated and grown on glass wool wetted with sterile distilled water in sterile filter units. The root exudate was collected daily and extracted with ethyl acetate. Each of these ethyl acetate extracts was analyzed directly by high-performance liquid chromatography linked with tandem mass spectrometry (LC/MS/MS). The results demonstrate that cotton roots exuded strigol and strigyl acetate, but no other known strigolactones such as orobanchol and alectrol. The production of strigol was detected even in the root exudate collected during the first 24 h of incubation and reached a maximum 5-7 days later. The average exudation of strigol and strigyl acetate during the incubation period was ca. 15 and 2 pg/plant/day, respectively, indicating that strigol mainly contributed to germination stimulation by the cotton root exudate.
Isolation of a cotton NADP(H oxidase homologue induced by drought stress
Directory of Open Access Journals (Sweden)
NEPOMUCENO ALEXANDRE LIMA
2000-01-01
Full Text Available The aim of this study was to identify and isolate genes that are differentially expressed in four selected cotton (Gossypium hirsutum L. genotypes contrasting according to their tolerance to water deficit. The genotypes studied were Siokra L-23, Stoneville 506, CS 50 and T-1521. Physiological, morphological and developmental changes that confer drought tolerance in plants must have a molecular genetic basis. To identify and isolate the genes, the mRNA Differential Display (DD technique was used. Messenger RNAs differentially expressed during water deficit were identified, isolated, cloned and sequenced. The cloned transcript A12B15-5, a NADP(H oxidase homologue, was up regulated only during the water deficit stress and only in Siokra L-23, a drought tolerant genotype. Ribonuclease protection assay confirmed that transcription.
Cellulose synthases: new insights from crystallography and modeling.
Slabaugh, Erin; Davis, Jonathan K; Haigler, Candace H; Yingling, Yaroslava G; Zimmer, Jochen
2014-02-01
Detailed information about the structure and biochemical mechanisms of cellulose synthase (CelS) proteins remained elusive until a complex containing the catalytic subunit (BcsA) of CelS from Rhodobacter sphaeroides was crystalized. Additionally, a 3D structure of most of the cytosolic domain of a plant CelS (GhCESA1 from cotton, Gossypium hirsutum) was produced by computational modeling. This predicted structure contributes to our understanding of how plant CelS proteins may be similar and different as compared with BcsA. In this review, we highlight how these structures impact our understanding of the synthesis of cellulose and other extracellular polysaccharides. We show how the structures can be used to generate hypotheses for experiments testing mechanisms of glucan synthesis and translocation in plant CelS. Copyright © 2013 Elsevier Ltd. All rights reserved.
McSorley, R; Dickson, D W; de Brito, J A; Hewlett, T E; Frederick, J J
1994-06-01
The effects of 12 summer crop rotation treatments on population densities of Meloidogyne arenaria race 1 and on yields of subsequent spring vegetable crops were determined in microplots. The crop sequence was: (i) rotation crops during summer 1991 ; (ii) cover crop of rye (Secale cereale) during winter 1991-92; (iii) squash (Cucurbita pepo) during spring 1992; (iv) rotation crops during summer 1992; (v) rye during winter 1992-93; (vi) eggplant (Solanum melongena) during spring 1993. The 12 rotation treatments were castor (Ricinus communis), cotton (Gossypium hirsutum), velvetbean (Mucuna deeringiana), crotalaria (Crotalaria spectabilis), fallow, hairy indigo (Indigofera hirsuta), American jointvetch (Aeschynomene americana), sorghum-sudangrass (Sorghum bicolor x S. sudanense), soybean (Glycine max), horsebean (Canavalia ensiformis), sesame (Sesamum indicum), and peanut (Arachis hypogaea). Compared to peanut, the first eight rotation treatments resulted in lower (P crops may provide a means for depressing M. arenaria population densities on a short-term basis to enhance yields in a subsequent susceptible vegetable crop.
Impact of mine waste dumps on growth and biomass of economically important crops.
Mathiyazhagan, Narayanan; Natarajan, Devarajan
2012-11-01
The present study aimed to investigate the effect of magnesite and bauxite waste dumps on growth and biochemical parameters of some edible and economically important plants such as Vigna radiata, V. mungo, V. unguiculata, Eleusine coracana, Cajanus cajan, Pennisetum glaucum, Macrotyloma uniflorum, Oryza sativa, Sorghum bicolour, Sesamum indicum, Ricinus communis, Brassica juncea, Gossypium hirsutum and Jatropha curcas. The growth rate of all the crops was observed in the range of 75 to 100% in magnesite and 15 to 100% in bauxite mine soil. The moisture content of roots and shoots of all the crops were in the range of 24 to 77, 20 to 88% and 42 to 87, 59 to 88% respectively. The height of the crops was in the range of 2.6 to 48 cm in magnesite soil and 3 to 33 cm in bauxite soil. Thus the study shows that both mine soils reflects some physical and biomolecule impact on selected crops.
Nitrogen, potassium and plant growth retardant effects on oil content and quality of cotton seed
Directory of Open Access Journals (Sweden)
Alkassas, A. R.
2007-09-01
Full Text Available The aim of this field experiment was to investigate the effect of nitrogen, potassium and a plant growth retardant (PGR on seed yield and protein and oil content of an Egyptian cotton cultivar (Gossypium barbadense Giza 86. Treatments consisted of: soil application of N (95 and 143 kg N ha-1 in the form ammonium nitrate, foliar application of potassium (0, 319, 638 or 957 g K ha-1 as potassium sulfate and foliar application of mepiquat chloride (MC (0 and 48 + 24 g active ingredient ha-1 on seed, protein and oil yields and oil properties of Egyptian cotton cultivar âGiza 86â (Gossypium barbadense. After applying the higher N-rate, foliar application of potassium and plant growth retardant MC significantly increased seed yield and the content of seed protein and oil, seed oil refractive index, unsaponifiable matter and total unsaturated fatty acids (oleic and linoleic. In contrast, oil acid and saponification value as well as total saturated fatty acids were decreased by foliar application of potassium and MC. The seed oil content was decreased with soil application of N.El objetivo de los experimentos de campo fue investigar el efecto del nitrogeno, potasio y retardantes del crecimiento de plantas sobre el contenido en proteínas y aceite de una semilla de algodón cultivada en Egipto (Gossypium barbadense Giza 86. Los tratamientos consistieron en la aplicación en suelo de N (95 and 143 kg N ha-1 en forma de nitrato amónico, aplicación foliar de K (0, 319, 638 or 957 g K ha-1 como sulfato potásico y aplicación foliar de cloruro de m mepiquat (MC (0 and 48 + 24 g de ingrediente activo ha-1 sobre un cultivar de algodón «Giza 86» (Gossypium barbadense. La aplicación de la cantidad más elevada de N, unida a la aplicación de potasio y del retardador MC, aumentó significativamente el rendimiento en semilla, así como el contenido en proteinas y en aceite. Respecto al aceite, aumentó el índice de refracción, la fracci
Directory of Open Access Journals (Sweden)
Aline Gonçalves Freitas
2015-12-01
Full Text Available The first cultural traces of ancient pottery towns in the Serra de Baturité are presented. The pollen spectrum of sediments reveals a mosaic of moist mountainous vegetation, xerophytes, annual nitrophilous, hygrophilous and bog plants. Useful pollen recovered from ceramic, such as cassava (Manihot type, sweet potatoes (Ipomoea type, cotton (Gossypium type, palm trees and fruitful (Arecaceae, cf. Astronium and Anacardium type, together with pathogenic microfungi corn, cotton and some tubers (Curvularia type, Alternaria, Puccinia type and cf. Ustilago maydis indicate agricultural and livelihood activities. The coprophilous fungi of humans and other animals (Cercophora type Gelasinospora type and Sordariaceae reflect the time spent by these groups in the archaeological area. The Gelasinospora fungus also shows the use of fire as fuel for agricultural practices and hunting. These data demonstrate the use of ceramics in funerary and domestic contexts.
RARE CASE OF TEXTILOMA OF NOSE PRESENTING WITH FAILURE OF EXTERNAL DCR AND NASAL OBSTRUCTION
Directory of Open Access Journals (Sweden)
Prakash
2015-05-01
Full Text Available It’s not uncommon to have complications for a surgical procedure even after taking meticulous care about do’s and don’ts. Retained foreign objects (RFO are one of the underreported complications for obvious reasons of legal issues . [1,2,3,4] It can be either surgical instruments or surgical sponges or cotton balls. They are called as Gossypiboma , textiloma. The term "gossypiboma" is derived from the Latin gossypium (“cotton wool, cotton ” and t he suffix - oma , meaning a tumor or growth, and describes a mass within a patient's body comprising a cotton matrix surrounded by a foreign body granuloma . "Textiloma" is derived from textile (surgical sponges have historic ally been made of cloth, and is used in place of gossypiboma due to the increasing use of synthetic materials in place of cotton .
Directory of Open Access Journals (Sweden)
Ammara eAhad
2015-09-01
Full Text Available Diversity of colors in flowers and fruits is largely due to anthocyanin pigments. The flavonoid/anthocyanin pathway has been most extensively studied. Dihydroflavonol 4-reductase (DFR is a vibrant enzyme of the flavonoid pathway which displays major impact on the formation of anthocyanins, flavan 3-ols and flavonols. The substrate specificity of the DFR was found to play a crucial role in determination of type of anthocyanidins. Altering the flavonoid/ anthocyanin pathway through genetic engineering to develop color of our own choice is an exciting subject of future research. In the present study, comparison among four DFR genes (Gossypium hirsutum, Iris × hollandica, Ang. DFRI and DFRII, sequence alignment for homology as well as protein modeling and docking is demonstrated. Estimation of catalytic sites, prediction of substrate preference and protein docking were the key features of this article. For specific substrate uptake, a proline rich region and positions 12 plus 26 along with other positions emphasizing the 26-amino acid residue region (132-157 was tested. Results showed that proline rich region position 12, 26 and 132-157 plays an important role in selective attachment of DFRs with respective substrates. Further, ‘Expasy ProtParam tool’ results showed that Iris × hollandica DFR amino acids (Asn 9: Asp 23 favorable for reducing DHQ and DHM thus accumulating delphinidin, while Gossypium hirsutum DFR has (Asn 13: Asp 21 hypothesized to consume DHK. Protein docking data showed that amino acid residues in above mentioned positions were just involved in attachment of DFR with substrate and had no role in specific substrate uptake.Advanced bioinformatics analysis has revealed that all above mentioned positions have role in substrate attachment. For substrate specificity, other residues region is involved. It will help in color manipulations in different plant species.
Directory of Open Access Journals (Sweden)
Charry Calle Jairo
1988-12-01
Full Text Available Los dos suelos salino-sódicos se cultivaron sucesivamente con algodón (Gossypium hirsutum var. Gossica P-21, soya (Glycine max var. ICA- Tunía y fríjol (Phaseolus vulgaris var. ICA- Gualí. La estabilidad de los agregados para los suelos, tratamientos y cultivos, se comparó calculando el área localizada debajo de cada una de las curvas aditivas porcentuales de los agregados, entre los parámetros menor de 025 mm y 0.42-0.84 mm.Residuality of sulfuric acid applied as amendment and calculated according to CEC and Sum of Exchangeable Bases (Ca, Mg, Na and K on the aggregate stability of two saline-sodic soils from Palmaseca zone , Cauca Valley, successively cultivated in cotton (Gossypium hirsutum var. Gossica P- 211. soybean (Glycine max var. ICA Tunía and bean (Phaseolus vulgaris var. ICA-Gualí was studied. The aggregate stability for two soils, treatments and crops, was compared by calculating the area located below each one of the accumulative percentage curves of aggregates, between less than 025 mm and 0.42-084 mm parameters. The results showed: A percent increase up to 56% in the aggregate stability of both soils, in treatments calculated according to CEC cultivated in soybean, and Sum of Exchangeable Bases cultivated in bean. The characteristic roots do not have a pronounced effect on aggregation. The initial and final chemical analysis of soils cultivated in cotton, bean and soybean showed in general, a 90 to 98% reductions of levels of sulphate, exchangeable sodium and exchangeable sodium percentage.
Genome-wide analysis of the WRKY gene family in cotton.
Dou, Lingling; Zhang, Xiaohong; Pang, Chaoyou; Song, Meizhen; Wei, Hengling; Fan, Shuli; Yu, Shuxun
2014-12-01
WRKY proteins are major transcription factors involved in regulating plant growth and development. Although many studies have focused on the functional identification of WRKY genes, our knowledge concerning many areas of WRKY gene biology is limited. For example, in cotton, the phylogenetic characteristics, global expression patterns, molecular mechanisms regulating expression, and target genes/pathways of WRKY genes are poorly characterized. Therefore, in this study, we present a genome-wide analysis of the WRKY gene family in cotton (Gossypium raimondii and Gossypium hirsutum). We identified 116 WRKY genes in G. raimondii from the completed genome sequence, and we cloned 102 WRKY genes in G. hirsutum. Chromosomal location analysis indicated that WRKY genes in G. raimondii evolved mainly from segmental duplication followed by tandem amplifications. Phylogenetic analysis of alga, bryophyte, lycophyta, monocot and eudicot WRKY domains revealed family member expansion with increasing complexity of the plant body. Microarray, expression profiling and qRT-PCR data revealed that WRKY genes in G. hirsutum may regulate the development of fibers, anthers, tissues (roots, stems, leaves and embryos), and are involved in the response to stresses. Expression analysis showed that most group II and III GhWRKY genes are highly expressed under diverse stresses. Group I members, representing the ancestral form, seem to be insensitive to abiotic stress, with low expression divergence. Our results indicate that cotton WRKY genes might have evolved by adaptive duplication, leading to sensitivity to diverse stresses. This study provides fundamental information to inform further analysis and understanding of WRKY gene functions in cotton species.
Sivarajasekar, N.; Baskar, R.; Ragu, T.; Sarika, K.; Preethi, N.; Radhika, T.
2017-07-01
The immature Gossypium hirsutum seeds—an agricultural waste was converted into a novel adsorbent and its effectiveness for cationic dyes removal was discussed in this study. Characterization revealed that sulfuric acid activated waste Gossypium hirsutum seed (WGSAB) contains surface area 496 m2 g-1. The ability of WGSAB to adsorb basic red 2 (BR2) and basic violet 3 (BV3) from aqueous solutions has been studied. Batch adsorption studies were carried out at different initial dye concentrations (100-300 mg l-1), contact time (1-5 h), pH (2-12) and temperature (293-323 K) to understand the adsorption mechanism. Adsorption data were modeled using Langmuir, Freundlich and Toth adsorption isotherms. Equilibrium data of the adsorption process fitted very well to the Toth model for both dyes. The Langmuir maximum adsorption capacity was 66.69 mg g-1 for BV3 and 50.11 mg g-1 for BR2 at optimum conditions. The near unity value of Toth isotherm constant (BR2: 0.999 and BV3: 1.0) indicates that WGSAB surface is heterogeneous in nature. The maximum adsorption capacity predicted by Toth isotherm of BV3 (66.699 mg g-1) is higher than BR2 (50.310 mg g-1). The kinetic investigation revealed that the BR2 and BV3 were chemisorbed on WGSAB surface following Avrami fractional order kinetics. Further, the fractional order and rate constant values are almost similar for every concentration in both the dyes. The thermodynamic parameters such as Δ H 0, Δ S 0 and Δ G 0 were evaluated. The dye adsorption process was found to be spontaneous and endothermic for the two dyes. Regeneration of WGSAB exhausted by the two dyes could be possible via acetic acid as elutant.
Directory of Open Access Journals (Sweden)
Francisco das Chagas Vidal Neto
2008-02-01
Full Text Available Os efeitos de caracteres mutantes morfológicos do algodoeiro (Gossypium hirsutum L. r. latifolium Hutch.: folha okra, bráctea frego e planta vermelha, em relação à resistência à mosca-branca (Bemisia tabaci biótipo B Hemiptera: Aleyrodidae, foram avaliados em experimentos com ou sem chance de escolha. Os experimentos foram conduzidos em casa-de-vegetação, no delineamento de blocos ao acaso, em fatorial 23 + 1, com quatro repetições. O mutante com a característica planta vermelha foi menos atrativo e menos preferido para oviposição, em relação à planta verde, em ambos os ensaios, com ou sem escolha. Não houve preferência quanto à forma da folha e ao tipo de bráctea.The effects of cotton lines (Gossypium hirsutum L. r. latifolium Hutch. with mutants morphologic characteristics: okra leaf, frego bract and red plant in relation to host plant resistance to whitefly (Bemisia tabaci bioyipe B Hemiptera: Aleyrodidae, were evaluated in choice or no choice assays. The assays were carried out in the greenhouse conditions, according to a completely randomized block design, in a 23 + 1 in a factorial arrangement with four replications. The mutant with red plant characteristic was less attractive and less preferred for oviposition than the normal green plant does, in both, whit or without choice tests. It did not have preference in relation to the form of the leaf and bract type.
Roy, Sribash; Tyagi, Antariksh; Shukla, Virendra; Kumar, Anil; Singh, Uma M.; Chaudhary, Lal Babu; Datt, Bhaskar; Bag, Sumit K.; Singh, Pradhyumna K.; Nair, Narayanan K.; Husain, Tariq; Tuli, Rakesh
2010-01-01
Background The concept of DNA barcoding for species identification has gained considerable momentum in animals because of fairly successful species identification using cytochrome oxidase I (COI). In plants, matK and rbcL have been proposed as standard barcodes. However, barcoding in complex genera is a challenging task. Methodology and Principal Findings We investigated the species discriminatory power of four reportedly most promising plant DNA barcoding loci (one from nuclear genome- ITS, and three from plastid genome- trnH-psbA, rbcL and matK) in species of Indian Berberis L. (Berberidaceae) and two other genera, Ficus L. (Moraceae) and Gossypium L. (Malvaceae). Berberis species were delineated using morphological characters. These characters resulted in a well resolved species tree. Applying both nucleotide distance and nucleotide character-based approaches, we found that none of the loci, either singly or in combinations, could discriminate the species of Berberis. ITS resolved all the tested species of Ficus and Gossypium and trnH-psbA resolved 82% of the tested species in Ficus. The highly regarded matK and rbcL could not resolve all the species. Finally, we employed amplified fragment length polymorphism test in species of Berberis to determine their relationships. Using ten primer pair combinations in AFLP, the data demonstrated incomplete species resolution. Further, AFLP analysis showed that there was a tendency of the Berberis accessions to cluster according to their geographic origin rather than species affiliation. Conclusions/Significance We reconfirm the earlier reports that the concept of universal barcode in plants may not work in a number of genera. Our results also suggest that the matK and rbcL, recommended as universal barcode loci for plants, may not work in all the genera of land plants. Morphological, geographical and molecular data analyses of Indian species of Berberis suggest probable reticulate evolution and thus barcode markers may
Directory of Open Access Journals (Sweden)
Sribash Roy
Full Text Available BACKGROUND: The concept of DNA barcoding for species identification has gained considerable momentum in animals because of fairly successful species identification using cytochrome oxidase I (COI. In plants, matK and rbcL have been proposed as standard barcodes. However, barcoding in complex genera is a challenging task. METHODOLOGY AND PRINCIPAL FINDINGS: We investigated the species discriminatory power of four reportedly most promising plant DNA barcoding loci (one from nuclear genome--ITS, and three from plastid genome--trnH-psbA, rbcL and matK in species of Indian Berberis L. (Berberidaceae and two other genera, Ficus L. (Moraceae and Gossypium L. (Malvaceae. Berberis species were delineated using morphological characters. These characters resulted in a well resolved species tree. Applying both nucleotide distance and nucleotide character-based approaches, we found that none of the loci, either singly or in combinations, could discriminate the species of Berberis. ITS resolved all the tested species of Ficus and Gossypium and trnH-psbA resolved 82% of the tested species in Ficus. The highly regarded matK and rbcL could not resolve all the species. Finally, we employed amplified fragment length polymorphism test in species of Berberis to determine their relationships. Using ten primer pair combinations in AFLP, the data demonstrated incomplete species resolution. Further, AFLP analysis showed that there was a tendency of the Berberis accessions to cluster according to their geographic origin rather than species affiliation. CONCLUSIONS/SIGNIFICANCE: We reconfirm the earlier reports that the concept of universal barcode in plants may not work in a number of genera. Our results also suggest that the matK and rbcL, recommended as universal barcode loci for plants, may not work in all the genera of land plants. Morphological, geographical and molecular data analyses of Indian species of Berberis suggest probable reticulate evolution and thus
Directory of Open Access Journals (Sweden)
Yujuan Zhang
2015-06-01
Full Text Available MicroRNAs (miRNAs are a group of endogenous small non-coding RNAs that play important roles in plant growth, development, and stress response processes. Verticillium wilt is a vascular disease in plants mainly caused by Verticillium dahliae Kleb., the soil-borne fungal pathogen. However, the role of miRNAs in the regulation of Verticillium defense responses is mostly unknown. This study aimed to identify new miRNAs and their potential targets that are involved in the regulation of Verticillium defense responses. Four small RNA libraries and two degradome libraries from mock-infected and infected roots of cotton (both Gossypium hirsutum L. and Gossypium barbadense L. were constructed for deep sequencing. A total of 140 known miRNAs and 58 novel miRNAs were identified. Among the identified miRNAs, many were differentially expressed between libraries. Degradome analysis showed that a total of 83 and 24 genes were the targets of 31 known and 14 novel miRNA families, respectively. Gene Ontology analysis indicated that many of the identified miRNA targets may function in controlling root development and the regulation of Verticillium defense responses in cotton. Our findings provide an overview of potential miRNAs involved in the regulation of Verticillium defense responses in cotton and the interactions between miRNAs and their corresponding targets. The profiling of these miRNAs lays the foundation for further understanding of the function of small RNAs in regulating plant response to fungal infection and Verticillium wilt in particular.
Directory of Open Access Journals (Sweden)
Verloove, F.
2013-12-01
Full Text Available Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum chrysotrichum, Tecoma stans, Tipuana tipu, Urochloa mutica, U. plantaginea y Washingtonia se citan por primera vez para las Islas Canarias, mientras que Alopecurus myosuroides, Amaranthus blitoides, Bothriochloa ischaemum var. songarica, Cardamine flexuosa subsp. debilis, Heliotropium curassavicum, Leonotis nepetifolia, Medicago lupulina, Parkinsonia aculeata, Physalis peruviana, Phytolacca americana y Turnera ulmifolia son nuevas para la flora de la isla de Gran Canaria. Finalmente, se confirma la presencia de Paspalum vaginatum, P. distichum y Cortaderia selloana en Gran Canaria.Trabajos recientes de campo en Gran Canaria han facilitado el descubrimiento de nuevas localidades para plantas vasculares no nativas. Agave attenuata, Antigonon leptopus, Atriplex nummularia, Cascabela thevetia, Cenchrus echinatus, Cuscuta campestris, Diplachne fusca subsp. uninervia, Diplotaxis tenuifolia, Dysphania anthelmintica (hasta ahora confundida con D. ambrosioides, Eclipta prostrata, Euphorbia pulcherrima, Fagopyrum esculentum, Gossypium barbadense, Lablab purpureus, Lemna minuta, Opuntia leucotricha, Passiflora edulis, Pennisetum glaucum, Phaseolus acutifolius, Pluchea carolinensis, Prosopis juliflora, Salvia microphylla, Schinus terebinthifolius, Senna spectabilis, Solanum
Diversidade de angiospermas e espécies medicinais de uma área de Cerrado
Directory of Open Access Journals (Sweden)
A.F. SILVA
2015-01-01
Full Text Available RESUMO Este trabalho teve como objetivo conhecer a diversidade vegetal de uma área de Cerrado em Prudente de Morais, MG, bem como suas indicações medicinais. Foram feitas nove excursões à reserva da Fazenda Experimental Santa Rita da Empresa de Pesquisa Agropecuária de Minas Gerais (FESR/EPAMIG (19°26’20”’ S e 44°09’15”’ W. O material vegetal coletado foi herborizado, identificado e incorporado ao acervo do Herbário PAMG/EPAMIG. O sistema de classificação utilizado foi o APG III. Após a identificação, realizou-se uma pesquisa bibliográfica buscando dados sobre a utilização medicinal das espécies. Coletaram-se 108 espécies pertencentes a 47 famílias. As famílias mais representativas foram: Fabaceae, com 16 espécies, Myrtaceae com sete espécies, Asteraceae e Rubiaceae com seis espécies cada, Malpighiaceae e Solanaceae com cinco espécies cada, Erythroxylaceae, Euphorbiaceae e Vochysiaceae, com quatro espécies cada, Anacardiaceae, Apocynaceae, Lamiaceae e Sapindaceae com três espécies cada, Annonaceae, Arecaceae, Bignoniaceae, Celastraceae e Primulaceae com duas espécies cada. Vinte e nove famílias foram monoespecíficas. Das 108 espécies, 39 são árvores (36%, 43 arbustos (40%, seis subarbustos (5,5%, 14 lianas (13% e seis são ervas (5,5%. Sessenta e seis (61% espécies pertencentes a 39 famílias (83% são utilizadas popularmente, para o tratamento de alguma doença. As famílias com maior número de espécies medicinais foram: Fabaceae com oito espécies; Rubiaceae com cinco espécies e Solanaceae com quatro espécies. As espécies que apresentaram mais finalidades terapêuticas foram: Brosimum gaudichaudii Trécul (Moraceae, Caryocar brasiliense Cambess. (Caryocaraceae, Cochlospermum regium (Mart. ex Schrank Pilg. (Bixaceae, Croton urucurana Bail. (Euphorbiaceae, Gomphrena officinalis Mart. (Amaranthaceae, Hymenaea stigonocarpa Mart. ex Hayne (Fabaceae, Lithrea molleoides (Vell. Engl. (Anacardiaceae
Directory of Open Access Journals (Sweden)
Paulo Eduardo Degrande
2011-10-01
Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica
Suzuki, Hideaki; Yu, Jiwen; Wang, Fei; Zhang, Jinfa
2013-06-01
Cytoplasmic male sterility (CMS), which is a maternally inherited trait and controlled by novel chimeric genes in the mitochondrial genome, plays a pivotal role in the production of hybrid seed. In cotton, no PCR-based marker has been developed to discriminate CMS-D8 (from Gossypium trilobum) from its normal Upland cotton (AD1, Gossypium hirsutum) cytoplasm. The objective of the current study was to develop PCR-based single nucleotide polymorphic (SNP) markers from mitochondrial genes for the CMS-D8 cytoplasm. DNA sequence variation in mitochondrial genes involved in the oxidative phosphorylation chain including ATP synthase subunit 1, 4, 6, 8 and 9, and cytochrome c oxidase 1, 2 and 3 subunits were identified by comparing CMS-D8, its isogenic maintainer and restorer lines on the same nuclear genetic background. An allelic specific PCR (AS-PCR) was utilized for SNP typing by incorporating artificial mismatched nucleotides into the third or fourth base from the 3' terminus in both the specific and nonspecific primers. The result indicated that the method modifying allele-specific primers was successful in obtaining eight SNP markers out of eight SNPs using eight primer pairs to discriminate two alleles between AD1 and CMS-D8 cytoplasms. Two of the SNPs for atp1 and cox1 could also be used in combination to discriminate between CMS-D8 and CMS-D2 cytoplasms. Additionally, a PCR-based marker from a nine nucleotide insertion-deletion (InDel) sequence (AATTGTTTT) at the 59-67 bp positions from the start codon of atp6, which is present in the CMS and restorer lines with the D8 cytoplasm but absent in the maintainer line with the AD1 cytoplasm, was also developed. A SNP marker for two nucleotide substitutions (AA in AD1 cytoplasm to CT in CMS-D8 cytoplasm) in the intron (1,506 bp) of cox2 gene was also developed. These PCR-based SNP markers should be useful in discriminating CMS-D8 and AD1 cytoplasms, or those with CMS-D2 cytoplasm as a rapid, simple, inexpensive, and
Directory of Open Access Journals (Sweden)
Osvaldo N Sousa Neto
2012-02-01
Full Text Available Conduziu-se um experimento no Campus da Universidade Federal Rural do Semiárido em Mossoró, RN, com o objetivo de avaliar o comportamento do algodoeiro (Gossypium hirsutum L. raça latifolium Hatch cultivar 8H, quanto ao aspecto crescimento, quando irrigado com efluentes domésticos tratados. O delineamento experimental adotado foi o de blocos casualizados com parcelas subdivididas e sendo testadas, nas parcelas, as diluições do efluente doméstico [25% - T1, 50% - T2, 75% - T3 e 100% de água residuária- T4 e água de abastecimento + adubação mineral do solo - T5] em dois solos de texturas contrastantes (Latossolo Vermelho Amarelo - S1 e Cambissolo - S2. A irrigação com água residuária influenciou significativamente o crescimento das plantas de algodoeiro, em referência ao índice de velocidade de emergência, à percentagem de germinação à altura de plantas, ao diâmetro caulinar e número de folhas e à área foliar e massa seca de parte aérea, crescendo com o aumento da proporção de uso do efluente doméstico. Houve efeito positivo do acúmulo de nutrientes no solo aplicados via fertirrigação sobre as variáveis estudadas. A fertirrigação com efluente doméstico tratado pode substituir a adubação convencional do algodoeiro.An experiment was conducted at the Universidade Federal Rural do Semi-arid in Mossoró, RN with the aim of evaluating the behavior of cotton (Gossypium hirsutum L. race latifolium Hatch 8H cultivar, in terms of growth when irrigated with treated domestic sewage. The experimental design was in randomized blocks with split plots and in plots were tested dilutions of wastewater [25% - T1, 50% - T2, 75% - T3 and 100% of wastewater - T4 and supply water with mineral fertilizer - T5] in two soils of contrasting textures. Irrigation with wastewater significantly influenced the growth of cotton plants, the rate of emergence, the germination percentage, plant height, stem diameter and leaf area, growing
Directory of Open Access Journals (Sweden)
JOSÉ JANDUI SOARES
2000-09-01
Full Text Available Com o objetivo de verificar o efeito de inseticidas em insetos predadores em cultura de algodão (Gossypium hirsutum L., instalaram-se, em 1993-1994, dois experimentos, um no campo, e outro, em laboratório. No experimento realizado no campo, os tratamentos foram: Fipronil 200 SC (75 g/ha de i.a.; Fipronil 800 WDG (64, 80 e 100 g/ha de i.a.; Endosulfan 350 CE (700 g/ha de i.a.; e testemunha. Em laboratório, além das formulações à base de Fipronil foi utilizado o Paration metílico 600 CE (480 g/ha de i.a.. Fipronil foi seletivo para os artrópodes predadores (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea e Doru lineare no campo, e a Cycloneda sanguinea (L., em laboratório, e pode ser recomendado em programas de manejo integrado de pragas na cultura do algodoeiro para o controle de Alabama argillacea (Rueb., e Anthonomus grandis Boh. Endosulfan foi seletivo em relação a Scymnus sp., Geocoris ventralis Thomazini e Doru lineare (Eschs no campo, com uma redução dos insetos inferior a 30%, e o Paration metílico não foi seletivo para C. sanguinea em laboratório.To assess the selectivity of insecticides to predator insects in cotton (Gossypium hirsutum L. crops two, trials, 1993-1994, under field and laboratory conditions were conducted. Under field conditions, the following treatments were compared: Fipronil 200 CS (75 g/ha of a.i.; Fipronil 800 WDG (64, 80 and 100 g/ha of a.i.; Endosulfan 350 EC (700 g/ha of a.i.; and control. Under laboratory conditions, in addition to Friponil, Methyl parathion 600 EC 480 g/ha of a.i. was also tested. Fipronil was selective to predators (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea and Doru lineare under field condition and to Cycloneda sanguinea (L. under laboratory conditions. This product can be used in integrated pest management programs in cotton crops to control Alabama argillacea (Rueb., and Anthonomus grandis Boh. Endosulfan was selective to Scymnus sp., Geocoris ventralis
Directory of Open Access Journals (Sweden)
Francisco das Chagas Vidal Neto
2005-02-01
Full Text Available Este trabalho teve como objetivo avaliar os efeitos de três características morfológicas mutantes de linhagens de algodoeiro herbáceo (Gossypium hirsutum L. r. latifolium Hutch., isoladas ou combinadas no mesmo genótipo, como fonte de resistência ao bicudo, Anthonomus grandis Boheman, 1843 (Coleoptera, Curculionidae. O experimento foi conduzido em campo, sob infestação natural, com delineamento de blocos ao acaso e arranjo fatorial 2´3 com um tratamento adicional, com quatro repetições. Em teste com chance de escolha, a característica bráctea frego foi a que apresentou maior redução no dano de oviposição pelo bicudo (34,71%, em relação ao equivalente normal. A folha "okra" reduziu o dano apenas quando associada à bráctea frego (40%. A combinação das três características mutantes na mesma planta proporcionou a menor porcentagem de botões com dano de oviposição (23,13%.This work aimed to evaluate the effects of three morphological mutants of upland cotton lines (Gossypium hirsutm L. r. latifolium Hutch., isolated or in combination in the same cotton genotype, as a source of resistance to boll weevil, Anthonomus grandis Boheman, 1843 (Coleoptera, Curculionidae. The experiment was carried out in the field, under natural infestation, with a completely randomized block design arranged in a factorial 2´3 plus an additional treatment, with four replications. In a multiple choice test, the character mutant frego bract presented the higher reduction on boll weevil oviposition damage (34.71%, in relation to the normal equivalent. The okra leaf reduced the boll weevil damage only when associated with frego bract (40%. The combination of the three mutant characters in the same plant presented the least square percent with oviposition damage (23.13%.
Directory of Open Access Journals (Sweden)
Ieda Maria Bortolotto
2005-06-01
Full Text Available Eichhornia crassipes (Mart. Solms, conhecida localmente como camalote, é uma planta aquática nativa da América do Sul, abundante no Pantanal. Os índios Guató usavam essa planta no Pantanal para a confecção de esteiras para dormir. Atualmente a comunidade não indígena do distrito de Albuquerque, Corumbá, MS, está fazendo artesanato com essa planta. O processo foi ensinado por uma índia Guató (74 anos que manteve a tradição de trançar o camalote. O uso do camalote para a confecção de artesanato é descrito aqui. O método utilizado inclui entrevistas semi-estruturadas e observação participante. A extração do camalote é feita nos rios, corixos e lagoas da região. As folhas são cortadas e somente os pecíolos são transportados para casa, lavados em água corrente e colocados para secar ao sol. Depois de secos os pecíolos são trançados e costurados. A técnica original dos Guató consiste em costurar o artesanato com linhas confeccionadas com algodão (Gossypium sp. ou tucum (Bactris sp., atualmente substituídos por fios de nylon, em Albuquerque. O artesanato é vendido aos turistas.Eichhornia crassipes (Mart. Solms, known locally as camalote, is an aquatic plant indigenous to South America, abundant in the Pantanal, Brazil. Guató Indians used it for making sleeping mats in the Pantanal. The non-Indian community of Albuquerque, Corumbá, MS, nowadays, is also using it for the same purposes. An ancient Guató Indian 74 years old taught the process. The use of the camalote for handicraft in Albuquerque is described here. The methods of investigation included both semi structured interviews and participant observations. The extraction of the camalote is made on the rivers, corixos and lagoons of the area. The leaf blades are cut and only petioles are carried to the houses, washed in clear water, and dried in the sun. After dried, the petioles are woven and sewed. The Guató original technique consists of sewing the craft
Directory of Open Access Journals (Sweden)
Fábio Suano de Souza
2007-04-01
Full Text Available A utilização de adubos pode-se tornar prejudicial caso o fertilizante não seja localizado adequadamente. No presente trabalho foram estudados o crescimento radicular do algodoeiro (Gossypium hirsutum, o crescimento inicial e a nutrição da planta, considerando o local de aplicação do fertilizante. O estudo foi realizado em vasos com parede de vidro. O fertilizante foi colocado a 5,0 cm abaixo e 0,0, 2,5, 5,0 e 10,0 cm ao lado das sementes. O crescimento radicular foi avaliado a cada três dias e, aos 21 dias após a emergência, as plantas foram coletadas, sendo avaliada a produção de matéria seca e a absorção de macronutrientes. A aplicação de fertilizante proporcionou crescimento inicial mais vigoroso do sistema radicular mesmo em solo previamente corrigido e adubado, o que é importante no estabelecimento da cultura. Somente houve bom crescimento inicial do sistema radicular e da parte aérea do algodoeiro quando o fertilizante foi aplicado de 5,0 a 10,0 cm ao lado e 5,0 cm abaixo das sementes.Unless fertilizer is properly placed in the soil it can be harmful. This experiment was conducted to study cotton (Gossypium hirsutum root growth and initial plant development and nutrition as affected by fertilizer placement. Cotton plants were grown in pots with a glass wall. The fertilizer was applied 5.0 cm under the seed row and 0, 2.5, 5.0 and 10.0 cm beside the seed row. Root growth was evaluated every 3 days, and 21 days after emergence the plants were harvested. Dry matter production and macronutrient absorption were evaluated. Even in previously limed and fertilized soil, localized fertilizer application reinforced the initial growth of cotton roots, which is very important for a good crop establishment in the field. Normal root growth and adequate initial plant development was only observed when the fertilizer was placed 5.0 cm below and from 5.0 to 10.0 cm distance from the seed row.
Desempenho fisiológico de sementes de algodão cultivadas em Luís Eduardo Magalhães, Bahia
Directory of Open Access Journals (Sweden)
R. T. C. Nunes
2015-11-01
Full Text Available O presente trabalho foi desenvolvido no laboratório de tecnologia de sementes da Universidade Estadual do Sudoeste da Bahia, Campus de Vitória da Conquista UESB, com objetivo de avaliar a qualidade fisiológica de sementes de algodão (Gossypium hirsutum L., utilizando-se cinco cultivares (DP 604, FM 993, BRS 368, TMG 642 e DELTA OPAL. As sementes foram submetidas aos seguintes testes: teor de água, peso de mil sementes, germinação, primeira contagem de germinação, índice de velocidade de emergência, emergência, comprimento da parte aérea, massa seca das plântulas e condutividade elétrica. O delineamento experimental utilizado foi o inteiramente casualizado, em quatro repetições de 50 sementes por tratamento. A cultivar TMG 642 demonstrou baixa qualidade fisiológica das sementes, quando comparados com as cultivares DP 604, FM 993, BRS 368, e DELTA OPAL. Os testes de germinação, condutividade elétrica e índice de velocidade de germinação mostraram eficiência na separação de cultivares de sementes de algodão em níveis de vigor. Physiological performance of cottonseed grown in Luís Eduardo Magalhães, BahiaABSTRACT: This study was conducted at the State University of seed technology laboratory of Southwest Bahia, Campus Victory Conquest, UESB, to evaluate the physiological quality of cotton seeds (Gossypium hirsutum L., using five cultivars (DP 604, FM 993, BRS 368, GMT 642 and DELTA OPAL. Seeds were subjected to the following tests: water content, weight of a thousand seeds, germination, first count, emergence speed index, emergency, shoot length, dry mass of seedlings and electrical conductivity. The experimental design was completely randomized, with four replications of 50 seeds per treatment. The cultivar TMG 642 demonstrated low physiological seed quality when compared with the DP 604 cultivars, FM 993, BRS 368, and DELTA OPAL. Germination tests, electrical conductivity and germination rate index showed efficiency
Directory of Open Access Journals (Sweden)
Francisco Assis de Oliveira
1999-12-01
Full Text Available Objetivou-se estudar, num solo aluvial, franco siltoso, no vale do Açu, no Rio Grande do Norte, o efeito do momento da última irrigação e da população de plantas sobre a altura das plantas e a produtividade do algodoeiro herbáceo (Gossypium hirsutum L.r. latifolium Hutch, cultivar Acala del cerro. Os tratamentos foram definidos pelos momentos da última irrigação aos 65, 80, 95 e 110 dias após a emergência e pela população com 30.000, 60.000, 90.000 e 120.000 plantas/ha. Usou-se o delineamento experimental em blocos ao acaso, com parcelas subdivididas, e quatro repetições. A altura das plantas aumentou com o retardamento da última irrigação e com o tamanho das populações. Houve efeito (P In an alluvial soil, silt loam, of Açu valley, in the state of Rio Grande do Norte, Brazil, a research was carried out to study the effect of time of the last irrigation and plant population on yield and plant height of the herbaceous cotton (Gossypium hirsutum L.r. latifolium Hutch cultivar Acala del cerro. Treatments consisted of times of the last irrigation at 65, 80, 95 and 110 days after emergence and populations with 30,000, 60,000, 90,000 and 120,000 plants/ha. The experimental plan was a randomized complete blocks in a split-plot design, with four replications. Delaying time of last irrigation increased height and plant populations. A significant effect (P <= 0.01 of interaction between time of last irrigation and plant population was found for cotton yield. The highest cotton yield (4,090 kg/ha was obtained with the interaction between time of last irrigation at 95 days and in population of 90,000 plants/ha. Irrigation times at 65 and 80 days were considered too early, and at 110 days too late for cotton yields.
Directory of Open Access Journals (Sweden)
Marta Suely Madruga
2008-08-01
Full Text Available Esta pesquisa foi realizada com o objetivo de avaliar o efeito da inclusão (0, 20, 30 e 40% de caroço de algodão integral (Gossypium hirsutum na dieta sobre a composição química e o perfil de ácidos graxos da carne de cordeiros Santa Inês. Foram utilizados 24 cordeiros machos não-castrados (peso corporal inicial de 19,0 ± 0,2 kg e 4 meses de idade, todos criados em regime de confinamento em baias individuais. Os níveis de caroço de algodão integral não afetaram a composição centesimal e os percentuais de colesterol e fosfolipídios da carne ovina. Entretanto, houve diferença entre os percentuais dos ácidos graxos mirístico, palmítico e linolênico e entre a relação C18:0 + C18:1 / C16:0. Do ponto de vista nutricional, a utilização de caroço de algodão integral na dieta pode ser recomendada, durante períodos curtos, em níveis de até 40% para ovinos em terminação. Ressalta-se que o caroço de algodão integral é um subproduto economicamente viável por apresentar baixo custo de produção em comparação ao milho e à soja.The objective of this research was to evaluate the effect of inclusion (0, 20, 30 and 40% of whole cottonseed (Gossypium hirsutum in the diet on chemical composition and fatty acids profile of Santa Inez sheep meat. Twenty four no castrated male sheep were used, (initial 19.0 ± 0.2 kg BW and 4 month old, all kept in confinement regime in individual stalls. The levels of whole cottonseed did not affect chemical composition and the percentages of cholesterol and phospholipids of the lamb meat. However, there was difference among the percentages of the miristic, palmitic and linolenic fatty acids and also to the relationship C18:0 + C18:1 / C16:0. At nutritional point of view, the utilization of whole cottonseed could be recommended, during short periods, up to the level of 40% for finishing animals. In addition, whole cottonseed is a by-product economically viable for presenting low production cost
Directory of Open Access Journals (Sweden)
G.S. Miranda
2013-01-01
Full Text Available Neste trabalho foi realizada a caracterização fitoquímica e avaliada a atividade antibacteriana in vitro dos extratos de Ageratum conyzoides L. (mentrasto, Gossypium hirsutum (algodão, Phyllanthus tenellus (quebra pedra, e Polygonum hydropiperoides (erva de bicho frente à Staphylococcus aureus e Escherichia coli. Para a avaliação da atividade antibacteriana foi utilizado o método de difusão em ágar. Os testes foram realizados com o extrato nas graduações alcoólicas de 0 a 100% (v/v, na proporção de 20% (m/v - massa/extrator. Os testes fitoquímicos constataram a presença de açucares redutores, compostos fenólicos, flavonoides, taninos, triterpenos, e esteróides nas quatro espécies. O crescimento das culturas de S. aureus foi inibido por todos os extratos, com exceção do extrato de Mentrasto. A maior atividade de inibição foi observada pelo extrato de quebra pedra. Entretanto, nenhum dos extratos foi capaz de inibir o crescimento das cepas de E. coli. Os resultados são promissores, visto que três das quatro plantas selecionadas demonstraram possuir substâncias antibacterianas, o que motiva estudos subsequentes para o isolamento e identificação dos princípios ativos responsáveis por essa atividade, com potencial de uso na indústria farmacêutica.In this study, phytochemical characterization was conducted and the in vitro antibacterial activity of extracts of Ageratum conyzoides L. (whiteweed, Gossypium hirsutum (cotton, Phyllanthus tenellus (shatterstone and Polygonum hydropiperoides (swamp smartweed was evaluated against Staphylococcus aureus and Escherichia coli. To assess the antibacterial activity, the agar diffusion method was used. Tests were performed with the extract at alcoholic contents from 0 to 100% (v/v, at 20% proportion (m/v - mass/extractor. Phytochemical tests indicated the presence of reducing sugars, phenolic compounds, flavonoids, tannins, triterpenes and steroids in all four species. The growth
Directory of Open Access Journals (Sweden)
Marco Antonio Camillo de Carvalho
2004-12-01
Full Text Available A adoção de sistemas de manejo conservacionistas e a sucessão de culturas com adubos verdes são práticas que visam preservar a qualidade do solo e do ambiente, sem prescindir da obtenção de produtividade elevada das culturas de interesse econômico. O objetivo deste trabalho foi avaliar os efeitos de sistemas de manejo do solo e adubos verdes na produtividade do algodoeiro (Gossypium hirsutum L.. O experimento foi realizado num Latossolo Vermelho distrófico, originalmente sob vegetação de Cerrado. O delineamento utilizado foi o de blocos ao acaso, em esquema de parcela subdividida e quatro repetições. Nas parcelas, utilizaram-se quatro adubos verdes: mucuna-preta, guandu, crotalária e milheto, e área de pousio (vegetação espontânea. Nas subparcelas foram adotados dois sistemas de manejo do solo: plantio direto e preparo convencional (uma gradagem pesada + duas gradagens leves. Os sistemas de manejo do solo não interferiram na produtividade do algodoeiro. O algodoeiro apresentou produtividade semelhante quando cultivado em sucessão a diferentes espécies de adubos verdes, no sistema de plantio direto e convencional de preparo do solo.The adoption of conservation management system and succession of crops after green manures aim at preserving the environment and soil quality, without dispensing the largest cash crop yield. The objective of this work was to evaluate the effects of soil management systems and green manures on cotton yield (Gossypium hirsutum L.. The experiment was carried out in a Typic Hapludox, covered by Savannah vegetation. The experimental design used was that of randomized blocks, in a split plot scheme, with four replications. In plots, four green manures were used: black velvet bean, pigeon pea, sunn hemp, millet and fallow area (spontaneous vegetation. In subplots, two managament soil systems were used: no-tillage and conventional tillage (one disk harrow + two levelling harrow. Soil management systems do
Estudo de caso de três espécies de plantas bioindicadoras de solos salinos
Directory of Open Access Journals (Sweden)
Mercia Fonseca Carvalho
2015-07-01
Full Text Available Bioindicadores, de uma maneira geral, são seres vivos de natureza diversa, vegetais ou animais, utilizados para analisar a qualidade de um determinado ambiente. A degradação ambiental do solo pela salinidade é um problema muito antigo e de extensão mundial, geralmente, mais pronunciado nas regiões áridas e semi-áridas. As plantas que se desenvolvem em áreas com elevadas concentrações de sais são chamadas de halófitas, e algumas delas são usadas na recuperar desses solos. O objetivo desse trabalho é analisar três espécies de plantas resistentes ao estresse salino gerar recomendações a respeito das mesmas, disponibilizando uma indicação de espécie que possa recuperar o ambiente salinizado. Foram selecionadas aleatoriamente três espécies de plantas resistentes a salinidade Copernicia prunifera, Atriplex nummularia L. e Gossypium hirsutum L, as mesmas foram analisados por uma planilha com características que identificam um bioindicador ideal e em seguida as espécies foram avaliadas de acordo com sua fisiologia e etiologia. Embora as propriedades da espécie A. nummularia tenha se destacado por recuperar os solos salinizados a espécie Copernicia prunifera foi considerada como um bioindicador ideal. Recomendam-se ainda estudos mais aprofundados acerca desse assunto.Case study of three species of saline soil bioindicatorsAbstract: Bioindicators, in general, living organisms are diverse in nature, plant or animal used to assess the quality of a given environment. Environmental degradation by soil salinity is a very old problem and expanse world generally more pronounced in arid and semi-arid regions. Plants that thrive in areas with high concentrations of salts are called halophytes, and some of them are used in recovering these soils. The aim of this work is to analyze three species of plants resistant to salt stress generate recommendations regarding the same, providing an indication of species that can restore the
Directory of Open Access Journals (Sweden)
Francisco Assis de Oliveira
1999-10-01
Full Text Available A field experiment was conducted during two years, 1990/91, in an alluvial soil, in the State of Paraíba, Brazil, to study the effect of the levels of soil-water tension, 50, 100, 200, 300, 400 and 600 kPa, at 20 cm depth, on upland cotton (Gossypium hirsutum L.r. latifolium Hutch, cv. CNPA-6H yield. The experimental design was a complete randomized block with six treatments and four repetitions. There was an effect of the treatments on plant height, leaf area index and cotton yield, but the precocity index was not modified. Water should be applied when the soil-water tension, measured at 20 cm depth, reaches values around 200 kPa. There was a quadratic (R² = 0.893** response of cotton yields to soil water tension, with the maximum when water was applied at 52% of soil water depletion.Durante dois anos, 1990/91, em solo aluvial, no município de Sousa, PB, estudou-se, em condições de irrigação por sulco, o efeito das tensões de água no solo a 50, 100, 200, 300, 400 e 600 kPa, na profundidade de 20 cm, sobre o rendimento do algodoeiro herbáceo (Gossypium hirsutum L.r. latifolium Hutch, cv. CNPA-6H. Adotou-se o delineamento experimental de blocos ao acaso com quatro repetições. Os resultados mostraram que houve efeito significativo dos tratamentos sobre a altura da planta, índice de área foliar e rendimento de algodão em rama, mas não houve efeito sobre os dados de precocidade. A tensão de 200 kPa mostrou-se como o melhor nível de água no solo para se efetuar as irrigações, uma vez que para as tensões superiores o rendimento foi significativamente reduzido.O efeito sobre o rendimento foi de natureza quadrática (R² = 0,893**, o que indica que o rendimento máximo seria atingido irrigando-se a cultura com 52% de esgotamento da água disponível no solo.
Differential potassium influx influences growth of two cotton varieties in hydroponics
International Nuclear Information System (INIS)
Ali, L.; Maqsood, M.A.; Kanwal, S.; Aziz, T.
2010-01-01
Potassium uptake rate of two cotton (Gossypium hirsutum L.) varieties viz., NIBGE-2 and MNH-786 was investigated in nutrient solution culture having deficient K at the rate 0.3 mM and deficient K+ Na at the rate 0.3 +2.7 mM. Depletion of K from solution was monitored over a period of 24 h at regular time intervals after 0, 0.5, 1.0, 1.5, 2, 3, 4, 5, 6, 8, 10, 12 and 24 h to estimate K uptake kinetics of the roots i.e. maximum influx, I/sub max/ and the Michaelis-Menten constant, Km. NIBGE-2 had about 2-fold higher (2.0 mg g rdw-1 hr-1) I/sub max/ value for K uptake rate at deficient K+Na than that (1.207 mg g rdw-1 hr-1) for MNH-786. Higher, Michaelis-Menten constant, Km (12.82 ppm) for K uptake rate was observed in both cultivars NIBGE-2 and MNH-786 at deficient K+Na than that at deficient K. Main effects of treatments and varieties had significant (p< 0.05) effect on shoot dry matter, root dry matter, total dry matter and leaf area per plant. Maximum K influx in NIBGE-2 at deficient K and deficient K +Na was attributed to enhanced growth response as compared to that in MNH-786. (author)
Carbon partitioning and export from mature cotton leaves
International Nuclear Information System (INIS)
Hendrix, D.L.; Grange, R.I.
1991-01-01
The partitioning of carbon in intact, mature cotton (Gossypium hirsutum L.) leaves was examined by steady-state 14 CO 2 labeling. Plants were exposed to dark periods of varying lengths, followed by similar illuminated labeling periods. These treatments produced leaves with a range of starch and soluble sugar contents, carbon exchange, and carbon export rates. Export during the illuminated periods was neither highly correlated with photosynthesis nor was export during the illuminated periods significantly different among the treatments. In contrast, the rate of subsequent nocturnal carbon export from these leaves varied widely and was found to be highly correlated with leaf starch content at the end of the illumination period and with nocturnal leaf respiration. Leaves which had accumulated the highest levels of starch (about 275 micrograms per square centimeter) by the end of the illumination period exhibited nocturnal export rates very similar to those during the daylight hours. Leaves which accumulated starch to only 50 to 75 micrograms per square centimeter virtually ceased nocturnal carbon export. For leaves with starch accumulations of between 50 and 275 micrograms per square centimeter, nocturnal export was directly proportional to leaf starch at the end of the illumination period. After the nocturnal export rate was established, it continued at a constant rate throughout the night even though leaf starch and sucrose contents declined
Genetic and epigenetic status of triple exotic consanguinity cotton introgression lines.
He, S P; Sun, J L; Du, X M
2011-10-03
Introgression lines are some of the most important germplasm for breeding applications and other research conducted on cotton crops. The DNA methylation level among 10 introgression lines of cotton (Gossypium hirsutum) and three exotic parental species (G. arboreum, G. thurberi and G. barbadense) were assessed by methylation-sensitive amplified polymorphism (MSAP) technology. The methylation level in the introgression lines ranged from 33.3 to 51.5%. However, the lines PD0111 and PD0113 had the lowest methylation level (34.6 and 33.3%, respectively) due to demethylation of most non-coding sequences. Amplified fragment length polymorphism (AFLP) was used to evaluate the genetic polymorphism in the cotton introgression lines. A high degree of polymorphism was observed in all introgression lines (mean 47.2%) based on AFLP and MSAP analyses. This confirmed the effects of genetic improvement on cotton introgression lines. The low methylation varieties, PD0111 and PD0113 (introgression lines), clustered outside of the introgression lines based on MSAP data, which was incongruent with an AFLP-based dendrogram. This phenomenon could be caused by environmental changes or introgression of exotic DNA fragments.
Screening cotton genotypes for seedling drought tolerance
Directory of Open Access Journals (Sweden)
Penna Julio C. Viglioni
1998-01-01
Full Text Available The objectives of this study were to adapt a screening method previously used to assess seedling drought tolerance in cereals for use in cotton (Gossypium hirsutum L. and to identify tolerant accessions among a wide range of genotypes. Ninety genotypes were screened in seven growth chamber experiments. Fifteen-day-old seedlings were subjected to four 4-day drought cycles, and plant survival was evaluated after each cycle. Three cycles are probably the minimum required in cotton work. Significant differences (at the 0.05 level or lower among entries were obtained in four of the seven experiments. A "confirmation test" with entries previously evaluated as "tolerant" (high survival and "susceptible" (low survival was run. A number of entries duplicated their earlier performance, but others did not, which indicates the need to reevaluate selections. Germplasms considered tolerant included: `IAC-13-1', `IAC-RM4-SM5', `Minas Sertaneja', `Acala 1517E-1' and `4521'. In general, the technique is simple, though time-consuming, with practical value for screening a large number of genotypes. Results from the screening tests generally agreed with field information. The screening procedure is suitable to select tolerant accessions from among a large number of entries in germplasm collections as a preliminary step in breeding for drought tolerance. This research also demonstrated the need to characterize the internal lack of uniformity in growth chambers to allow for adequate designs of experiments.
Response of cotton varieties to different environments: flowering behavior and fiber quality
International Nuclear Information System (INIS)
Jawdat, D.; Ayyoub, Z.; Elias, R.
2012-01-01
Flowering behavior and fiber quality traits were analyzed of six Gossypium hirsutum L. varieties and one G. barbadense variety that were cultivated in two environmentally different locations. Records of days after planting (DAP) at first floral bud emergence, DAP at first floral opening, plant height at first flower and nodes above white flower (NAWF) were analyzed statistically to study flowering behavior in both locations. Fiber traits were tested and records of micronaire, fiber length, strength, cohesion, elongation, ginning percentage, and weight of seed cotton were statistically analyzed to look for significant differences and correlations. Earliness and a decline in fiber strength, and fiber cohesion were obtained in varieties cultivated in Soujeh accompanied with an increase in ginning percentages. Uniquely, fiber elongation showed no significant differences in varieties between the two environments in both seasons. Our results indicated that stability in some fiber traits such as, micronaire, fiber length, strength and cohesion was a variety specific. Evidently, fiber elongation in our work was not affected by cultivation managements and environmental conditions which suggest the solid genetic bases that control this trait. (author)
Directory of Open Access Journals (Sweden)
A. I. A. Pereira
Full Text Available Abstract Sexual choice by male stink bugs is important because females that experience food shortages lay fewer eggs with lower viability compared with well-fed females. In this study, we investigated whether Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae males fed with a low-quality diet during its nymphal stage show selectivity for sexual partners resulting in high-quality progeny. Lightweight males and females were obtained from nymphs fed weekly with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae. By contrast, heavyweight males and females were fed three times a week and received an extra nutritional source: cotton leaves, Gossypium hirsutum L. (Malvaceae. Lightweight males preferred to mate with heavy females (77.78 ± 14.69%, whereas heavyweight males did not discriminated between light or heavyweight females. Females mated with lightweight males showed similar levels of reproduction to those mated with heavyweight males. The results provide an indication of the importance of male and female body weight for sexual selection in Asopinae stink bugs.
Analysis of flavonoids and the flavonoid structural genes in brown fiber of upland cotton.
Directory of Open Access Journals (Sweden)
Hongjie Feng
Full Text Available BACKGROUND: As a result of changing consumer preferences, cotton (Gossypium Hirsutum L. from varieties with naturally colored fibers is becoming increasingly sought after in the textile industry. The molecular mechanisms leading to colored fiber development are still largely unknown, although it is expected that the color is derived from flavanoids. EXPERIMENTAL DESIGN: Firstly, four key genes of the flavonoid biosynthetic pathway in cotton (GhC4H, GhCHS, GhF3'H, and GhF3'5'H were cloned and studied their expression profiles during the development of brown- and white cotton fibers by QRT-PCR. And then, the concentrations of four components of the flavonoid biosynthetic pathway, naringenin, quercetin, kaempferol and myricetin in brown- and white fibers were analyzed at different developmental stages by HPLC. RESULT: The predicted proteins of the four flavonoid structural genes corresponding to these genes exhibit strong sequence similarity to their counterparts in various plant species. Transcript levels for all four genes were considerably higher in developing brown fibers than in white fibers from a near isogenic line (NIL. The contents of four flavonoids (naringenin, quercetin, kaempferol and myricetin were significantly higher in brown than in white fibers and corresponding to the biosynthetic gene expression levels. CONCLUSIONS: Flavonoid structural gene expression and flavonoid metabolism are important in the development of pigmentation in brown cotton fibers.
Directory of Open Access Journals (Sweden)
Felipe eBorrero-Echeverry
2015-06-01
Full Text Available The insect olfactory system discriminates odor signals of different biological relevance, which drive innate behavior. Identification of stimuli that trigger upwind flight attraction towards host plants is a current challenge, and is essential in developing new, sustainable plant protection methods, and for furthering our understanding of plant-insect interactions. Using behavioral, analytical and electrophysiological studies, we here show that both females and males of the Egyptian cotton leafworm, Spodoptera littoralis (Lepidoptera, Noctuidae, use blends of volatile compounds to locate their host plant, cotton, Gossypium hirsutum (Malvales, Malvaceae. Female S. littoralis were engaged in upwind orientation flight in a wind tunnel when headspace collected from cotton plants was delivered through a piezoelectric sprayer. Although males took off towards cotton headspace significantly fewer males than females flew upwind towards the sprayed headspace. Subsequent assays with antennally active synthetic compounds revealed that a blend of nonanal, (Z-3 hexenyl acetate, (E-β-ocimene, and (R-(+-limonene was as attractive as cotton headspace to females and more attractive to males. DMNT and (R-(--linalool, both known plant defense compounds may have reduced the flight attraction of both females and males; more moths were attracted to blends without these two compounds. Our findings provide a platform for further investigations on host plant signals mediating innate behavior, and for the development of novel insect plant protection strategies against S. littoralis.
Liu, Xiufang; Song, Yunzhi; Xing, Fangyu; Wang, Ning; Wen, Fujiang; Zhu, Changxiang
2016-09-01
WRKY transcription factors are involved in various processes, ranging from plant growth to abiotic and biotic stress responses. Group I WRKY members have been rarely reported compared with group II or III members, particularly in cotton (Gossypium hirsutum). In this study, a group I WRKY gene, namely, GhWRKY25, was cloned from cotton and characterized. Expression analysis revealed that GhWRKY25 can be induced or deduced by the treatments of abiotic stresses and multiple defense-related signaling molecules. Overexpression of GhWRKY25 in Nicotiana benthamiana reduced plant tolerance to drought stress but enhanced tolerance to salt stress. Moreover, more MDA and ROS accumulated in transgenic plants after drought treatment with lower activities of SOD, POD, and CAT. Our study further demonstrated that GhWRKY25 overexpression in plants enhanced sensitivity to the fungal pathogen Botrytis cinerea by reducing the expression of SA or ET signaling related genes and inducing the expression of genes involved in the JA signaling pathway. These results indicated that GhWRKY25 plays negative or positive roles in response to abiotic stresses, and the reduced pathogen resistance may be related to the crosstalk of the SA and JA/ET signaling pathways.
Directory of Open Access Journals (Sweden)
Xiaoqian Chu
Full Text Available WRKY transcription factors constitute a very large family of proteins in plants and participate in modulating plant biological processes, such as growth, development and stress responses. However, the exact roles of WRKY proteins are unclear, particularly in non-model plants. In this study, Gossypium hirsutum WRKY41 (GhWRKY41 was isolated and transformed into Nicotiana benthamiana. Our results showed that overexpression of GhWRKY41 enhanced the drought and salt stress tolerance of transgenic Nicotiana benthamiana. The transgenic plants exhibited lower malondialdehyde content and higher antioxidant enzyme activity, and the expression of antioxidant genes was upregulated in transgenic plants exposed to osmotic stress. A β-glucuronidase (GUS staining assay showed that GhWRKY41 was highly expressed in the stomata when plants were exposed to osmotic stress, and plants overexpressing GhWRKY41 exhibited enhanced stomatal closure when they were exposed to osmotic stress. Taken together, our findings demonstrate that GhWRKY41 may enhance plant tolerance to stress by functioning as a positive regulator of stoma closure and by regulating reactive oxygen species (ROS scavenging and the expression of antioxidant genes.
Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B
2015-01-01
Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.