Poliitikud avaldavad muret / Kalev Kallemets
Kallemets, Kalev, 1979-
2002-01-01
Reformierakonna noortekogu peasekretär Kalev Kallemets lubas tudengitele, et Reformierakonna noortekogu võtab erakonna juhatuse koosolekul tõsiselt arutlusele Riigikogu otsuse lugeda kuni 24-aastased tudengid toimetulekutoetuste arvestamisel oma vanemate ülalpeetavateks /vahendas Alo Lõhmus
Mark Kostabi soovib muuta inimesi õnnelikumaks / Kalev Mark Kostabi
Kostabi, Kalev Mark, 1960-
2008-01-01
Kalev Mark Kostabi oma sisekujunduslikest eelistustest, ameeriklaste ja itaallaste kodude sisekujunduse erinevustest, kunstist kui ruumikujunduse ühest osast, oma New Yorgi ja Rooma korterite kujundusest
Spordiseltsi "Kalev" õigusjärglus küsimärgi all / Tea Kurvits
Kurvits, Tea, 1950-
2000-01-01
Moskvas asutati 1944. aastal ametiühingute vabatahtlik spordiühing "Kalev". Eestis loodi 1901. aastal Tallinna Jalgrattasõitjate Selts "Kalev". Kelle järglane on praegune spordiselts "Kalev"? Ka spordiseltsi ajalugu käsitleva Ruudi Toomsalu raamatu "Möödunut meenutades" kirjastamisest
Suhkur võib Kalev RECi aktsiad aastaiks külmutada / Kaisa Tahlfeld, Mariliis Pinn
Tahlfeld, Kaisa
2008-01-01
Tallinna halduskohus andis maksu- ja tolliametile õiguse blokeerida 40% AS-ile Kalev kuuluvatest AS-i Kalev Real Estate Company aktsiatest, et tagada kohustuste täitmine pärast laovaruvaidluse lõppu. Kommenteerib Ott Karolin. Lisa: Kalev REC
Uku ja Eha Masing - õiglased rahvaste hulgas / Hele Israel
Israel, Hele
2009-01-01
Holokausti keskuses Yad Vashem on juute aidanud inimestele pühendatud mälestustahvlid. Inimesi, kes holokausti käigus aitasid juute, nimetatakse õiglased rahvaste hulgas, kelle hulka kuuluvad ka Uku ja Eha Masing
Telemedicine networks of EHAS Foundation in Latin America
Directory of Open Access Journals (Sweden)
Ignacio ePrieto-Egido
2014-10-01
Full Text Available Rural areas in developing countries are characterized by lack of resources, low population density and scarcity of communications infrastructure. These circumstances make it difficult to provide appropriate healthcare services. This paper explains research results achieved by EHAS (Enlace Hispano Americano de Salud - Hispano American Health Link and how they have contributed to improve healthcare in isolated areas of developing countries through the use of Information and Communication Technologies (ICT. As the first step, EHAS always collaborates with public health systems to identify its communication and information needs. Based on the analysis of needs, EHAS does research on appropriate technologies to provide communication in each context and on information systems suited to needs of health personnel. In parallel, EHAS has worked to provide applications that, making use of the communications services installed, could improve the healthcare services in these remote areas. In this line, solutions to improve epidemiological surveillance or to provide telemedicine services (like a digital stethoscope or a tele-microscopy system have been developed. EHAS has also performed several researches trying to ensure the sustainability of their solutions and has summarized them in a Management Framework for Sustainable e-Healthcare Provision. Finally, the effort to spread acquired knowledge has crystallized in a book that details all the technologies and procedures previously mentioned.
"Kalev" izbavilsja ot pishtshevõhh "dobavok" / Hilda Vall
Vall, Hilda
2007-01-01
Ärimees Oliver Kruuda teatas oma piimatööstuse Tere ja kondiitritööstuse Kalev müügist Eesti investeerimisfirmale Alta Capital Partners, põhjendades oma otsust sooviga edaspidi tegutseda kinnisvara ja meedia vallas
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 8.m00410 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, pu...tative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available coideum (Slime mold). Wiscott-aldrich ... syndrome protein gb|EAL71043.1| hypothetical protein ... ... EHA1 4.m00692 >1ceeB 8 59 36 87 3e-13 ... gb|AAS38848.1| similar to Dictyostelium dis
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 81.m00161 >1n7sA 2 63 15 76 7e-16 ... gb|AAC46892.1| similar to synaptobrevin; Method: concept...ual translation supplied ... by author gb|AAC46891.1| similar to synaptobrevin; ... Method: concept
Kuimet, Paul, 1984-
2016-01-01
Paul Kuimet, Dénes Kalev Farkas ja Laura Kuusk räägivad, kuidas valmisid nende kunstnikuraamatud ja mis oli projekti tõukejõuks. Paul Kuimeti fotoraamat "In Vicinity", Dénes Kalev Farkasi raamatud "Evident in Advance" ja "Credo", Laura Kuuse raamat "Pop-up-book"
2008-01-01
Ülikooli ja seal õpetatavaid erialasid tutvustavad dotsent Leif Kalev, kunstimagistrant Anneli Leinpere, professor Tiit Land, välisüliõpilane Milanost Alessandro Centonze, vanemteadur Hannes Palang ning kirjaliku tõlke magistrant Liis Kelberg
Kaks kuud Kalev SPA-s / kommenteerinud Julia Kurbat, Natalia Nazarenko-Kiivikas, Margit Lipstuhl
2012-01-01
Kahe spordiharrastaja Kaur Sau ja Kadri Sõggeli seatud eesmärkidest 2012. aastal ja kehalisest arengust treenides kaks kuud mõnes Tallinna spordiklubis. Treeningutest Kalev Spa Hotel & Water Park'i nimekandvas spordi- ja vabaajakeskuses
2009-01-01
Artikkel toetub Saksamaal pagulaseestlaste hulgas läbi viidud uurimusele, mille eesmärgiks oli intervjuude kaudu saada pagulaseestlaste kogemuslik tagasivaade eesti rahvatantsurühmade tekkimisele ja arengule ning seda mõjutanud teguritele Saksamaa Liitvabariigis pärast Teist maailmasõda
Mälestused minu elust / Ferdinand Johann Wiedemann ; tõlk. Kalev Jaago
Wiedemann, Ferdinand Johann
2000-01-01
Järg Sep/21;23;26;28;30 Oct/3;5;7;10;12;14 Ferdinand Johann Wiedemanni (1805-1887) mälestuste saksakeelne algkäsikiri aastast 1878 asub Eesti Ajaloomuuseumis Otto Greifenhageni fondis nr. 65, säilik 6. Kommentaar: Kalev Jaago
Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.
2009-01-01
Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann
Valgas võtab maavanema ameti üle Kalev Härk / Maria-Elisa Rannajõe
Rannajõe, Maria-Elisa
2007-01-01
Valga maavanema kohusetäitjaks saab maavalitsuse arengu- ja planeeringuosakonna juhataja Kalev Härk, praegu maavanema kohuseid täitev Tõnis Lass läheb puhkusele. Valga maavanem Georg Trashanov on kriminaalmenetluse ajaks töökohalt kõrvaldatud
Reimer, Andres
2007-01-01
Kalevi ja Tere toiduainetööstusettevõtete müügist investeerimisfirmale Alta Capital Partners. Vt. samas: Alta Capital Partners; Holger Roonemaa, Kristjan Jõevere. Finantsinspektsioon: Kalev rikkus head tava
High Voltage EEE Parts for EMA/EHA Applications on Manned Launch Vehicles
Griffin, Trent; Young, David
2011-01-01
The objective of this paper is an assessment of high voltage electronic components required for high horsepower electric thrust vector control (TVC) systems for human spaceflight launch critical application. The scope consists of creating of a database of available Grade 1 electrical, electronic and electromechanical (EEE) parts suited to this application, a qualification path for potential non-Grade 1 EEE parts that could be used in these designs, and pathfinder testing to validate aspects of the proposed qualification plan. Advances in the state of the art in high power electric power systems enable high horsepower electric actuators, such as the electromechnical actuator (EMA) and the electro-hydrostatic actuator (EHA), to be used in launch vehicle TVC systems, dramaticly reducing weight, complexity and operating costs. Designs typically use high voltage insulated gate bipolar transistors (HV-IGBT). However, no Grade 1 HV-IGBT exists and it is unlikely that market factors alone will produce such high quality parts. Furthermore, the perception of risk, the lack of qualification methodoloy, the absence of manned space flight heritage and other barriers impede the adoption of commercial grade parts onto the critical path. The method of approach is to identify high voltage electronic component types and key parameters for parts currently used in high horsepower EMA/EHA applications, to search for higher quality substitutes and custom manufacturers, to create a database for these parts, and then to explore ways to qualify these parts for use in human spaceflight launch critical application, including grossly derating and possibly treating hybrid parts as modules. This effort is ongoing, but results thus far include identification of over 60 HV-IGBT from four manufacturers, including some with a high reliability process flow. Voltage ranges for HV-IGBT have been identified, as has screening tests used to characterize HV-IGBT. BSI BS ISO 21350 Space systems Off
2006-01-01
Oma seisukohtadest Tallinnas Tõnismäel asuva Teise maailmasõja mälestusmärgi suhtes räägivad isamaaliitlane Kalev Rebane ja vene noorteühenduse Notshnoi Dozor juhid Roman Zharov, Aleksandr Korobov, Oleg Filippov ja Igor Rogo
Karro,Kadri
2011-01-01
Briti kunstniku Richard Hamiltoni (1922 - 2011) loomingust eesti kunstiteadlaste Eha Komissarovi, Sirje Helme ja Jaak Kangilaski pilgu läbi. Lähemalt 1956. aastal valminud kollaažist "Mis teeb tänapäeva kodud nii eriliseks, nii meeldivaks?"
Фабрику Kalev продают норвежской фирме / Андрус Карнау, Райго Неудорф
Карнау, Андрус
2010-01-01
AS-i Kalev Chocolate Factory osta sooviv Orkla kontrerni esindajate kinnitusel hakatakse edaspidi toodangut eksportima nii Balti- kui Põhjamaadesse. Enne varade üleminekut uuele omanikule tuleb ära oodata Kalevi aktsiate aresti alt vabanemine
Põhjala fotomuuseumis / Eha Vain
Vain, Eha
1999-01-01
22. apr.-st Tallinna raevangla Fotomuuseumis fotonäitus "Põhjala saared". Fotograafid Göte Ask Gotlandilt, Absalon Hansen Fääri saartelt ja Andy Horner Ahvenamaalt tutvustavad oma töödes kodusaarte loodust; Tartu kunstikooli fototudengid Eesti saarte inimesi ja nende eluolu.
Toetame Valgevenet / Kalev Kallemets
Kallemets, Kalev, 1979-
2006-01-01
Autor arvab, et demokraatia võiduletulekule Valgevenes aitaks kaasa Aleksandr Lukashenko mitte tunnustamine Valgevene presidendina, samuti tuleks toetada moraalselt ja aineliselt Valgevene opositsiooni. Valgevene majanduslik ning poliitiline toetamine Venemaa poolt tuleks muuta võimalikult ebemugavaks
Põgenemine Egiptusest / Kalev Vilgats
Vilgats, Kalev
2005-01-01
Terrorirünnakust Sharm el-Sheikhi luksushotellis Chazala Gardens'is, vastutusevõtjaks on end nimetanud nii rühmitus "Egiptuse Modzhaeedid" (Egiptuse Pühad Sõdalased) kui ka Abdullah Azzami Brigaad
Slater, Stephanie; Slater, Timothy F.; Baybayan, Kalepa C.
2016-01-01
This paper documents the complete modern Hawaiian navigational full-sky. Over eight years of field notes, observations, and interviews with cultural leaders, historians, and ho`okele wa`a (navigators) were used to construct and validate Kilohoku Ho`okele Wa`a, the Astronomy of the Hawaiian Navigators. In contrast to the various historical sky maps designed by different practitioners and local groups in pre-colonial times, this sky-map depicts the four whole-sky constellations used by present day wayfinders. Designed by a loosely bound group of cultural leaders and navigators as a tool to use in modern non-instrumental navigation, Kilohoku Ho`okele Wa`a is a pragmatic fusion of ancient Hawaiian tradition, traditions of greater Polynesia, and modern-day Indigenous cultural forces. Like a very small number of cultures who use the sky for non-instrumental navigation, the ho`okele wa`a conceive of each season's visible sky as a whole image, using a single constellation that stretches from the northern to the southern horizon as a tool that facilitates direction finding in skies that are often very cloudy, and that chunks the sky into sections that decrease the cognitive load placed on the navigator. Moving through the seasons, beginning in Winter, Na `Ohana Hoku `Eha (The Four Star Families) are Kekaomakali`I (The Bailer), Kaiwikuamo`o (The Backbone), Manaiakalani (The Fishhook), and Kalupekawelo (The Kite). The whole-sky character of each of the four "star families," combines with that star family's mo`olelo (purposeful story) to further facilitate navigation, employing the emotional component of moral and familial associations to enhance memorization and to provide wayfinders with encouragement on their long journeys.
Kaks Mari Vaalas / Eha Komissarov
Komissarov, Eha, 1947-
1999-01-01
9. nov.-st galeriis 'Vaal' Mari Roosvaldi maalinäitus 'Persoon'; 10. nov.-st galerii keldrisaalis Mari Kurismaa 'Matemaatika ja metafüüsika'. Mari Roosvaldi kollaazhides on ühendatud maal ja foto.
Robert Lepiksoni maailm / Eha Komissarov
Komissarov, Eha, 1947-
2000-01-01
Näitus "Minu maailm. Robert Lepikson fotograafina ja kollektsionäärina" galeriis "Vaal". Väljas on loodusfotod, fotod autodest, kunstikogust Eduard Steinbergi (1937) ja Vladimir Nemuhhini (1925) maalid, paar Salvador Dali värvilist litograafiat
Milleks meile Afganistan? / Kalev Vilgats
Vilgats, Kalev
2007-01-01
Afganistani sõdade ajaloost ja riigi allakäigust alates 1973. aastast, kui Daud Khan korraldas riigipöörde ja kuningas pages riigist, Nõukogude okupatsioonist 1979-1989. Afganistanis toimuvatest islami terroristide koolitustest, Talibani võimust, narko- ja relvakaubandusest, Eesti kaitseväelaste hukkumisest Afganistanis. Kaart
Doktor Haageni preparaadid / Kalev Vapper
Vapper, Kalev, 1982-
2008-01-01
Mõtteid ja assotsiatsioone Kaido Haageni kaks nädalat pärast pommitamist Gruusias tehtud fotoseeriat vaadates. Fotosid eksponeeriti näitusel "Seinad 080808" Disaini- ja Arhitektuurigaleriis Tallinnas
Iraanis toimuvad presidendivalimised / Kalev Kask
Kask, Kalev
2005-01-01
Iraanis toimuvatest presidendivalimistest. Kaheksast kandidaadist on parimad väljavaated presidendiks saada endisel presidendil Akbar Hashemi Rafsanjanil ja endisel kultuuri- ja kõrgharidusministril Mustafa Moinil
Tarand tegi Tarandit / Kalev Vilgats
Vilgats, Kalev
2011-01-01
Euroopa Parlamendi liikme Indrek Tarandi kandideerimisest Toomas Hendrik Ilvese vastaskandidaadina eelseisvatel presidendivalimistel. Vt. samas Andres G. Adamsoni karikatuur. Vt. ka lk. 4: Indrek tegi jälle Tarandit
A demographic outline / Kalev Katus, Allan Puur
Katus, Kalev, 1955-2008
2002-01-01
Ajalooline ülevaade Eesti elanikkonna kujunemisest ning Eestit läbinud migratsioonivoogudest Nõukogude okupatsiooni perioodil, mis on suuresti mõjutanud Eesti tänast demograafilist olukorda. Tabel ja diagrammid: Eestlaste ja välismaalaste arv Eestis 1922-2000; Välismaalaste osakaal Eestis päritolumaa järgi; Rahvusvahelised migratsioonivood Eestis 1946-1999; Välismaalaste osakaal valitud Euroopa riikides. Kaart.
Kuningas on surnud! Elagu kuningas! / Kalev Kask
Kask, Kalev
2005-01-01
Ilmunud ka: Meie Maa 10. august lk. 5. Maailma suurima monarhistliku ja ühe suurema islamiriigi Saudi Araabia uueks kuningaks sai traditsiooniliste tavade järgi peale kuningas Fahdi surma tema poolvend Abdullah. Lisa: Saudi Araabia kuningad
Me alles hakkame ehitama / Kalev Kallemets
Kallemets, Kalev, 1979-
2006-01-01
Ilmunud ka: Delovõje Vedomosti 6. dets. lk. 10. Eesti elamuehituse maht on alles jõudmas Euroopa tasemele ning selleks, et jõuaksime keskmiste eluruumi ruutmeetritega inimese kohta järele arenenud riikidele, kulub veel palju aktiivseid kinnisvara arendamise aastaid, leiab autor
Majanduskasv jätkub / Kalev Kallemets
Kallemets, Kalev, 1979-
2006-01-01
Reformierakonna ettepanekutest järgmisteks aastateks - tulumaksu langetamine, laenuvõtmise ergutamine, müüa või anda kasutamiseks erakätesse riigile kuuluvat kinnisvara (sh valitsemiseks mittevajalik maa), ettevõtluse arendamine
Tsirkus või demokraatia / Kalev Kallemets
Kallemets, Kalev, 1979-
2005-01-01
Autor leiab, et riigikontrolli suunamine kohalikesse omavalitsustesse ning justiitsminister Ken-Marti Vaheri plaan süüdistada sel aastal 63 ametnikku üle Eesti on kõigi avaliku teenistuse töötajate alandamine
Pantvangidraama Põhja-Osseetia keskkoolis / Kalev Vilgats
Vilgats, Kalev
2004-01-01
Põhja-Osseetia piirilinnas Beslanis võeti koolimaja koos õpilaste, õpetajate ja lapsevanematega pantvangi, hõivajad nõudsid läbirääkimistele Põhja-Osseetia presidenti Aleksandr Dzassohhovit, Inguššia presidenti Murat Zjazikovi ja doktor Leonid Roshali, et nende kaudu esitada nõudmised Inguššia võimude poolt vangistatud sisside vabastamiseks. Kaart: Põhja-Osseetia
Laps vajab veel riigi toetust / Kalev Kotkas
Kotkas, Kalev, 1960-
2001-01-01
Ilmunud ka: Virumaa Teataja, 5. sept. 2001, lk. 7; Meie Maa, 5. sept. 2001, lk. 4; Lääne Elu, 6. sept. 2001. lk. 4; Valgamaalane, 6. sept. 2001, lk. 2; Koit, 6. sept. 2001, lk. 6; Nädaline, 13. sept. 2001, lk. 4; Vooremaa, 20. sept. 2001, lk. 4; Sakala, 26. sept. 2001, lk. 2; Järva Teataja, 27. sept. 2001, lk. 2. Lastega perede toetamisest. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik
Tõde selgub võrdluses / Kalev Kotkas
Kotkas, Kalev, 1960-
2001-01-01
Vastukaja M. Treiali art. "Sotisaalhoolekande seaduse muudatustest", Vooremaa 11. okt. 2001, lk. 2. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Valgamaalane (2001) 27. okt., lk. 2 ; Põhjarannik (2001) 26. okt., lk. 2 ; Hiiu Leht (2001) 19. okt., lk. 2 ; Koit (2001) 20. okt., lk. 6 ; Meie Maa (2001) 23. okt., lk. 2
Kommunistlik Vietnam loodab suurele tulevikule / Kalev Kask
Kask, Kalev
2006-01-01
Ilmunud ka: Hiiu Leht 7. juuli lk. 4. Vietnami Kommunistliku Partei X kongressil peeti kõige tähtsamakas riigi siseprobleemidega tegelemist, mille tulemusena vahetusid president, peaminister ja Rahvuskogu esimees
Kohus himustab Sudaani presidenti / Kalev Vilgats
Vilgats, Kalev
2009-01-01
Rahvusvaheline kirminaalkohus otsustas anda välja rahvusvahelise orderi Sudaani presidendi Omar al-Bashir vahistamiseks sõja- ja inimsusevastaste kuritegude eest. Sellekohased arvamused välisajakirjanduses
Ohupilved stabiilse euroraha kohal / Kalev Kallemets
Kallemets, Kalev, 1979-
2004-01-01
Ilmunud ka: Põhjarannik, 4. aug. 2004, lk. 2; Severnoje Poberezhje, 4. aug. 2004, lk. 2; Lääne Elu, 5. aug. 2004, lk. 2; Nädaline, 5. aug. 2004, lk. 4; Valgamaalane, 5. aug. 2004, lk. 2; Meie Maa, 5. aug. 2004, lk. 2; Koit, 5. aug. 2004, lk. 6; Vali Uudised, 6. aug. 2004, lk. 2; Hiiu Leht, 6. aug. 2004, lk. 2; Võrumaa Teataja, 7. aug. 2004, lk. 2; Harjumaa, 10. aug. 2004, lk. 2; Sakala, 11. aug. 2004, lk. 2. Euroraha stabiilsuse ohustajad
Pinochet taas trellide taga / Kalev Vilgats
Vilgats, Kalev
2005-01-01
Santiagos vahistati Tšiili endine diktaator Augusto Pinochet, keda süüdistatakse maksupettuses ja passide võltsimises seoses salajaste pangaarvetega, millel on hoiustatud miljoneid dollareid valenimede all USA-s ja teistes riikides
Izvinite, jeshtsho raz izvinite / Raul Kalev
Kalev, Raul
2007-01-01
Autor selgitab eestlaste ja venelaste erinevat suhtumist Teise maailmasõja tulemustesse ning valitsuse käitumist pronkssõduri probleemi lahendamisel ja leiab, et eestlased ja venelased peavad proovima mõista teineteist, soovima tundma õppida kõrvuti elavate rahvaste ajalugu, kombeid ja pühadusi
Eestis meenutati Paul Kerest / Kalev Vilgats
Vilgats, Kalev
2011-01-01
Paul Kerese 95. sünniaastapäeva puhul viibisid Tallinnas male eksmaailmameister Anatoli Karpov ja teised malemaailma tipud. President Toomas Hendrik Ilves kohtus male suurkujudega Kadriorus 6. jaan. 2011
Mittetulundusorganisatsioonide tegevus ja strateegiline juhtimine / Kalev Stoicescu
Stoicescu, Kalev
2002-01-01
Bibliogr. lk. 114. - Kokkuvõte ingl. k. lk. 115. Üleminek teadlikule ja sihikindlale strateegilisele juhtimisele teostub mittetulundusorganisatsioonis reeglina siis, kui organisatsioon on saavutanud teatud arengutaseme ehk kriitiliste ressursside massi, mis annab paremaid tegutsemisvõimalusi
Relvastatud jõu kasutamine / Kalev Stoicescu
Stoicescu, Kalev
2006-01-01
Sõjalistes operatsioonides peavad jõu kasutamise reeglid olema piisavalt selged, nende koostamisel arvestatakse oma riigi seadusi ja rahvusvahelist õigust, kuid ka kohalikku kultuuritausta. Liiga kitsad reeglid võivad piirata sõjalise ülema tegevust, liiga laiad või ähmased reeglid aga võivad viia konflikti eskaleerumisele. Näiteid
Kalev Spa : Aia tn. 18, Tallinn = Kalev Spa : Aia St. 18, Tallinn / Henry Kuningas
Kuningas, Henry
2006-01-01
"Kalevi" ujula ümberehitus. Projekteerija: AB Emil Urbel OÜ. Autorid: Emil Urbel, Ivar Lubjak. Sisekujundaja: Taavi Aunre (OÜ Boom.ee). Konstruktor: Margus Allik (MG Inseneribüroo OÜ). Projekt ja valmis: 2005. Ill.: I korruse plaan, 4 värv. vaadet
Sillad = Broer : [luuletused] / Lars Saabye Christensen ; tlk. Eha Vain
Christensen, Lars Saabye
2004-01-01
Sisu: Sillad = Broer; Taevas Tallinna kohal = Himmel over Tallinn; "sellest punktist ..." = "det er ingen vei tilbake ..."; Vanaema juuksed = Farmors hår; "ma mäletan jõge ..." = "jeg husker en elv ..."; "surnud ..." = "de daede ..."; Kutid = Gutta
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 78 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Query... putative [Entamoeba histolytica HM-1:IMSS] ... Length = 139 ... Query: 19 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVN
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 79 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Quer
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 6, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 122 ... Query: 26 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLDLKIRVTGGGQVAQAYAI 85 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRV...TGGGQVAQAYAI Sbjct: 1 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRVTGGGQVAQAYAI 60 ... Query: 146 YR 147 ... YR Sbjct: 121 YR 122
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available otein [Entamoeba histolytica HM-1:IMSS] ... Length = 113 ... Query: 129 SGHTSTATTHSISFTGTGNSIGKSNATNFKVT...GSIPTLDISKPTTNIKVRFIDGKQKVFK 188 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK Sbjct: 1 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIEPLDIQQGCLGDCYFLA 61 ... FTDDEFPAELRSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIE...PLDIQQGCLGDCYFLA Sbjct: 1 ... FTDDEFPAELRSIGKIDSILPSSLTFLRPNEYMEHPQLYENGIEPLDIQQGC
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SFTTLTN 60 ... Query: 135 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY 194 ... PKGLAKCVDMNYIELTS...NEFEEFPDVICELRKVTILMLQQNRIKEVPDSISKLEKLSGLY Sbjct: 121 PKGLAKCVDMNYIELTSNEFEEFPDVICELRKVTILMLQQNRIKE
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIKE...IKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EAYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIK...EIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ve [Entamoeba histolytica HM-1:IMSS] ... Length = 179 ... Query: 8 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERN...AQKRLEMLKDIVGSLGENSCILP 67 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP Sbjct: ...1 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP 60 ... Query: 128 E
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IDFMRLAINGTAEAHRACMKYCKPGMYEF Sbjct: 121 IRTKAVYKYNTNETELHDVLFEARTVKTKEEIDFMRLAINGTAEAHRACMKYCKPGMYEF 180 ... Query: 270 CHRYATDLTLTYPIN...GKFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG 329 ... CHRYATDLTLTYPING...KFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG Sbjct: 241 CHRYATDLTLTYPINGKFTEQQKTIYNIVLS
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RFIKYVQFETTSNAMSSSVPSTPTQIEFEKYLQNELNEMGIKNELTQTGHLFAYLSN 60 ... Query: 127 DTLLGADDKCAVAILMTICE...MYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 186 ... DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIG...RSITHLDINKLKAKKAYSLD Sbjct: 121 DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 180 ... Query: 247
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available YIKTYQKLFTELHETK 60 ... Query: 412 TLVNQIVSKECEHISEHEEKTICEQMNIVVFGEKNKTSLTESLQSLVNGDELTGENKYFC 471 ... TLVNQIVSKECEHISEHEEKTICE...QMNIVVFGEKNKTSLTESLQSLVNGDELTGENKYFC Sbjct: 121 TLVNQIVSKECEHISEHEEKTICEQMNIVVFGEKNK
Paleepööre graafikas / Eha Komissarov
Komissarov, Eha, 1947-
2001-01-01
Ljubljana 24. graafikabiennaalist Sloveenias. Kuraatoriprojektidest, Breda Skrjanec'i kureeritud põhinäitusest "Print World". Peapreemia - Damien Hirsti töö "Viimane õhtusöök". Marna Bunnelli, Tracy Moffati, Thomas Ruffi, Sasho Vrobic'u ja Eestit esindanud Liina Siibi töödest
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ECHFSFKGQSETDFAEGIYHGKFVFPYDYPK Sbjct: 1 ... VKRLQREYAAFLKSPPPDMTIYLIESSVHECHFSFKGQSETDFAEGIYHGKFVFPYDYPK 60 ... Query: 130 ETCS...DIKKEFAIKSQYYTC 148 ... ETCSDIKKEFAIKSQYYTC Sbjct: 121 ETCSDIKKEFAIKSQYYTC 139
Planetaarne mudel ei tööta / Eha Komissarov
Komissarov, Eha, 1947-
2005-01-01
26. Ljubljana graafikabiennaalist "Tõuge/Thrust". Lähemalt ameerika kunstniku Devorah Sperberi tööst "Mona Lisa", Calcografia Nationali (Hispaania) väljapanekust, eestlaste projektist "Jagatud protsess"
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 0063 [Entamoeba histolytica HM-1:IMSS] ... Length = 201 ... Query: 34 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNV...IINFYIPICVIAIISIYQKNIEKGLTV 93 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV Sbjct...: 8 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV 67 ... Query: 154
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein LSm2, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 69 ... Query: 5 ... SFFKTLIGKEVVVELKNDVI...ITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 64 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKC...DATLFPQIQTMTDCFIRGN Sbjct: 1 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 170 ... Query: 24 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVI...ISNNVSCSRKQCSI 83 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI Sbjct: 21 ... ...VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI 80 ... Query: 144 YSIIK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVILVSLREY 84 ... ELVFKEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVI...LVSLREY Sbjct: 1 ... ELVFKEEGQEYGQVTRMLGNGRLEAYCFDGKTRQCHIRGQMQRKVWINVNDVILVSLREY 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yme, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 145 ... Query: 7 ... IALMRLTADLKTMLTDPP...VGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRLTFSDE 66 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPF...EGGLFELRLTFSDE Sbjct: 1 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available t00003 [Entamoeba histolytica HM-1:IMSS] ... Length = 365 ... Query: 252 LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRN...NVFNSLFKQIKHSEKWDRLFKIEFKHEQG 311 ... LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRNNVFNSLFKQIKHSEKWDRLFKIEFKHEQG Sbjct: 1 ... LPFEM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 228 ... Query: 96 ... VRENMEDVISTCHLERNKDLVGVFDGHNG...DSAARIAATLLKQDTKNYTLLDDIHFIDLFN 155 ... VRENMEDVISTCHLERNKDLVGVFDGHNGDSAARIAATLLKQDTKNYTLLDDIHFIDLFN Sbjct: 1 ... VRENMEDVISTC
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 338 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 397 ... ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTC...VAPNVFYSDPKLEG Sbjct: 121 ALQIHSDIALTLPPEHLTCLKYLVSFCSHLVKSEKSKMTIEAISTCVAPNVFYSDPKLEG 180 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
Leedu kunst on integratsioonivõimeline / Eha Komissarov
Komissarov, Eha, 1947-
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest
TOEFL-test sobib nii Pekingis kui Tallinnas / Eha Teder
Teder, Eha
2003-01-01
Tulemas on uue põlvkonna TOEFL (Test of English as a Foreign Language) test, mis toob kaasa uue arusaama standardiseeritud (keele)testidest. Testi saab teha Põhja-Ameerika ülikoolide teabekeskuses Tallinna Tehnikaülikoolis
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein [Entamoeba histolytica HM-1:IMSS] ... Length = 131 ... Query: 3 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLT...NIDATSYEEALVKFLDSWLCIF 62 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF Sbjct...: 1 ... FEYLDHPADVILHSWGQNIIEAFENAAAGMFNFMSDLTNIDATSYEEALVKFLDSWLCIF 60 ... Query: 123 DQTHIHILLDI 133 ... DQTHIHILLDI Sbjct: 121 DQTHIHILLDI 131
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein [Entamoeba histolytica HM-1:IMSS] ... Length = 103 ... Query: 31 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHIS...PMIDTS 90 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS Sbjct: 1 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tative [Entamoeba histolytica HM-1:IMSS] ... Length = 141 ... Query: 94 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPY...EYNGGHVRSSMNISTETALYKELNKLFEI 153 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI Sbjct: 1 ... GFKTLSPYELNQMINS
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 204 ... Query: 7 ... QWQKAQETIFVDWIND...TLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKIIENPKFR 66 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEK...LTNKHCSEKIIENPKFR Sbjct: 1 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 337 SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD 396 ... ... SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD Sbjct: 241 SASYPSADCKECIVMLLEKDPEKRLTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKD 300 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ry: 348 CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI 407 ... ... ... CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI Sbjct: 241 CIQELLVKDPEKRLTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDI 300 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 1 ... DNKPFYAFIGTFLSPQTRDQITFASVKKLHETLGELSVDVINNTSLEVLINCIKGVGFYT 60 ... Query: 174 VISQRLGWADGSTPEKVRLQLESWL...PKEEWPLFNKSLVAFGQCCCRKTHPKCKQCPIQDK 233 ... VISQRLGWADGSTPEKVRLQLESWLPKEEWPL...FNKSLVAFGQCCCRKTHPKCKQCPIQDK Sbjct: 121 VISQRLGWADGSTPEKVRLQLESWLPKEEWPLFNKSLVAFGQCCCRKTHPKCKQCPIQDK 180 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available .t00007 [Entamoeba histolytica HM-1:IMSS] ... Length = 56 ... Query: 454 QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRT...KYGDLVDDFEKNQK 509 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK Sbjct: 1 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK 56
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 210 VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 269 ... VEIITPENAIKGITKSISDRRG...FIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG Sbjct: 1 ... VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available bjct: 1 ... LGFSLLKLHLPANKILLQKIQNLDNTFPLKDIEALIKYLPNNAEYQIINGSKGIDITSVI 60 ... Query: 613 GNILNASSPLRCRADA...FSLEALLLLKDVPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF 672 ... GNILNASSPLRCRADAFSLEALLLLKD...VPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF Sbjct: 121 GNILNASSPLRCRADAFSLEALLLLKDVPGLLQNGLKFVLGQVDPVLLLEQIAICRDAIF 18
Karl Nagel : Pain things = Pain things / Eha Komissarov
Komissarov, Eha, 1947-
2007-01-01
Maali- ja videokunstnik Karl Nagelist kui probleemsest nüüdisaegsest kunstnikust, kes võtab provokatiivseid positsioone ideoloogiate ja poliitika küsimustes. Tema kunstnikupositsioon keerleb terrorismi, fašismi ja natsionalismi ümber, dissidendi positsioonile asununa on ta käsitlenud surma ja vägivalla teemat (Tšetšeenia sõda) ja üritanud sõna võtta ka kodanikuvabaduste laiendamise nimel. Sotsiaalse tegelikkuse ja kunsti vastandlikkuse küsimuses on ta võtnud nulltoleratsi taotleva seisukoha, võrdlemata kunsti tegelikkusega
Üliõpilasteatrid - teistmoodi teater / Kalev Kudu
Kudu, Kalev, 1961-
2007-01-01
Üliõpilasteatrite VI maailmakongressist 21. - 26. juulini Urbinos Itaalias. Autor oma ettekandest teemal "Üliõpilasteater kui mäss. Üliõpilasteatrite eriline missioon globaliseeruvas maailmas". Lühiintervjuu Liege'i ülikooli professori, üliõpilasteatri kunstilise juhi ja Rahvusvahelise Üliõpilasteatrite Liidu (AITU) esimehe Robert Germayga. Etendustest: "Shahrazad - neitsi Bagdadist" (Bologna ülikool, Itaalia"), "Mbomo-mvet" (Yaounde ülikool, Kamerun), "The Believed Dead" (Brescia Katoliiklik Ülikool, Itaalia), "Teenrid" (Teatro Verga, Milano ülikool, Itaalia), "Antigone" (Ateena ülikool, Kreeka), "Tilt!" (Teatro Aenigma, Urbino ülikool, Itaalia), "Paroodia" (Milano ja Urbino ülikoolide üliõpilased), "Erose tiivad" (Saloniki ülikool, Kreeka), "Kolmas laps" (Long Islandi ülikool, USA), "Lee-Oki lugu" (Hoseo ülikool, Lõuna-Korea), "Ülikond" (Vilniuse Tehnikaülikool, Leedu)
Ühe ajastu lõpu algus / Kalev Kask
Kask, Kalev
2004-01-01
Ilmunud ka: Meie Maa, 9. nov. 2004, lk. 7. Yasser Arafati tervislik seisund on halvenemas, seni pole ta ametlikult kedagi oma järeltulijaks määranud. Palestiinlased peaksid suutma valida talle kombekohase järglase, vastasel juhul satuvad nad keerulisse võimuvõitlusse, millest saab kasu eelkõige Iisrael, leiab autor
Läänlased, eestlased ja majanduskasv / Kalev Kallemets
Kallemets, Kalev, 1979-
2006-01-01
Autori hinnangul suurendaks Reformierakonna liberaalne majanduspoliitika eestlaste investeeringuid Eesti majandusse ja need omakorda eestlaste, sh. läänlaste palgataset. Vt. samas diagrammid: Maksud, investeeringud ja reaalne SKP kasv ELis 1996-2004; Eesti ja Läänemaa palgakasv
Kaks teenetemärki Peter Hundile / Kalev Vilgats
Vilgats, Kalev
2010-01-01
Pärnu maavanem Andres Metsoja andis president Toomas Hendrik Ilvese volitusel AS Wendre suuromanikule Peter Hundile üle Valgetähe IV klassi teenetemärgi ettevõtluse edendamise eest. Ettevõtja pälvis ka Pärnu linna vapimärgi
Tänavused mõjukamad valimised / Kalev Kask
Kask, Kalev
2004-01-01
Ilmunud ka: Meie Maa, 2. nov. 2004, lk. 4. Ameerika Ühendriikides toimuvatest presidendivalimistest, kus otsustavaks kujuneb kahe kandidaadi, George Walker Bushi ja John Forbes Kerry, vaheline heitlus
Suurajatolla Ali al-Sistani saabus Najaffi / Kalev Vilgats
Vilgats, Kalev
2004-01-01
Mässulise shiiidivaimuliku Moqtada al-Sadri Mahdi armee võitlejad on pidanud Najafis USA vägedega lahinguid juba kolm nädalat. Iraagi kõrgeim shiiiavaimulik suurajatolla Ali al-Sistani kutsub kõiki iraaklasi endaga Najaffi marssima, et lahingutele lõpp teha
President Ilves avas Pärnus voodivabriku / Kalev Vilgats
Vilgats, Kalev
2009-01-01
President Toomas Hendrik Ilves viibis 16. novembril 2009 Pärnus Trading House Scandinavia AB kontserni kuuluva OÜ Stram voodivabriku avamisel. Riigipea tunnustas ettevõtte omanikku Peter Hunti uute töökohtade loomise eest
Teater kui katk, teater kui haiguste ravi / Kalev Kudu
Kudu, Kalev, 1961-
2005-01-01
Antonin Artaud' projekt tegevuskunsti festivalil "Diverse Universe". Projekti lavastas Tartu Üliõpilasteatri näitlejate ja Tartu Ülikooli kahe teatritudengiga Ph. Brehse Berliini performance'irühmast Open Space. Workshop Tartu Üliõpilasmajas 3.-6. maini ja 6. mail Sadamateatris etendus "Katk". Lisatud lavastaja ja osalejate arvamused õpikojast
Kulka lemmikud 2007 / Kalev Kesküla
Kesküla, Kalev, 1959-2010
2008-01-01
Eesti Kultuurikapitali aastapreemia said 17. saj. Tartu juhuluule kogumiku "O Dorpat, urbs addictissima musis" koostajad Kristi Viiding, Jana Orion, Janika Päll (Tallinn : Eesti Keele Sihtasutus, 2007)
Mis saab Eesti maaelust 2013. aastal? / Kalev Kotkas
Kotkas, Kalev, 1960-
2007-01-01
Ilmunud ka: Nädaline, 14. juuli 2007, lk. 5; Meie Maa, 13. juuli 2007, lk. 2; Järva Teataja, 17. juuli 2007, lk. 2; Valgamaalane, 17. juuli 2007, lk. 2; Hiiu Leht, 17. juuli 2007, lk. 2; Põhjarannik, 13. juuli 2007, lk. 3; Severnoje Poberezhje, 13. juuli 2007, lk. 3; Sõnumitooja, 18. juuli 2007, lk. 2; Pärnu Postimees, 19. juuli 2007, lk. 15; Lääne Elu, 19. juuli 2007, lk. 2; Võrumaa Teataja, 17. juuli 2007, lk. 2; Virumaa Teataja, 20. juuli 2007, lk. 11; Vooremaa, 19. juuli 2007, lk. 2; Sakala, 25. juuli 2007, lk. 2. Autor arutleb maaelu arengukava 2007-2013 meetmete võimaluse üle põllumajanduse konkurentsivõimet parandada ning hoiatab riigikontrolli maaelu käsitleva auditi ja selles prognoositavate majandusraskuste võimalike kaasmõjude eest noorte elukutsevalikule
Teenistuspüstolid valikusõelal / Ants Kalev
Kalev, Ants
2004-01-01
15.-16. juunil 2004 korraldatud Maksu- ja Tolliameti töötajate uute teenistusrelvade valikukonkursile esitatud püstolimudelite Walter'i P99, Sig Sauer'i Sig PRO SP 2022 ja Heckler'i ja Koch'i P 2000 näitajate kirjeldused. Valiku tegemisel Walter'i P 99 kasuks sai määravaks tootja pakutav hind ja relvastusspetsialistide arvamus
Al-Zarqawi - terrorist või kangelane? / Kalev Kask
Kask, Kalev
2005-01-01
Ilmunud ka: Meie Maa 29. juuni lk. 5. Jordaanias sündinud palestiinlane Abu Musab al-Zarqawi, õige nimega Ahmed Fadel al-Khalaylah, on rühmituse Jama'at al-Tawhid wal Jihad juht ja hetkel kuulsaim sõjapealik Iraagis, kes on pühendanud oma elu võitlusele USA vastu
Dokumentaalfilm "Laulev revolutsioon" tähistab vabadust / Kalev Vilgats
Vilgats, Kalev
2007-01-01
Dokumentalistide James Tusty ja Maureen Castle Tusty Eesti taasiseseisvumisest kõnelevast dokumentaalfilmist kui suurepärasest Eesti tutvustajast maailmale kirjutab oma koduleheküljel USA uuringute firma Media Research Center president L. Brent Bozell III. Refereering
Bussipark müüdud, mured murtud? / Kalev Vilgats
Vilgats, Kalev
2004-01-01
Pärnu linnavalitsus müüs 51,39% bussifirma Pärnu ATP AS-i aktsiaist 11 miljoni kroonise alghinnaga ainsana pakkumise teinud Trandemark OÜ-le. Autor tõstatab küsimuse ostjafirma omanikest ja reisijateveo jätkamise tingimustest
Mõjuka majandusteoreetiku väärikas lahkumine / Kalev Kask
Kask, Kalev
2006-01-01
Suri üks mõjukamaid kaasaja majandusteoreetikuid Milton Friedman, keda seostatakse eelkõige monetaristliku majandusteooriaga, mis rõhutab vabaturumajanduse arendamist ja valitsuse võimalikult vähest sekkumist majandustegevusse
Rahvusvaheliselt tõsiseltvõetav partner / Leif Kalev
Kalev, Leif, 1976-
2000-01-01
Eesti Üliõpilaskondade Liidu osalusest Euroopa üliõpilaskondade liitude katusühenduse (ESIB-The National Unions of Students in Europe) kui majandusliku ISIC-kaardi väljaandjate keskühenduse (ISTC-International Student Travel Association) töös. ESIB-i poolaastakoosolekul Genfis oktoobri lõpul võeti vastu avaldused Eesti, Austria ja Suurbritannia üliõpilaskondade liitude toetuseks tegevuses õppemaksude vastu. Septembri lõpul toimus Düsseldorfis rahvusvaheline noorte ja tudengite iga-aastane turismikonverents
Aukonsulid aitavad edendada kontakte Eestiga / interv. Kalev Vilgats
2008-01-01
Ülevaade Eesti aukonsulite viiendast konverentsist, millest võttis osa üle 70 aukonsuli rohkem kui 40 riigist. Lisad: Aukonsulid Eestis; Eesti konsulaatide ajalugu. Vt. samas: Kuidas sai teist Eesti aukonsul? Kui palju kulub teie ajast konsulitööle?; Mida arvavad teie tegevusest perekonnaliikmed ja sõbrad? Küsimustele vastavad Eesti aukonsul Moldovas Igor Goncearov, Eesti aukonsul Los Angeleses Jaak Treiman, Eesti aukonsul Tuneesias Abdeljelil Bouraoui, Eesti peaukonsul Sao Paulos Jüri Saukas. Arvamust avaldab ka Eesti välisminister Urmas Paet.
Peresõbralik firma 2002 - Paikuse Saeveski / Kalev Petti
Petti, Kalev
2002-01-01
Ajakiri Pere ja Kodu ja ajaleht Äripäev selgitasid välja Eesti kõige peresõbralikuma ettevõtte. - Lisaks tabelid: Eesti töötajasõbralike ettevõtete TOP 50 ; Peresõbralike firmade TOP 50 ; Töökeskkonnasõbralike firmade TOP 50 ; Töötaja arengu sõbralike firmade TOP 50
Uus etapp Iisraeli võitluses palestiinlastega / Kalev Kask
Kask, Kalev
2004-01-01
Ilmunud ka: Meie Maa, 27. apr. 2004, lk. 6. Iisraeli ja Hamasi vahelise võitluse ägenemise käigus tapeti Iisraeli julgeolekujõudude poolt Palestiina äärmusrühmituse Hamas juht Abdel-Aziz al-Rantisi. Lähis-Ida rahuplaani hakkavad Berliinis arutama rahuprotsessi nelja osapoole esindajad - USA, Euroopa Liit, ÜRO ja Venemaa
Surmanuhtlus - õiglane või mitte / Kalev Kask
Kask, Kalev
2007-01-01
Artiklis käsitletakse küsimust, kas surmanuhtlust pidada õiglaseks karistuseks või pole selle täitmine demokraatlikus ühiskonnas küllaldaselt õigustatud. Ilmunud ka Meie Maa : Nädalalõpp 19-20. jaan. 2007, lk. 3
Uue paradigma poole monumendikeskustelus / Priit-Kalev Parts
Parts, Priit-Kalev, 1972-
2007-01-01
Autor püstitab küsimuse, kas on üldse sünnis luua igavesi ja muutumatuid vorme. Paindlikumat tõlgendamist võimaldab näiteks muutlik ja hävinev puu, mida võib vesta või istutada. Pingemaandajana sobiks tordist monumendikoopia
Merkel: Nord Streami on meile vaja / Kalev Kask
Kask, Kalev
2009-01-01
Venemaa presidendi Dmitri Medvedevi ja Saksamaa kantsleri Angela Merkeli kohtumisel käsitleti energeetikapoliitikat, D. Medvedev kutsus Rootsit üles toetama Nord Streami arendamist ning taunis Nabucco gaasijuhtme rajamist
Mida teha järjepideva rahvastikuarengu nimel / Kalev Katus
Katus, Kalev, 1955-2008
2007-01-01
Rahvastikuteadlane annab ülevaate Eesti rahvastiku sündimustasemest kui rahvastikuprotsesse enim mõjutanud tegurist, analüüsib erinevate meetmete, sh rahakesksete meetmete mõju sündimusele ja pakub välja abinõud, mis aitavad tõsta sündimuse taastetasemele. Lisatud diagramm ja graafikud
Eraõigusliku juriidilise isiku organi liikmete õigussuhted / Kalev Saare
Saare, Kalev, 1974-
2010-01-01
Eraõiguslike juriidiliste isikute organi mõistest aktsiaseltsi ja osaühingu näitel, organiliikmete sisesuhte tekkimisest ja tsiviilseadustiku üldosa seaduse poolt määratud sisesuhte sisusse kuuluvatest peamistest kohustustest
Vaal müüb XX sajandi klassikat / Eha Komissarov
Komissarov, Eha, 1947-
2001-01-01
Galeriis "Vaal" näitusmüügil "Suured ja unustamatud" saab osta G. Braque'i, P. Delvaux', F. Baconi, K. Appeli, J. Dine'i, N. de Saint Phalle'i, H. Hartungi, J. Vossi, B. van Velde, P. Picasso, J. Mir̤, A. T̉piesi, M. Chagalli, A. Saura ja C. Garache'i töid
Beebitoidu müüki hakkab korraldama range koodeks / Eha Laanepere
Laanepere, Eha, 1963-
1995-01-01
Rinnapiima asendajate reklaami ja müüki reguleerivast rahvusvahelisest koodeksist International Baby Food Action Network (IBFAN), mis on vastu võetud 1982. aastal, selle seadustiku vajalikkusest Eestis
Värvid meie ümber / Kalev Vene, Herki Tomberg
Vene, Kalev
2001-01-01
Värvid läbi aastatuhandete, esiisadeaegne värvitööstus, värvide põhikomponendid, erinevate värvitüüpide funktsioonid, värvide jaotus ja omadused, punamuldvärv, õlivärv, liimvärv. Järg: nr. 9, lk. 44-45, nr. 10, lk. 18-21, nr. 11, lk.40-41, nr. 12, lk. 31-31. Vaid I osa kokkuvõte inglise ja vene keeles
Rahvastikuteadus ja Eesti rahvastikuarengu pöördepunktid / Kalev Katus, Allan Puur
Katus, Kalev, 1955-2008
2006-01-01
Järg nr. 3 lk. 491-522. Bibl. lk. 511-521. Rahvastikuteaduse tekke- ja arenguloost, rahvastikuarengu kui iseseisva sotsiaalsüsteemi seaduspärasustest ning demograafilisest üleminekust rahvastikutaaste arenguetapina. Tabelid
Ehitise garantii kehtivas eraõiguse süsteemis / Kalev Saare, Kristjan Tamm, Urmas Volens
Saare, Kalev, 1974-
2013-01-01
Ehitise garantii olemusest ja eesmärkidest, seostest töövõtugarantii ja tagatava õigussuhtega. Artikli teema seondub 29.–30. novembrini 2012 Tartus toimunud rahvusvahelisel konverentsil „Kümme aastat võlaõigusseadust Eestis ja võlaõiguse areng Euroopas“ peetud ettekandega „Töövõtja vastutus ehituse töövõtulepingu rikkumisel ja ehitise garantii“
Kliimasoojenemise hüsteeria läheb kalliks maksma / Kalev Kallemets
Kallemets, Kalev, 1979-
2009-01-01
Autori väitel tähendab praegune EL-i süsinikdioksiidi-kaubanduse kokkulepe Eesti elektrihinna 2-3-kordistumist 2015. või 2020. aastaks, 20% suurune emissioonikärbe ning süsinikdioksiidi kvoodi hinnatõus tähendab lööki Eesti ja Euroopa majandusele
"Need, kes on käest libisenud..." : [luuletused] / Kalev Kesküla
Kesküla, Kalev, 1959-2010
2000-01-01
Sisu: "Need, kes on käest libisenud..." ; Armastuse kolmjalg ; Inimese määratlus ; Aja määratlus ; Taasleitud Pariis ; Dr. Faustus ; "Päev, mu tegus tööandja..." ; "Mõned kadunud asjad..." ; "Keskealine mees..." ; "Unustuse keha..."
USA presidendivalimised lükati käima / Kalev Kask
Kask, Kalev
2007-01-01
Kuigi USA presidendi George Walker Bushi ametiaeg lõpeb kahe aasta pärast ja presidendivalimised toimuvad alles järgmisel aastal, on valimiskampaania juba alanud. Esmalt tuleb vabariiklastel ja demokraatidel välja selgitada partei ühiskandidaadid
Põhja-Korea tuumakriisis saavutati läbimurre / Kalev Kask
Kask, Kalev
2007-01-01
Kuuepoolsel läbirääkimisel sõlmitud leppe järgi lubab Põhja-Korea sulgeda vaidlusaluse Youngbyoni tuumajaama, kus valmistatakse väidetavalt plutooniumi, peatingimuseks saada vastutasuks suures koguses elektrienergiat
Laenusaaja õiguste kaitse SMS-laenu lepingute puhul / Kalev Saare, Karin Sein, Mari Ann Simovart
Saare, Kalev, 1974-
2010-01-01
SMS-laenu lepingutele kohaldatavad normid, laenuandja teavitamiskohustus ja tarbija võimalused lepingust taganeda. Laenuandja intressi-, viivise- ja leppetrahvinõuded, intressikokkuleppe lubatavuse piirangud
Tegevusloa kehtetuks tunnistamine : kas haldussund või karistus? / Kalev Aavik
Aavik, Kalev
2011-01-01
Artikkel põhineb 31. Eesti õigusteadlaste päevadel Tartus 30. septembril 2010 peetud ettekandel. 23. veebruaril 2011 võttis Riigikogu vastu majandustegevuse seadustiku üldosa seaduse, mis muuhulgas kodifitseerib tegevuslubade andmise ja kehtetuks tunnistamise normid. Vastavast Euroopa Inimõiguste Kohtu praktikast
Applying theory of constraints in tactical and strategic management / Kalev Kaarna, Mait Miljan
Kaarna, Kalev
2002-01-01
Bibliogr. lk. 86-87. - Kokkuvõte eesti keeles lk. 87. Piirangute teooria kasutamise vajadusest ja võimalustest. Piirangute juhtimisest pikas perspektiivis ning sellel põhinevast strateegilisest juhtimisest. Tabelid
Et karu müttaks ja hunt uluks / Kalev Aun
Aun, Kalev, 1951-
2004-01-01
Keskkonnainvesteeringute Keskuse jahinduse programmi raames toetab KIK jahimaade korralduse ja ulukikaitse projekte ning jahiulukite rakendusuuringuid, trükiste väljaandmist ja jahimeeste erialast väljaõpet
2014-01-01
Ajavahemikus 2008-2013 Pirita rannas läbi viidud uurimuses demonstreeriti lennukil paikneva (ALS) ja rannale paigaldatud (TLS) mõõdistusseadmete abil tehtava laserskaneerimise võimalusi ranna kolmemõõtmelise topograafia ajaliste muutuste analüüsimiseks
Reservsõjaväelasele Leo Kunnasele anti Stalkeri romaaniauhind / Kalev Kask, Kaarel Kressa
Kask, Kalev
2009-01-01
Eesti Ulmeühingu Stalkeri-nimelised auhinnad jaotusid järgmiselt: algupärase romaani auhind - Leo Kunnas (romaani "Gort Ashryn" 1. osa "Enne viimast sõda"), algupärase jutu auhind - Indrek Hargla ("Minu päevad Liinaga", ilm. Looming, 2008, nr. 8), algupärase lühijutu auhind - Laur Kraft ("Ultima Cthule", ilm. võrguajakirjas Algernon), tõlkeromaani auhind - Sergei Lukjanenko ("Öine Vahtkond"), kogumiku auhind - Poul Anderson ("Taevarahvas"), tõlkejutu auhind - Paolo Bacigalup ("Flööditüdruk")
Vastutegevuse staabi tööst Kevadtormil 2003 / Kalev Muru
Muru, Kalev
2003-01-01
Brigaadiõppustel Kevadtorm 2003 võimaldati reservohvitseridel soovi korral osaleda Kaitseliidu üksuste juures abilistena. Kaitseliit oli sellel suurõppusel üks põhilisi vastutegevuse organiseerijaid
Eesti majandus 1991-2007 : taassünd ja edulugu / Kalev Kukk
Kukk, Kalev, 1951-
2008-01-01
Ettekanne Rahvusarhiivi teaduskonverentsil "Kaks algust: 15 aastat iseseisvat Eesti Vabariiki" 23. novembril 2007. Eesti majandus 1980-ndate aastate lõpul, iseseisvuse esimestel aastatel ning pärast liitumist Euroopa Liiduga. Tabelid
Prillop, Kalev
2006-01-01
Ilmunud ka: Infopress 11. aug. lk. 24-25. Ida politseiprefekt vastab küsimustele, mis puudutavad Sillamäe elaniku tapmist Narva-Jõesuus, kuritegevust Ida- ja Lääne-Virumaal selle aasta I poolaastal, sh. Sillamäel
Eesti lipu võib heisata iga päev / Kalev Uustalu
Uustalu, Kalev, 1951-
2006-01-01
Aasta alguses jõustunud Eesti lipu seaduses kehtestatud riigi- ja kohaliku omavalitsuse asutustele riigilipu kasutamise uutest reeglitest ning eraisikutele Eesti lipu kui rahvuslipu kasutamise vabadusest. Sama ka Hiiu Leht 3. veeb. 2006, lk. 8 ; Sakala 10. veeb. 2006, lk. 2 ; Lääne Elu 9. veeb. 2006, lk. 2 ; Järva Teataja 23. veeb. 2006, lk. 2 ; Pärnu Postimees 23. veeb. 2006, lk. 2 ; Linnaleht Tartu 24. veeb. 2006, lk. 6
A-, B- ja C-kingades üle salamandrite / Kalev Vapper
Vapper, Kalev, 1982-
2010-01-01
Fotonäitus "Riburajad" Y-galeriis Tartus 5. oktoobrist 17. oktoobrini 2009, kuraator Peeter Laurits. Näitusel eksponeeritud fotode read tekkisid järk-järgult pildivahetuse käigus Tartu Kõrgema Kunstikooli endiste ja praeguste tudengite vahel. Loetletud osalejad, lähemalt Valdur Mikita tekstidest
Kahtlejate osakaal on kasvanud 44 protsendile / Kärt Anvelt ; kommenteerinud Kalev Petti
Anvelt, Kärt, 1973-
2011-01-01
Autor käsitleb viimaseid valimiste-eelseid küsitlusuuringuid ning märgib, et kahtlejaid on enim endiste Reformierakonna toetajate seas ning valimiste tulemuse seisukohalt näib olevat võtmeküsimus, kas Reformierakonna valija taastab oma eelistuse ja tuleb valima või mitte. Diagrammid, graafikud
Rohkem kui 300 aastat tagasi surnud pere õnnestus tuvastada / Mati Mandel ; Kalev Jaago
Mandel, Mati, 1945-
2016-01-01
Peanse külas Lihula vallas toimunud kaevamistest. Leiti nelja inimese luustikud. Leiumaterjal võimaldas võrrelda ja kokku viia arheoloogi, numismaatiku, atropoloogi ja arhivaari uurimistulemusi. Suure tõenäosusega võisid leitud maetud olla Leti Andrese Mihkel, tema abikaasa ning lapsed Heinrich ja Ann. Tegu võib olla 1710.- 1711. aasta katku ohvritega. Haruldase juhtumina saab luid seostada konkreetsete ajalooliste isikutega
Seitsmes palverändur on professor Volker Sellin / Kalev Vilgats
Vilgats, Kalev
2009-01-01
Pärnust pärit valgustusaja mõtleja Carl Gustav Jochmanni 220. sünniaastapäeva tähistamine Pärnu raekojas. Loenguid pidasid professorid dr. Ulrich Kronauer ja dr. Volker Sellin Saksamaalt. Seitsmenda Pärnu akadeemilise palveränduri märgi sai dr. Volker Sellin. Akadeemilise palverändurimärgi on saanud väljaspool Eestit Pärnu ajaloo uurimist toetanud või siit pärit väljapaistvate tegelaste pärandit tutvustanud õpetlased
Vabadus, võrdsus ja vendlus ning liberaaldemokraatliku riigi üleilmastumine / Leif Kalev
Kalev, Leif, 1976-
2011-01-01
Vabadus, võrdsus ja vendlus liberaaldemokraatlikus riikluses, selle sisepinged ja alternatiivid üleilmastumise kontekstis ning kohasus tänase poliitika ja valitsemise analüüsimisel. Liberalismi rakendustest Eestis
Hans Lepp : ainult tänu kodueestlastele on Eesti olemas / Hans Lepp ; interv. Kalev Vilgats
Lepp, Hans, 1950-
2007-01-01
Rootsi instituudi praegune kultuurinõunik Hans Lepp töötas esimese kultuuriatasheena taas avatud Rootsi suursaatkonnas. Töötamisest Rootsi instituudis, riigi välispoliitikast, suhetest Venemaaga, aprillisündmustest jm
Mets ja marutaud / Merje Ottson ; kommenteerinud Kalev Männiste, Kaja Kübar, Enel Niin
Ottson, Merje
2011-01-01
Marutõvest ja marutaudist. Rebaste ja kährikute marutaudi vastase vaktsineerimise mõjust loomade arvukuse kasvutegurina ning nende põhjustatud ohust lindude, peamiselt metsislaste, ja näriliste arvukusele ning jahimeeste osast rebaste ja kährikute arvukuse piirajana.
Kulu- ja turupõhisest hinnakujundamise strateegiast turunduses / Mait Miljan, Kalev Kaarna
Miljan, Mait
2005-01-01
Tänapäevases ärikeskkonnas soovitavad autorid kasutada kombineeritud mudelit, milles rakendatakse kulu- ja turupõhist strateegiat lähtuvalt ettevõtte turusituatsioonist, tegevusvaldkonnast ning püütakse liikuda ühtse hinnakujundamiseni tarneahelas kui tervikus. Skeemid
Takistused ja tulemused piirangute teooria rakendamisel ettevõtete arendamiseks / Kalev Kaarna
Kaarna, Kalev
2005-01-01
Piirangute teooria on selgetel alustel põhinev juhtimiskontseptsioon, mis võtab arvesse ka inimkäitumist muutuste juhtimisel, keskendub ettevõtte tegevustulemuste hüppelisele paranemise saavutamisele läbi tegevuse fokuseerimise. Skeem. Tabel
Koppel, Kaido
2005-01-01
Ilmunud ka: VI Rural Parliament of Estonian Villages : July 21-23, 2005 in Lepanina, Pärnu County. Eestis rakendub Leader programm täies mahus Euroopa Liidu uuel eelarve perioodil ehk alates aastast 2007. Skeem: Maaelu arengu baas 2007-2013
Komissarov, Eha, 1947-
2013-01-01
Metallikunstnik Heino Mülleri 65. juubelile pühendatud ülevaatenäitusest. H. Mülleri sisekujundustöödest saab ülevaate T. Kohvi fotode abil, sepa tulist tööd ääsi taga näeb Anu Juuraku video vahendusel
I am a painting/Can't go on / Eha Komissarov, Maria-Kristiina Soomre, Marten Esko ja Liina Siib
Komissarov, Eha, 1947-
2015-01-01
Kunstiprojekti "Merike Estna ja mina kui maal" rahvusvahelisest maalinäitusest "Mina kui maal" Kumu Kunstimuuseumis ja eesti noorte kunstnike näitusest "Can't go on, must go on / Võimatu minna, kindlasti minna" Tallinna Kunstihoones 2014. a.
Viik, Kadi
2005-01-01
Sotsiaalministeeriumi soolise võrdõiguslikkuse osakonna juhataja Kadi Viik korraldab rahvusvahelise konverentsi "New Masculinity Tallinn 2005" (Uus mehelikkus). Lisaks nimekiri: Eesti nais(kultuuri)juhte
Benadie, Johan
2004-01-01
Eesti tööstusettevõtteid külastas tööstusettevõtetele suunatud koolitusprogrammi "20 Keys" eestvedaja. "20 Keys" aitab Benadie sõnul tööstusettevõte tootlikkust suurendada. Lisa: Mis on "20 Keys"
Metafüüsika magma pinnapealsuse shlaki all / Mati Sirkel ; interv. Kalev Kesküla
Sirkel, Mati
2004-01-01
Tõlkija Mati Sirkel oma raamatust "Orva-aastad". Ka tööst Eesti Kirjanike Liidu esimehena ning kirjaniku kohast ühiskonnas. Vastukaja: Vaher, Berk. Kas kirjanik vajab komissari? // Eesti Ekspress (2004) 5. aug., lk. B9
Parts, Juhan, 1966-
2007-01-01
Majandus- ja kommunikatsiooniminister Juhan Parts vastab oma visiidil Pärnusse nii Pärnu ettevõtlust, linna eduvalemit, kohalikku transpordiühendust, Rail Baltica projekti ning Pärnu lennujaama puudutavatele küsimustele. Lisa: CV
Kalev ja Rae vald tülitsevad tehase reovee pärast / Garel Püüa
Püüa, Garel
2006-01-01
Kalevi kommivabriku heitvee reostustase ületab kohati kümme korda tehase ehitamisel taotletud taset, Rae valla veepuhasti ei suuda nii suurt koormust taluda. Kalevi õigusteeninduse juhi Allan Viirma sõnul ei ole vald väljastanud Kalevile reovee eelpuhastite rajamiseks projekteerimistingimusi. Kommenteerib Rae vallavanem Raivo Uukkivi
Hääleõiguse piirang kapitaliühingu huvide kaitse abinõuna / Kalev Saare
Saare, Kalev, 1974-
2016-01-01
Seadusjärgse hääleõiguse piirangu vastavusest selle instituudi eesmärkidele. Seostest ühingu ja vähemusliikmete kaitse süsteemis, selle instituudi subjektilisest ulatusest, sisulisest ulatusest liikmega tehingu tegemise näitel ning hääleõiguse piirangu rikkumise õiguslikest tagajärgedest. Sisaldab asjakohast kohtupraktikat
Eesti tööstuse areng on vaid kohalike ettevõtjate kätes / interv. Raul Kalev
2008-01-01
Ilmunud ka: Postimees : na russkom jazõke : Tehnika i Proizvodstvo 9. juuni lk. 1,4-5. Vestlusringis Eesti tööstuse perspektiividest osalesid majandus- ja kommunikatsiooniminister Juhan Parts, lehtmetalli töötleva AS Favor omanik Almar Proos, AS Baltika juht Meelis Milder ja tööandjate keskliidu juht Tarmo Kriis
Saare, Kalev, 1974-
2003-01-01
Praktilise õiguselu seisukohalt ühest olulisimast küsimusest, milleks on eraõigusliku juriidilise isiku vastutus. Uus tsiviilseadustiku üldosa seadus tõi kaasa olulisi muudatusi juriidilise isiku õigusliku regulatsiooni osas
Evelin Ilves tegi transrasvadele ära
2010-01-01
Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kalev Chocolate Factory on nüüdseks kõigi oma maiustuste valmistamisel loobunud hüdrogeenimata taimsete rasvade kasutamisest
Tusov tegi sõber Kruudaga head äri / Agnes Ojala
Ojala, Agnes
2008-01-01
Kalev Real Estate Company (Kalev REC) müüs BCA Center OÜ OÜ-le Raldon. Kalevi õigusteeninduse juht Allan Viirma selgitab ettevõtte müümist. Vt. samas: Kalev Spordis jääb spordile vähem ruumi
Kruuda lahkub Kalevi tütarettevõtete juhi kohalt
2006-01-01
Vt. ka Postimees : na russkom jazõke 28. juuli lk. 4. AS-i Kalev suuromanik Oliver Kruuda lahkub Kalevi tütarettevõtete AS Kalev Chocolate Factory, AS Kalev Jõhvi Tootmine ja AS Vilma juhataja kohalt, tütarfirmade juhatuse esimeheks nimetatakse Kalevi senine müügi- ja teenindusdirektor Kati Kusmin
Vethal, Silje
2003-01-01
Sisu: "Astronaudid võivad rääkida, kui raske on seistes magada, ja kinnitatult ..." = "Astronauter kan fortalle hvor vanskelig det er åsove stående, og dessuten ..."; "Filosoof võib jutustada et ta kahlas kord teatud liiki lestakalade vahel kel ..." = "Filosofen kan fortelle at han en gang vasset blant en type små flyndrer som ..."; "Suvi veedetakse magades ..." = "En sommer tilbringes sovende ..."
Zájedová, Iivi, 1955-
2010-01-01
Artikkel põhineb uurimistööl väliseestlaste rahvatantsuharrastusest. Rahvatantsurühmade tekkimisest, rahvatantsu osast eestluse säilitamisel väliseestlaste seas. Eesti pagulaste tegevusest ja protsessidest Teise maailmasõja järgsel Saksamaal
Järg, Raul, 1973-
2009-01-01
Rakvere linna peaarhitekt, žürii liige Raul Järg rahvusvahelisest arhitektuurivõistlusest, mille ülesandeks oli pakkuda lahendus Rakvere Pauluse kiriku kasutuselevõtmiseks Arvo Pärdi muusikamajana ja kirikuesise väljaku ümberkujundamiseks, auhinnatud töödest. 1. preemia said Kristiina Aasvee, Kristiina Hussar ja Anne Kose (Celander Projekt)
Töö vastuvõtmine ja töövõtja vastutus ehitusvigade eest / Piia Kalamees, Kalev Saare, Karin Sein
Kalamees, Piia, 1983-
2010-01-01
Töö vastuvõtmise kohustusest, töö valmimise ja vastuvõtmise õiguslikust tähendusest ja mõjust, töövõtja vastutuse ulatusest ja vastutusmudeli erisustest, ehitustöö valmiduse määratlemisest. Eesti ja Saksamaa seaduste ja kohtupraktika võrdlev analüüs
Mändmaa, Kalev
2003-01-01
Huvide konflikti mõiste ja üldreeglid (Eesti, Euroopa Liit, Saksamaa, Austria, Ameerika Ühendriigid) ; erireeglid - tehingud ja rahalised suhted kliendiga (advokaat-klient tehingute üldreeglid), äriühingud kliendina, advokaaditasu hüvitamine kolmanda isiku poolt, endised kliendid, huvide konflikti laienemine kaastöötajatele ; huvide konflikti tagajärg
2009-01-01
Rakendusantropoloogia olemusest. Tartu Ülikooli Vijandi Kultuuriakadeemia projekti „Viljandimaa käsitööklastri väljaarendamine“ käigus tehtud välitööde tulemustest ja ümarlaua järeldustest. Viljandimaa käsitöömeistrite, eriti meeste traditsioonilise ehituse ja puutöönduse olukorrast ning käsitöövaldkonna arendamise võimalustest.
Noorkõiv, Kalev
2007-01-01
2008. aasta esimese jaanuari seisuga oli Eesti rahvaarv esialgse hinnangu kohaselt 1 340 600. Tabelid. Graafik. Vt. samas: Registreeritud rahvastikusündmused, detsember 2007 = Registered vital events, December 2007
Taruste, Tea
2011-01-01
Ehitusmaterjalide tootjate liidu tegevjuhi Enno Rebase hinnangul on ehitusmaterjalide hinnatõus vältimatu, sest sisendid lähevad kallimaks ja kokkuhoidu pole enam võimalik millegi arvel saavutada, kuid suuremat hinnatõusu võib takistada siseturu väike nõudlus. Vineeri hind on tõusnud 20-30%, OSB tõusis 15%
Kuidas kaasajal mõtestada rahvuslust? / ref. Urmi Reinde
2008-01-01
Keskerakonna noortekogu korraldatud konverentsil "Kuidas kaasajal mõtestada rahvuslust?" peetud ettekannete refereeringud: Edgar Savisaar, Leif Kalev, Ahto Lobjakas, Indrek Neivelt, Iris Pettai, Andrei Hvostov, Rein Ruutsoo
Evelin Ilves: Kalevi kommid on kräpp / Arvo Uustalu
Uustalu, Arvo, 1964-
2009-01-01
Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvhapete sisalduse pärast. Kommenteerivad ASi Kalev Chocolate Factory turundus- ja müügidirektor Monika Heinrand, suhtekorraldaja Ruth Roht ning toitumisteadlased Selma Teesalu, Mai Maser ja Tagli Pitsi. Vt. samas: Transrasvad põhjustavad rasvumist
Vilma lõpetab leivateo / Marko Suurmägi
Suurmägi, Marko, 1975-
2008-01-01
Vilma emafirma Kalev Chocolate Factory juhatuse liikme Mait Nilsoni sõnul jagab Kalev jahutoodete tegemise Jõhvi ja Viljandi ettevõtte vahel nii, et leiba ja saia hakatakse küpsetama Jõhvis ning Viljandisse koondub tortide, kookide ja jahusegude valmistamine. Lisa: Ajalugu
Taanduva Kruuda asemele astub ambitsioonikas Kusmin / Harry Tuul
Tuul, Harry
2006-01-01
Ilmunud ka: Delovõje Vedomosti 2. aug. lk. 7. Kalevi müügi- ja teenindusdirektor Kati Kusmin asub juhtimisest taanduva Oliver Kruuda asemele Kalevi tütarfirmade AS-i Kalev Chocolate Factory, AS-i Vilma ja AS-i Kalev Jõhvi Tootmine juhatuses. Lisa: Kati Kusmini CV. Vt. samas: Kruuda: taandun suuresti isiklikel põhjustel
Kruuda ostab Werolit Sõõrumaa abil / Martin Hanson
Hanson, Martin, 1984-
2006-01-01
Kondiitritööstus Kalev teatas, et sõlmis kokkuleppe U.S. Invest AS-iga, mille kohaselt AS Kalev omandab 50% suuruse osaluse Weroli aktsiatele kõrgeima pakkumise teinud Dovelin Baltic OÜ-s, mis kuulub Urmas Sõõrumaale
Fourth Generation War: Paradigm for Change
2005-06-01
PARADIGM FOR CHANGE by Ghanshyam Singh Katoch June 2005 Thesis Advisor : Kalev Sepp Second Reader...Approved by: Kalev Sepp Thesis Advisor Douglas Borer Second Reader Gordon McCormick Chairman, Department of Defense...combination of all the resources of the government, not just the army. d. Economy of Effort A Robo -Soldier is a small, tracked, electrically powered vehicle
Saare, Kalev, 1974-
2017-01-01
Vähemusosaluse omajate võimalustest enamusosalejate passiivsuse, vastuseisu, lubamatu hääletamisel osalemise või hääletustulemuste ebaõige tuvastamise korral kapitaliühingu huvidele vastava otsuseni jõudmiseks. Sisaldab asjakohast kohtupraktikat ja võrdlust Saksa õigusega
Kalberg, Martin
2006-01-01
Üüri suuruse ajalooline ülevaade ja võrdlus, üüri suurus eluruumi üürilepingu olulise osana, üüri ühepoolse suurendamise võimalused, üürniku vaidlustamisvõimalused üüri suurendamise korral
Edgari paralleelne ühiskond / Argo Ideon
Ideon, Argo, 1966-
2008-01-01
Autor leiab, et Keskerakonna esimees Edgar Savisaar on rajamas omaenda suveräänset maailma, ning toob selle kohta näiteid: vapimärgid vs teenetemärgid, vabaduskell vs vabadussammas, Kalev Sport vs ETV
Linnastumist hakatakse uurima kosmosest = Urbanisation will be studied from space / Piret Tali
Tali, Piret, 1972-
2014-01-01
Tartu Ülikooli füüsikud Kaupo Voormansik ja Karlis Zalite ning geograaf Kalev Koppel on loonud veebikaardi, mis aitab uurida linnastumist. Andmeid hakkab koguma Euroopa Komisjoni satelliit Sentinel-1
Koda = Koda / Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto ; kommenteerinud Katrin Koov
Mark, Ülar, 1968-
2016-01-01
Minimalistliku vormiga eramu KODA Tallinnas, Järvekalda tee 33. Autorid Ülar Mark, Taavi Jakobson, Hannes Tamjärv, Kalev Ramjalg, Marek Strandberg. Arhitektid Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto, Hannes Praks
99% maaelu arengukavast võib saada heakskiidu / Heli Raamets
Raamets, Heli, 1975-
2007-01-01
Maaelu arengukava (MAK), mille alusel jagataks Eestile 14,5 miljardit krooni, ootab novembris Euroopa Liidu heakskiitu. Vt. samas: Euroopa Liidu maaelu arengukavadest; Kommenteerivad: Kalev Kreegipuu, Kaul Nurm, Silvia Lotman, Margus Timmo
Bez kota mõsham razdolje / Jevgeni Kapov
Kapov, Jevgeni
2004-01-01
Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme
Uus omanik liidab Kalevi vabriku Poola tehasega / Andrus Karnau
Karnau, Andrus
2007-01-01
Kommivabriku Kalev ja piimatööstuse Tere uus omanik Indrek Rahumaa kavatseb ettevõtted liita Poola kommivabrikuga Mieszko ja Läti piimakombinaadiga Piensaimnieks, mille on ostnud Rahumaa enamusosalusega investeerimisfirma Alta Capital Partners. Lisa: CV
PR, patriotism ja olupoliitika / Evi Arujärv
Arujärv, Evi, 1953-
2009-01-01
Proua Evelin Ilves kritiseeris kommivabriku Kalev toodangut transrasvade sisalduse pärast. Artikli autor analüüsib sellest hargnenud üldrahvalikku muljetevahetust kui väärtusmaailmade kokkupõrget
Kaasaegse kunsti muuseum suurendab panuseid - Köler Prize / Hanno Soans
Soans, Hanno, 1974-
2011-01-01
Eesti Kaasaegse Kunsti Muuseumi loodud kaasaegse kunsti preemiast. 6. juunini EKKM-is avatud Köler Prize 2011 nominentide - Dénes Kalev Farkas, Tõnis Saadoja, Timo Toots, Sigrid Viir, Jevgeni Zolotko - näitusest
Ainult parim võidab / Martin Rünk
Rünk, Martin, 1982-
2011-01-01
Köler Prize 2011 nominentide (Dénes Kalev Farkas, Tõnis Saadoja, Timo Toots, Sigrid Viir, Jevgeni Zolotko) näitus Eesti Kaasaegse Kunsti Muuseumis 5. juunini. Esimest aastat väljaantavast autasust
Köler värskele kunstile / Anders Härm ; intervjueerinud Kadri Karro
Härm, Anders, 1977-
2011-01-01
Köler Prize 2011 nominentide (Dénes Kalev Farkas, Tõnis Saadoja, Timo Toots, Sigrid Viir, Jevgeni Zolotko) näitus Eesti Kaasaegse Kunsti Muuseumis 30. aprillist 5. juunini. Preemia asutamisest ja nominentide valikust
Tartu meer õigustab küsitavat maatehingut / Laine Jänes ; interv. Andrus Karnau
Jänes, Laine, 1964-
2007-01-01
Tartu linnapea vastab küsimustele, mis on seotud Tartu linnavalitsuse maadevahetuse tehinguga Reformierakonnaga seotud ettevõtjate Verni Loodmaa, Kalev Kase ja Alar Kroodo firmaga Kvintett Kinnisvara
Kaitsevägi pani printerikulu summaga kümme korda mööda
2014-01-01
Vastukaja 8. mail Eesti Päevalehes ilmunud artiklile "Tahad rahu, muretse printer". Artiklit kommenteerivad Kaitseväe logistikakeskuse ülem kolonelleitnant Kalev Koidumäe ja peaminister Taavi Rõivas
Suurtootjad veavad Rae vallaga vägikaigast vee pärast / Villy Paimets
Paimets, Villy, 1972-
2007-01-01
Rae valla veefirma AS Elveso on vaidlustes magusavabriku Kalev, kaupluseketi Rimi suurköögi ja pelmeenitootjaga Uvic, süüdistades ettevõtteid heitvee liigses reostamises. Lisa: Taust; Uvicil pole probleeme
Rae nahaalne skeem soosis lemmikuid / Nils Niitra
Niitra, Nils, 1975-
2007-01-01
Tartu linnavalitsuse maadevahetuse tehingust Reformierakonnaga seotud ettevõtjate Verni Loodmaa, Kalev Kase ja Alar Kroodo firmaga Kvintett Kinnisvara. Skeem: Maadevahetus linnavalitsuse tagatoas. Vt. samas: Lihtinimest ähvardab sundvõõrandamine
KIK pidas sünnipäeva / Endrik Tõnsberg
Tõnsberg, Endrik
2005-01-01
11. mail 2005. a. andsid Keskkonnainvesteeringute Keskuse viienda sünnipäeva puhul ajakirjanikele pressikonverentsi KIK-i nõukogu esimees, keskkonnaminister Villu Reiljan, KIK-i juhataja Kalev Aun ja programmijuht Heiko Põdersalu
Alessi : unistuste vabrik : 8 / Alberto Alessi
Alessi, Alberto
1999-01-01
Itaalia firma Alessi juures töötavate firmade Battista Piazza ja Tendentse toodangust. Alessandro Mendini projektist: 1992. a. anti standardne vaas kujundada sajale kunstnikule (nende hulgas Kalev Mark Kostabi). 30 illustratsiooni
Jõulukaartide karm olelusvõitlus / Anneli Aasmäe
Aasmäe, Anneli, 1973-
2001-01-01
Eesti kunstnike kujundatud postkaartide valmistamise võimalused tänapäeva Eestis. Turu on vallutanud Hallmark Cards. Jõulukaartide saatmise kombest. Kommivabriku "Kalev" joonistusvõistluse võitis Margus Krassi kaart
Ehe seep Eesti moodi / Anneli Aasmäe
Aasmäe, Anneli, 1973-
2008-01-01
Produtsent Kristian Taska Kalev Spordis näidatav Venezuela seebiseriaali Eesti oludele mugandatud variant "Kalevi naised" : lavastaja Ingomar Vihman : osades Andrus Vaarik, Anne Reemann, Piret Kalda, Ken Saan jt.
Neudorf, Raigo
2010-01-01
AS-i Kalev Chocolate Factory osta sooviv Orkla kontrerni esindajate kinnitusel hakatakse edaspidi toodangut eksportima nii Balti- kui Põhjamaadesse. Enne varade üleminekut uuele omanikule tuleb ära oodata Kalevi aktsiate aresti alt vabanemine. Diagramm
Karner, Kadrin
2011-01-01
Orkla Group'i majandusaasta aruande kohaselt müüs Oliver Kruuda suurosalusega Luterma 2010. a. mais Kalev Chocolate Factory ja küpsisetootmise Norra taustaga toidukontsernile ligi 33 miljoni euro eest
Alvela, Ain, 1967-
2011-01-01
Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik
Keskerakond võitles töörahva õiguste eest kella kaheni öösel / Andrus Karnau, Artur Sadovski
Karnau, Andrus
2008-01-01
Töölepinguseaduse eelnõu teisest lugemisest riigikogus. Lisatud: töölepinguseaduse uuendused ; Kaire Uuseni intervjuu Kalev Chocolate Factory personalijuhi Kärt Kirsoga: Ettevõtjad aimavad töövaidluste arvu kasvu
Leil on kõva! : dokumentaalne lugemisdraama neljas pildis. Volüüm 2 / Madis Jürgen
Jürgen, Madis, 1962-
1999-01-01
Miks tahavad poliitikud Sauna tänavale teatrit? Tegelased: Krista Siilats, Jaan Tamm, Signe Kivi, Jüri Kuuskemaa, Margus Allikmaa, Krista Kodres, Kalev Kallo, Tiina Mägi, Silvi Lindma-Pihlak, Eino Baskin, Mart Laar.
Coaching näitab töötajast hoolimist / Urve Vilk
Vilk, Urve
2012-01-01
Konverentsil "Arengukompass 2012: uue ajastu organisatsiooni arendusvahendid" esinenud juhtimiskoolitaja ja sertifitseeritud coach'i Ivar Lukki, Elioni tehnoloogiadirektori Kalev Reiljani ja superviisori Katrin Aava Tallinna Ülikoolist sõnavõttudest
Golõshom i publitshno / Sofja Bauer, Tiia Linnard
Bauer, Sofia, 1947-2001
1998-01-01
Ida-Virumaa kunstnike kevadnäitusest Jõhvis, kujundas Aleksandr Igonin. Tutvustatakse osalevaid kunstnikke : Kalev Prits (Pump), Aleksandr Igonin, Aira ja Mati Rautso, Ljudmila Maisurjan, Andres Malõgin, Irja Annus, Juri Horev jt.
Kaks mõrva ühes mesilasperes ehk laibarida ei tule / Lauri Tabur ; interv. Enno Tammer
Tabur, Lauri, 1974-
2005-01-01
Keskkriminaalpolitsei ülem vastab küsimustele, mis puudutavad Tallinna koolitüdruku Veronika Dari, eestikeelse allilma väidetava liidri Kalev Kure ning ärimees Kauri Koppeli mõrvu Tallinnas. Lisa: Kiirarvamus
Kes on šõuilma tuntuimad (pool)eestlased? / Priit Pullerits
Pullerits, Priit, 1965-
2009-01-01
Eesti päritolu maailmas tuntud meelelahutusmaailmas osalejatest (Mena Suvari, Ornella Muti, Miliza Korjus, Kalev Mark Kostabi, Edmund Valtman, Erika Eleniak, Alar Kivilo, Ants Robert Kristian Luuk, Sonny Arahanga jt)
Maksuameti eksjuht ostis 66000kroonise Picasso
1999-01-01
Modernistliku kunsti klassikute näituselt galeriis "Vaal" osteti kaks Picasso keraamilist teost: "Curly Hair Face" omandas 66000 krooni eest Kalev Järvelill ja "Man's Face" 33000 krooni eest ERA-Panga pankrotihaldur Veli Kraavi.
Mütsiga lüües : kuidas väärikalt vananeda? / Imbi Jeletsky
Jeletsky, Imbi
2007-01-01
Vt. ka Kesknädal 21. nov., lk. 12. ETV saates "Vabariigi kodanikud" arutleti vananemise teemal. Stuudios olid kirjanik Maimu Berg, rahvastikuteadlane Kalev Katus ja kunstnik Heinz Valk, saatejuht oli Aarne Rannamäe
Meeleolumaailma peegel / Jan Piotrowski
Piotrowski, Jan
2011-01-01
Inimkäitumise ettearvamatusest ja ennustatavusest, meeleoluanalüüsist. Kalev Leetaru (Illinoisi ülikool) revolutsioonide ennustamise võimalikkusest. Osama bin Ladeni tõenäolise asukoha avastamisest
Pragmaatika kui hea kunsti garant / Indrek Grigor
Grigor, Indrek, 1981-
2007-01-01
Tartu Kõrgema Kunstikooli diplomitöödest: Martti Poomi (S'Poom "Na'Miin") ja Asko Kikkuli (Iconcrash "My Sky") muusikavideotest, Kaisa Eiche teoreetilisest uurimusest "Kultuuritehase vajalikkus ja teostatavus Tartus", Carl-Christian Frey animafilmist "Pärastlõuna", Andrus Lauringsoni installatsioonist "Capaskoop", Berit Talpsepa robootilisest skulptuurist "Superheterodüünvastuvõtt", Eike Epliku installatiivsest skulptuurist "Ma saan aru, et ma ei ole orav", Anna-Stina Treumundi fotoinstallatsioonist "Vaikiv dialoog", Kalev Vapperi sotsiaalkollaazhist "Vapper Kalev lõpetab kooli"
USAs avati suurim Balti kunsti näitus / Neeme Raud
Raud, Neeme, 1969-
2002-01-01
New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp
Eesti kunstnikud pidid teosed hõlma all Moskvasse toimetama / Vahur Koorits, Ksenia Repson
Koorits, Vahur, 1981-
2008-01-01
Eesti kunstnike näitus "Paradise is not lost" Moskvas Zurab Tsereteli galeriis, kuraator Eha Komissarov. Vene tolliametnikud ei tahtnud lubada üle piiri Raul Meele ja Villem Jahu teoseid, kuna pidasid neid poliitiliselt sobimatuteks. Kommenteerib Eha Komissarov. Samal teemal ka Ksenia Repsoni repliik "Näitus kogub külastajaid"
Modeling and controller design on ARX model of Electro-Hydrolic ...
African Journals Online (AJOL)
Electro-hydraulic actuator (EHA) is commonly used in industry for its linear movement, quick response and accurate positioning of heavy loads. However, the uncertainties, highly nonlinearities and time varying characteristic of EHA caused difficulties in controlling the system. This paper studies the performance of Fuzzy PID ...
Directory of Open Access Journals (Sweden)
Siti Nurul Ain Md Jamil
2014-09-01
Full Text Available A synthesis of acrylonitrile (AN/butyl acrylate (BA/fumaronitrile (FN and AN/EHA (ethyl hexyl acrylate/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS and potassium persulphate (KPS as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg and stabilization temperature was studied using Differential Scanning Calorimetry (DSC. The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA and FN were 55%–71%, 85%–91% and 76%–79%, respectively. It was found that with the same comonomer feed (10%, the Tg of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C. AN/EHA/FN terpolymer also exhibited a lower Tg at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C. By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%. It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C. In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1% and AN/EHA copolymer (38.0%.
Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak
2014-09-01
A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (T g ) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermogravimetric Analysis. The conversions of AN, comonomers (BA and EHA) and FN were 55%-71%, 85%-91% and 76%-79%, respectively. It was found that with the same comonomer feed (10%), the T g of AN/EHA copolymer was lower at 63 °C compared to AN/BA copolymer (70 °C). AN/EHA/FN terpolymer also exhibited a lower T g at 63 °C when compared to that of the AN/BA/FN terpolymer (67 °C). By incorporating BA and EHA into a PAN system, the char yield was reduced to ~38.0% compared to that of AN (~47.7%). It was found that FN reduced the initial cyclization temperature of AN/BA/FN and AN/EHA/FN terpolymers to 228 and 221 °C, respectively, in comparison to that of AN/BA and AN/EHA copolymers (~260 °C). In addition, FN reduced the heat liberation per unit time during the stabilization process that consequently reduced the emission of volatile group during this process. As a result, the char yields of AN/BA/FN and AN/EHA/FN terpolymers are higher at ~45.1% and ~43.9%, respectively, as compared to those of AN/BA copolymer (37.1%) and AN/EHA copolymer (38.0%).
Lee, Sang-Woon; Kim, Seong-Gon; Balázsi, Csaba; Chae, Weon-Sik; Lee, Hee-Ok
2012-03-01
The objective of this study was to evaluate the physical properties of synthetic hydroxyapatite (sHA) and hydroxyapatite from eggshells (eHA) by Fourier-transform infrared (FT-IR) and x-ray diffraction (XRD) and to compare the regenerative ability of the bone using sHA and eHA in a rabbit calvarial defect model. FT-IR and XRD were used to compare the physical properties of sHA and eHA. sHA was purchased from Sigma, and eHA was kindly donated from the Hungarian academy of science. Sixteen New Zealand white rabbits were used for the animal study. After the formation of a bilateral parietal bony defect (diameter 8.0 mm), either sHA or eHA was grafted into the defect. The defect in the control was left unfilled. Bone regeneration was evaluated by histomorphometry at 4 and 8 weeks after the operation. The peak broadening of the XRD experiments were in agreement with scanning electron microscope observation; the sHA had a smaller granule size than the eHA. The eHA had impurities phases of CaO (International Center for Diffraction Data (ICDD) 075-0264) and Ca(OH)(2) (ICDD 072-0156). Total new bone was 17.11 ± 10.24% in the control group, 28.81 ± 12.63% in sHA group, and 25.68 ± 10.89% in eHA group at 4 weeks after the operation. The difference was not statistically significant (P > .05). Total new bone at 8 weeks after the operation was 27.50 ± 10.89% in the control group, 38.62 ± 17.42% in sHA group, and 41.99 ± 8.44% in the eHA group. When comparing the sHA group to the control group, the difference was not statistically significant (P > .05). However, the eHA group was significantly different from the control group (P = .038). When comparing the eHA group to the sHA group, the difference was not statistically significant (P > .05). Both types of HA showed higher bone formation than the unfilled control. However, eHA had significantly higher bone formation than the unfilled control at 8 weeks after operation. Copyright © 2012 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Brund, René B. Korsgaard; Rasmussen, Sten; Nielsen, Rasmus O.
2018-01-01
Weak hip abductors may be related with increased hip adduction and knee abduction angular movement, which may be risk factors of lower extremity injuries. As the role of eccentric hip abduction strength (EHAS) on hip adduction angular movement and knee abduction angular movement (KABD) remains...... and Codamotion active marker system. Using multiple linear regression models (n=186 legs), no relationships between EHAS and hip and knee kinematics were found. A possible reason for the lack of relationship between EHAS and hip and knee kinematics may be owing to differences in the running kinematics. Some...
Oliver Kruuda müüb salaja Kalevi ja Tere / Piret Reiljan, Kristina Traks, Virge Lahe
Reiljan, Piret, 1983-
2007-01-01
Ilmunud ka: Delovõje Vedomosti 26. sept. lk. 9. Suuromanikud Oliver Kruuda, Heino Priimägi ja Aare Annus otsustasid müüa kondiitritööstuse Kalev ja piimatööstuse Tere investeerimisettevõttele Alta Capital ning keskenduda meediale ja kinnisvarale. Vt. samas: Kalevi aktsionäre oli koosolekul vaid käputäis; Finantsinspektsiooni kommentaar; Alta Capital; Diagramm: Kalev AS-i tütarfirmade käibed. Kommenteerivad Alari Purju, Heldur Meerits ja Toomas Kivimägi
Multiple Sclerosis in a Nigerian Alcoholic Male: A Case Report from ...
African Journals Online (AJOL)
Uche
Background: Multiple sclerosis is a rare neurological disorder in black Africans. In Nigeria it had been ... and intracerebral white matter hyper-intensities on magnetic resonance imaging. ... life in Eha-Alumona, a rural community in Enugu state.
Tallinna Rahvaülikool kutsub kõiki uuele algavale kursusele "Kunstikriitikute lemmikud"
2005-01-01
Loengusari: 9. II - Eha Komissarov "Popkunstnik Andy Warhol"; 16. III - Anders Härm "Saksa performance'i-kunstnik Joseph Beuys"; 23. III - Hanno Soans "Inglise maali- ja installatsioonikunstnik Martin Creed (sünd. 1968, Wakefield)"
PR-teenuse hind tõuseb 20% / Eda-Liis Kann
Kann, Eda-Liis, 1979-
2004-01-01
Suhtekorraldusfirmad prognoosivad aasta teiseks pooleks PR-teenuste 20protsendilist hinnatõusu. Kommenteerivad Kersti Luha, Maren Pärn, Ingrid Eha, Maria Raudsepp, Heidi Pihlak ja Rein Meripõld. Lisa: Väikefirmale on PR-teenus kallis
2007-01-01
Uutest kunstiraamatutest "Meistriteoste lummus. Koopia 19. sajandil" (koostaja Tiina-Mall Kreem), "Priit Pärn" (koostaja Eha Komissarov), "Henn Roode. Modernist saatuse kiuste" (koostaja Kädi Talvoja)
Gorod polutshit novõi avtobusnõi terminal / Urmas Tooming
Tooming, Urmas
2008-01-01
Tallinnasse Hobujaama ja Ahtri tänava nurgale ehitatakse kinnine bussiterminal ja ärihoone. Eskiisprojekti koostasid Madis Eek ja Reio Avaste arhitektuuribüroost Eek & Mutso. Kommenteerib Eha Võrk
Radikaalsus muuseumi kaitsva teki all / Mari Sobolev
Sobolev, Mari, 1968-
2004-01-01
Rotermanni soolalaos avatud Marco (Marko) Laimre isiknäituse "Küsimused ja vastused" puhul 13. IV toimunud konverentsist. Johannes Saare, Eha Komissarovi, Hanno Soansi, Anders Härmi ja Mari Sobolevi ettekannetest
The European Hematology Association Roadmap for European Hematology Research : A consensus document
Engert, Andreas; Balduini, Carlo; Brand, Anneke; Coiffier, Bertrand; Cordonnier, Catherine; Döhner, Hartmut; de Wit, Thom Duyvené; Eichinger, Sabine; Fibbe, Willem; Green, Tony; de Haas, Fleur; Iolascon, Achille; Jaffredo, Thierry; Rodeghiero, Francesco; Salles, Gilles; Schuringa, Jan Jacob
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology
"Ema, vaata, ma olen Kumus!" / Teet Veispak
Veispak, Teet, 1955-
2010-01-01
Näitus "Muutuv maalikunst" Kumu Kunstimuuseumis 14. maist 10. oktoobrini 2010. Kuraator Eha Komissarov, kujundaja Urmas Muru. Lähemalt Jaan Toomiku, Tõnis Saadoja, Merike Estna, Alice Kase maalidest ning Kiwa projektist "Eklektika"
Excuse me, are you the last here? / Hanno Soans
Soans, Hanno, 1974-
2003-01-01
Rotermanni soolalaos 2003 a. sügisel toimunud rahvusvahelisest näitusest "Viimane kangelane", kus oma nägemust kangelasest tutvustab 23 kunstnikku Ida-Euroopast. Kuraatorid Hanno Soans ja Eha Komissarov
Annad Miksikesele sõrme, võtab terve käe / Sirje Tohver
Tohver, Sirje, 1948-
2005-01-01
Miksikese õppekeskkonnast ja online-kontrolltöödest erinevate Eesti koolide näitel. Kogemusi jagavad õpetajad: Age Tamm, Eha Kaukvere, Tiia Salm, Kaja Kiis, Mare Kütt, Lemme Sulaoja, Annika Lõhmus
Kui palju tuleb juhitöös tegeleda "pean" ja "tahan" tegevustega?
2003-01-01
Vastavad Fontes Grupi Nõukogu esimees Tõnis Arro, Aeroc AS-i juhatuse esimees Ivar Paplavskis, Eesti Ehitusettevõtjate Liidu tegevdirektor Tarmo Lige, American Toursi tegevdirektor Anu Eha ja Esmofoni juhatuse esimees Aivar Sirelpuu
The National Representation Beauty Contest / Karolina Łabowicz-Dymanus
Łabowicz-Dymanus, Karolina
2011-01-01
Näitus "The Art of Estonia - Adapting Modernity / Provocations and Confrontations" Szczecini Rahvusmuuseumis kuni 27.veebr. 2011 ja Varssavi Rahvusmuuseumis kuni 04. juulini 2011. Kumu Kunstimuuseumi korraldatud näituse kuraatorid Tiina Abel ja Eha Komissarov
Jamil, Siti Nurul Ain Md; Daik, Rusli; Ahmad, Ishak
2014-01-01
A synthesis of acrylonitrile (AN)/butyl acrylate (BA)/fumaronitrile (FN) and AN/EHA (ethyl hexyl acrylate)/FN terpolymers was carried out by redox polymerization using sodium bisulfite (SBS) and potassium persulphate (KPS) as initiator at 40 °C. The effect of comonomers, BA and EHA and termonomer, FN on the glass transition temperature (Tg) and stabilization temperature was studied using Differential Scanning Calorimetry (DSC). The degradation behavior and char yield were obtained by Thermog...
Directory of Open Access Journals (Sweden)
Yongling FU
2018-03-01
Full Text Available Electrohydrostatic actuator (EHA is a type of power-by-wire actuator that is widely implemented in the aerospace industry for flight control, landing gears, thrust reversers, thrust vector control, and space robots. This paper presents the development and evaluation of position-based impedance control (PBIC for an EHA. Impedance control provides the actuator with compliance and facilitates the interaction with the environment. Most impedance control applications utilize electrical or valve-controlled hydraulic actuators, whereas this work realizes impedance control via a compact and efficient EHA. The structures of the EHA and PBIC are firstly introduced. A mathematical model of the actuation system is established, and values of its coefficients are identified by particle swarm optimization. This model facilitates the development of a position controller and the selection of target impedance parameters. A nonlinear proportional-integral position controller is developed for the EHA to achieve the accurate positioning requirement of PBIC. The controller compensates for the adverse effect of stiction, and a position accuracy of 0.08 mm is attained. Various experimental results are presented to verify the applicability of PBIC to the EHA. The compliance of the actuator is demonstrated in an impact test. Keywords: Actuation system, Aerospace, Electrohydrostatic actuator, Force control, Nonlinear dynamics, Particle swarm optimization, Position control
Wang, Xingjian; Shi, Cun; Wang, Shaoping
2017-07-01
Hybrid actuation system with dissimilar redundant actuators, which is composed of a hydraulic actuator (HA) and an electro-hydrostatic actuator (EHA), has been applied on modern civil aircraft to improve the reliability. However, the force fighting problem arises due to different dynamic performances between HA and EHA. This paper proposes an extended state observer (ESO)-based motion synchronisation control method. To cope with the problem of unavailability of the state signals, the well-designed ESO is utilised to observe the HA and EHA state variables which are unmeasured. In particular, the extended state of ESO can estimate the lumped effect of the unknown external disturbances acting on the control surface, the nonlinear dynamics, uncertainties, and the coupling term between HA and EHA. Based on the observed states of ESO, motion synchronisation controllers are presented to make HA and EHA to simultaneously track the desired motion trajectories, which are generated by a trajectory generator. Additionally, the unknown disturbances and the coupling terms can be compensated by using the extended state of the proposed ESO. Finally, comparative simulation results indicate that the proposed ESO-based motion synchronisation controller can achieve great force fighting reduction between HA and EHA.
"on yks niisugune film..." : [luuletused] / [Mesikepp, Indrek] fs
fs, pseud., 1971-
2007-01-01
Sisu: "on yks niisugune film..." ; "kui kord Kalev koju jõuab..." ; "niisiis te arvate kõike teadvat..." ; "ytle mulle ausalt kastead..." ; "they are so bleak..." ; "yhel ööl ma tajusin surma..." ; "ma tundsin et see või veel juhtuda..." ; "kui kylm alumiiniumist joon..."
Üliõpilasteatrid peavad Itaalias kongressi
2006-01-01
Itaalia väikelinnas Urbinos lõpeb 27. juulil sealse ülikooli teatri Teatro Aenigma ja Rahvusvahelise Üliõpilasteatrite Assotsiatsiooni koostöös kuues tudengiteatrite maailmakongress. Eestist osaleb ja peab ettekande lavastaja ja Tartu Üliõpilasteatri kunstiline juht Kalev Kudu
Arco Vara laieneb Bulgaariasse
2006-01-01
Alates juunist tegutseb Bulgaarias Arco Vara Gruppi kuuluv maaklerfirma Arco Imoti EOOD, mis tegutseb rahvusvahelise kaubamärgi ARCO Real Estate all. Bulgaariasse on Eesti ettevõtetest oma tegevust laiendanud ka varahaldusfirma Delta Imoti Capital ja Kalev Real Estate Company kinnisvaraarendusega tegelev tütarettevõte Stude REC EOOD
Neli vaadet tuumale ja näivusele / Märt Väljataga
Väljataga, Märt, 1965-
2009-01-01
Arvustus: Tuglas, Friedebert. Valik proosat / koostanud ja saatetekstid kirjutanud Jaan Undusk. Tallinn : Avita, 2009 ; Nietzsche, Friedrich. Tragöödia sünd. Tallinn : Tänapäev, 2009 ; Kesküla, Kalev. Elu sumedusest. Tallinn : Tuum, 2009 ; Sirkel, Mati. Uued orva-aastad. Kommentaarium. Tallinn : Tuum, 2009
Brest-Litovski rahuleping ja Vladimir Putin / Küllo Arjakas
Arjakas, Küllo, 1959-
2005-01-01
Autor selgitab Venemaa presidendi Vladimir Putini möödalaskmisi ajalooküsimuste käsitlemisel 10. mail Moskvas toimunud pressikonverentsil. Bresti rahukõneluste ja rahulepingu ajaloost. Vt. samas: Kalev Vilgats. Vene presidendi must-valge maailm
Kiviõli politsei jättis hätta neli korda abi palunud mehe / Frank Sprenk-Dorn
Sprenk-Dorn, Frank
2004-01-01
Kiviõli lähistel Erra külas kolm autovarast kinni pidanud Mati Vilumets süüdistab politseid tema väljakutsetele reageerimata jätmises, politsei hinnangul ei olnud tema kõned üheselt mõistetavad. Kommenteerib Ida politseiprefekt Kalev Prillop
Naised käsu korras firmade juhatusse! Jah või ei? / Kairi Alt, Aveli Kippari, Karl Koort... [jt.
2011-01-01
Küsimusele vastavad Columbus IT Partner Eesti AS personalijuht Kairi Alt, Stele ja Riveli omanik Aveli Kippari, AS Panaviatic'i turundusjuht Karl Koort, OÜ Tarkvara Tehnoloogia Arenduskeskuse tegevjuht Indrek Vainu, AS PricewaterhouseCoopers auditiosakonna direktor Eva Jansen, Kalev Chocolate Factory tootmisjuht Hardo Reinike
"Kalevi naised" - komöödia, kus nalja ei tehta / Verni Leivak
Leivak, Verni, 1966-
2008-01-01
Produtsent Kristian Taska filmib Jüri tehnopargis Kalev Spordis näitamiseks Venezuela seebiseriaali Eesti oludele mugandust "Kalevi naised" (lavastaja Ingomar Vihman, telerežissöör Hermes Brambat, osades Maria Avdjuško, Andrus Vaarik, Jan Uuspõld, Britta Vahur, Ken Saan jt)
Ettevaatust! Sünnib Eesti esimene päris telenovela / Mart Niineste
Niineste, Mart, 1983-
2008-01-01
Produtsent Kristian Taska filmib Jüri tehnopargis Kalev Spordis näitamiseks Venezuela seebiseriaali Eesti oludele mugandust "Kalevi naised" (lavastaja Ingomar Vihman, osades Maria Avdjuško, Toomas Zupping, Jan Uuspõld, Britta Vahur, Ken Saan jt). Filmivõtetelt
Tonto, Kadri
2016-01-01
Minimalistliku vormiga eramu KODA. Kontseptsiooni autorid Ülar Mark, Taavi Jakobson, Hannes Tamjärv, Kalev Ramjalg, Marek Strandberg; arhitektid Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto, Hannes Praks. Eesti Arhitektide Liidu preemia "Väike 2013-2015" laureaat
Faced with an alternative : A failed submarine deal / Magnus Ilmjärv
Ilmjärv, Magnus, 1961-
2007-01-01
Saksamaa soovist osta Eestilt allveelaevad Kalev ja Lembit. Kartus avaliku arvamuse, ühe osa sõjaväelaste ja ka Nõukogude Liidu reaktsiooni ees ning maa okupeerimine Nõukogude Liidu poolt olid põhjused, miks allveelaevade Saksamaale mahamüümine ei õnnestunud
AGG Maailmameistrivõistluste eel
2008-01-01
12.-14. juunini toimuvad Torontos Aesthetic Group Gymnastics (AGG) maailmameistrivõistlused Toronto Ülikooli võimlemiskeskuses. Nende võistluste korraldamise raske ülesande on võtnud oma õlule Kanada eestlaste võimlemisklubid Kalev Estienne ja Ritmika vastavalt Evelyn Koobi ja Annely Riga juhtimisel
Ostetud lõputööga saaks ülikoolidiplomi kätte küll / Kristi Leppik
Leppik, Kristi
2008-01-01
Plagiaadist, autoriõigusest ja lõputööde ostmisest ajakirjandusliku eksperimendina korraldatud õigusteaduse bakalaureuse lõputöö hankimise näitel Kommenteerivad Tallinna Tehnikaülikooli ehitusteaduskonna dekaan Roode Liias, Akadeemia Nord õigusteaduste dekaan Aare Kruuser, Tartu Ülikooli majandusteaduskonna arenduspordekaan Jüri Sepp, Tallinna Ülikooli riigireaduste instituudi direktor Leif Kalev
Short outlines of books by Estonian authors / Janika Kronberg and Rutt Hinrikus
Kronberg, Janika, 1963-
2010-01-01
Arvustus: Käsper, Kalle. Buridanid. I-V. Tallinn : Eesti Keele Sihtasutus, 2005-2010 ; Kivastik, Mart. Eesti asjad. Tartu : Kaks Musketäri, 2010 ; Kangro, Maarja. Ahvid ja solidaarsus. Tallinn : Eesti keele Sihtasutus, 2010 ; Põder, Rein. Unustatud. Tallinn : Eesti Raamat, 2010 ; Kesküla, Kalev. Elu sumedusest. Tallinn : Tuum, 2009 ; Pilv, Aare. Ramadaan. Tallinn : Tuum, 2010
"Su mõte on see, mida elad" : vanadus / Kaire Nurk
Nurk, Kaire, 1960-
2005-01-01
Reet Varblase kuraatoriprojektist "Homo grandis natu" Tallinna Kunstihoones kuni 15. V. Tallinna Kunstikooli õpilaste (õpetaja Katrin Tukmann), Katarzyna Kozyra, Eveli Variku, Marge Monko, Piia Ruberi & Doris Kareva ja Mare Mikofi töödest, Tallinna Ülikooli audiovisuaalkunsti osakonnas tehtud filmidest (Elen Lotman, Jaak Kilmi, Kalev Hiller)
Ledjanõje kopii izvestnõh pamjatnikov pojavilis v Tartu
2007-01-01
Kuus meeskonda Tartu Kõrgemast Kunstikoolist, Tartu Ülikoolist ja Tartu lastekunstikoolist lõikasid välja jääskulptuure, mis kopeerisid Eestimaa tuntud monumente. Võidutöö autor oli Kalev Järvik taiesega ±Energia¬. Tema töö on koopia Riho Kulla Narvas asuvast samanimelisest skulptuurist
Poliitikute soodsad majaostud jätavad jõuministrid külmaks / Tuuli Koch, Priit Rajalo
Koch, Tuuli
2005-01-01
Peaminister Andrus Ansipi ja justiitsministri Rein Langi suhtumisest majandusminister Edgar Savisaare Keila-Joa krundi ostusse. 500 000 krooni eest ostis kinnistu Keila-Joal ka ärimees Raimo Kägule kuuluv firma OÜ Marriot. Lisa: Savisaare küsitavad tehingud. Vt. samas: Politseimaja rent toob Oliver Kruudale miljoneid. Kommenteerib ASi Kalev Real Estate Company nõukogu liige Oliver Kruuda
Uus kunst ootab vaatajaid augusti lõpuni
2006-01-01
Pärnu Uue Kunsti Muuseumi kollektsiooni esitlus "Sünnitus" Viljandis. Vaadata on Yoko Ono, Kalev Mark Kostabi, Edward Lucie-Smithi, Martin Garcia Rivera, Leonhard Lapini, Peeter Lauritsa, Enn Põldroosi jt. teosed. Reedeti on loomepäevad. 18. augustil näitab oma töid ja kõneleb Mark Soosaar
Lenz, Eestis unustatud geenius / Riina Mägi
Mägi, Riina, 1957-
2001-01-01
Tartus toimunud rahvusvahelise Lenzi-konverentsi (Jakob Michael Reinhold Lenz) publik nägi väljasõidul Põltsamaale Lenzi kirjutatud näidendit "Haavatud peigmees", mis esitati Tartu üliõpilasteatri poolt Põltsamaa lossihoovis. Lav. Kalev Kudu
Ettevõtted panustavad eelarve koostamisel järjest enam spetsialistide täiendkoolitusse / Madli Kents
Kents, Madli
2005-01-01
AS-i Kalev koolitusspetsialist Gerli Jõgi, Hansapanga koolituse ostujuht Katrin Kase ja AS-i Eesti Energia koolitusjuht Erge Heido selgitavad, millele pööratakse tähelepanu nende ettevõttes koolituseelarve koostamisel ning annavad ülevaate rakendatavatest koolitusvormidest. Vt. samas: Marja Liis. Esiplaanil on teenindajad
Poliitikud ei leidnud staadioni planeeringule uusi lahendusi / Eno-Gerrit Link
Link, Eno-Gerrit
2008-01-01
Riigikogu Pärnumaa saadikuteühenduse ja Pärnu linnavõimu esindajate ning spordiseltsi Kalev juhtide nõupidamine Kalevi staadioni ümberehituse käimalükkamiseks lõppes tulemusteta, sest kõiki osapooli rahuldava tulemuseni ei jõutud. Kommenteerivad Mark Soosaar ja Vello Järvesalu
Kruuda tahab Kalevi ja Tere ikkagi Altale müüa / Hindrek Riikoja
Riikoja, Hindrek
2008-01-01
Oliver Kruuda firmade Kalev ja Tere müügiläbirääkimiste katkemisest Altaga. Alta Capitali juhi Indrek Rahumaa sõnul loodetakse müügilepinguni jõuda aasta teises pooles. Lisa: Mille üle läbi räägiti
Ebaõnnestunud müügitehing tõi Kalevile kohtuasja ja varade aresti / Dannar Leitmaa
Leitmaa, Dannar, 1982-
2008-01-01
Harju maakohus andis loa arestida Oliver Kruudale kuuluva Kalevi ja selle tütarfirmade varad, kuna Alta Foodsi poolt Kalevi toiduainetööstuse omandamiseks makstud kuus miljonit eurot tagatisraha kuulub väljamaksmisele tehingu katkemise korral. Lisa: Kalev nõuab 141 miljonit krooni
Vahejuhtum kassas / Krister Kivi
Kivi, Krister, 1975-
2008-01-01
Alta Capitali juhist Indrek Rahumaa karjäärist ja varasematest tehingutest. Oliver Kruuda firmade Kalev ja Tere müügiläbirääkimiste katkemine võib Rahumaale kaasa tuua 141 miljoni kroonise finantskaotuse. Lisa: Indrek Rahumaa
Dzhentelmenide kätsh / Hannes Sarv
Sarv, Hannes
2008-01-01
AS Alta Foods esitas Stockholmi arbitraazhiinstituudile taotluse, et saada tagasi AS-i Kalev toiduainetööstuse ja AS-i Tere omandamiseks tasutud kuue miljoni euro suurune ettemaks. Vt. samas: Tehingu kronoloogia. Küsimustele vastavad Indrek Rahumaa ja Oliver Kruuda
Komissarov, Kalle, 1976-
2002-01-01
Konkursist, zürii koosseis, võidutöödest. Võistlusala oli AS-i "Kalev" ja Tallinna Piimatööstuse territoorium. Preemiad: I - Nikolai Volkov, Liis Sagadi, II - Tarmo Teedumäe, Renee Puusepp, Karli Luik, Toomas Tammis, Inga Raukas, III - Veronika Valk, ostupreemiad - Alver Trummal Arhitektid ja büroo Kosmos
Agar pronkssõduriga võitleja sai kanepisuitsetamise eest trahvi / Katrin Rohtla, Siim Randla
Rohtla, Katrin, 1966-
2006-01-01
Aktiivse pronkssõduri vastasena tuntust kogunud Isamaaliidu liige Kalev Rebane sai Läänemaal Peraküla rannas kanepi suitsetamise eest politseilt 9000 krooni trahvi. Isamaa ja Res Publica Liidu liikmed on teinud ettepaneku noormees erakonnast välja arvata. Lisa: Mille eest koostati protokoll?
Jalgrattur Sigvard Kukk : naisi tuleks lilledega loopida / Andres Kalvik
Kalvik, Andres, 1982-
2007-01-01
Kalev Chocolate Teami kuuluvad jalgratturid Mart Ojavee ja Priit Prous koos elukaaslaste Fia Metsamägi ja Kaia-Liia Ilumetsaga räägivad paarisuhtest olukorras, kui mees enamiku ajast välismaal viibib. Lisa: Enamik rattureid vahetab spordist loobudes naist
Arupärimine rahandusministrile eurokalkulaatoritest / Jürgen Ligi, Ene Ergma, Helle Kalda...[jt.
2011-01-01
Riigikogu liikmete Helle Kalda, Toomas Vareki, Aivar Riisalu, Lauri Laasi, Mailis Repsi, Enn Eesmaa, Kalle Laaneti, Eldar Efendijevi, Nelli Privalova, Vladimir Velmani, Olga Sõtniku, Kalev Kallo, Toivo Tootseni, Arvo Sarapuu, Nikolai Põdramägi Evelyn Sepa, Ain Seppiku ja Valeri Korbi poolt 17. novembril esitatud arupärimine
21. IV tähistasid Eesti Rahvusraamatukogus...
2004-01-01
Konverentsi ja näitusega tähistasid oma 80. aastapäeva Väärismetallasjade ja Märkide Tehas Roman Tavast OÜ ning OÜ Juveel. Konverentsil esinesid Raul-Roman Tavast, Kalev Uustalu, Vilius Kavaliauskas, Kaalu Kirme jt. Harulduste osakonna näitusesaalis kuni 21. V väljapanek tehases 80 aastal toodetust
Kaasaegse kunsti muuseum asutas iga-aastase Köleri auhinna / Mart Niineste
Niineste, Mart, 1983-
2011-01-01
EKKM-i poolt nimetatud Köler Prize 2011 nominendid on Dénes Kalev Farkas, Tõnis Saadoja, Timo Toots, Sigrid Viir ja Jevgeni Zolotko. Laureaadi valib rahvusvaheline žürii EKKM-is 1. maist 5. juunini toimuva näituse põhjal. Kunstiauhinnast
Zahharov, Roman
2003-01-01
Kapitali struktuuri optimeerimisest. Analüüsi aluseks on võetud Eesti tööstusettevõtete (Baltika, Estiko, Kalev, Klementi, Norma, Saku Õlletehas, Rakvere Lihakombinaat, Viisnurk) 1996-2001 aastate finantsaruanded. Lisad lk. 238-241. Tabelid. Diagramm
Petrišin, Grigori
2009-01-01
Riigikogu liikme, endise Tallinna abilinnapea Kalev Kallo poole pöördus ettevõtja Grigori Petrišin, keda kaitsepolitsei oli sundinud väidetavalt oma firma nimel kirjutama linnajuhte kompromiteerivaid kirju. Nüüd väidab ettevõtja, et teda on ära kasutatud valimiseelsetes võimumängudes
Remo Holsmer: mees Kalevi pingi taga / Remo Holsmer ; interv. Peep Lillemägi
Holsmer, Remo, 1980-
2009-01-01
Reformierakonna Tallinna piirkonnajuht Remo Holsmer vastab küsimustele, mis puudutavad tema tööd Kalevi korvpalliklubi managerina, korvpalli taset Eestis, Kalevisse välismängijate leidmist, Tallinna Kalev-Tartu Rock vastasseisu ning suhteid Jaak Salumetsaga
Sisekommunikatsiooni roll on toidutööstuses kriitilise kaaluga / Kairi Oja
Oja, Kairi
2015-01-01
Toidutööstuse sisekommunikatsioonist. Selgitusi jagavad Coca-Cola HBC Eesti avalike suhete juht Nele Normak, Jako Arula ettevõttest AS A. Le Coq, AS-i Kalev kommunikatsioonijuht Rutt Roht ja Eesti Toiduainetööstuse Liidu juhataja Sirje Potisepp
Piiritagune teater huvitab igat näitlejat / Kadri Bank
Bank, Kadri
2006-01-01
VIIIndast rahvusvahelisest sõltumatute ja amatöörteatrite festivalist "Apostrof" Prahas 30. VII - 4. VIII, kus osales ka Tartu Üliõpilasteater lavastusega "Puhastatud" (autor Sarah Kane, lavastaja Kalev Kudu). Lavastus pälvis publikuhääletusel 14 osaleja seas viienda koha
Kultuurkapital nimetas aasta parimad
2011-01-01
Eesti Kultuurkapitali aastapreemia 2010 laureaadid: arhitektid Maarja Kask, Ralf Lõoke, Karli Luik (Sõmeru keskusehoone), animaator Mati Kütt (Taevalaul), helilooja Urmas Sisask, kirjanik Mats Traat (Minge üles mägedele), sporditreener Anna Levandi, kunstnik Denes Kalev Farkas (Let's Play, the Game Is Over), teatriühendus R.A.A.A.M., folklorist Anu Korb (Eesti asundused)
Kõige eest siin elus tuleb maksta / Piret Hartman
Hartman, Piret
2006-01-01
ERL-i fraktsiooni nõunik käsitleb rahvastikuteadlase Kalev Katuse loengut Eesti rahvastikuarengust Euroopa kontekstis. Rahvastiku juurdekasv tuleb seada kõigis valdkondades esmatähtsaks, vaja on terviklikku toetussüsteemi kuni lapse täiskasvanuks saamiseni
Võidusamba klaasimine algab järgmisel nädalal / Urmas Tooming
Tooming, Urmas
2008-01-01
Tallinnasse rajatava Vabadussõja võidusamba betoonsüdamiku ümber ehitatakse metallkarkass, mille külge kinnitatakse klaasplokid. Töid teostab Tšehhi firma Sans Souc. Samba valguslahendusest. Kommenteerivad Kalev Pikaru firmast Telora-E ja disainer Andri Laidre
Mis teeb ühe brand'i teistest paremaks? : Võidu tähendusrikkuse poole / Mauri Sööt
Sööt, Mauri
2013-01-01
Balti riikides läbi viidud brand'iuuringust Meaningful Brands, millega selgitati, kuidas brand'id mõjutavad inimese heaolu individuaalses ja kollektiivses tähenduses. Eestis uuritud 46 brand'i seas saavutas kõige kõrgema tähendusrikkuse indeksi magusatootja Kalev. Uuringutulemuste kasutusvõimalusi ettevõtte kommunikatsioonis ja üritusturunduses
Väätsa Agro müüdud / Silja Lättemäe
Lättemäe, Silja, 1952-
2006-01-01
Eesti suurima põllumajandusettevõtte Väätsa Agro OÜ üle 56% suurosaluse omandas Eesti kapitalil tegutsev osaühing Windmühle. Vt. samas: Miks te ei maksa piimavõlga ära? Küsimusele vastab AS-i Kalev omanik Oliver Kruuda
Kalevi rooli asub endine lihatööstur / Kaisa Tahlfeld
Tahlfeld, Kaisa
2010-01-01
Endine Atria juht Kaido Kaare saab Kalev Chocolate Factory uueks juhiks. Kaare arvates võiksid Eesti magusatööstuse ambitsioonid ulatuda Eestist väljapoole, ta näeb võimalusi suurendada koostöös Orkla grupi ettevõtetega Kalevi tootmisefektiivsust ja jätkata tootearendust
Directori ülesanne : Kangekaelsed alluvad / Marko Rillo
Rillo, Marko
2007-01-01
Ettevõtte juhi ja alluvate vahelistest probleemidest. Lahendusi kaasusele pakuvad Kalev Chocolate Factory AS-i juhatuse esimees Kati Kusmin: Rohkem usku iseendasse; firma Meeskonnakoolituse juhtimistreener-konsultant Ülo Vihma: Varem või hiljem saavutame ikka oma ebakompetentsuse taseme!; internetifirma Bookinghouse asutaja ja juht Andres Liinat: Oskused on õpitavad - isikuomadused mitte
Leading Estonian brands in the hands of foreign companies / Andreas Kaju
Kaju, Andreas
2002-01-01
Emori poolt 2002. aasta alguses läbi viidud uurimusest selgus, et Eesti top 10 kaubamärkide hulgas on Kalev ainus Eesti kapitalil põhineva ettevõtte kaubamärk. Tabel: Eesti ettevõtete ja kaubamärkide top 6. Lisa
Sise- ja rahvusvaheline tasakaal / Ragnar Nurkse ; tõlk. Aet Ringborg
Nurkse, Ragnar
2004-01-01
Keynesi majandusteooriast, rahvatulu ja väliskaubanduse seose multiplikaatoranalüüsist, tööhõivepoliitikast avatud majanduses ja selle rahvusvahelisest koordineerimisest, majanduslikust natsionalismist, rahvusvahelisest valuutapoliitikast ja multilateraalsest kaubandusest. Vt. ka: Kalev Kukk. Kes oli ja on Ragnar Nurkse? Ülevaade eesti soost majandusteadlase Ragnar Nurkse (1907-1959) elukäigust
Eesti harrastusfilm võitis esikoha
2007-01-01
Tallinna V rahvusvahelise amatöörfilmide festivali peaauhind jagunes nelja filmi vahel, millest üks oli Eesti "Elevanti nägema" (tegijad Sandra Dürdorth, Maureen Apel, Kalev Saar, Leon Shamis). Teised võitjad olid Austria (2 filmi) ja Soome
50 miljoni kulutamise eesmärk : 50 miljonit tuleb kulutada ja kõik / Raimo Poom
Poom, Raimo
2007-01-01
Ministeeriumid kritiseerivad majandus- ja kommunikatsiooniministeeriumi kodutoetuse seaduse eelnõu, mille eesmärk on lahendada lasterikaste perede eluasemeprobleemid. Siim Valmar Kiisleri, Jürgen Ligi, majandus- ja kommunikatsiooniministeeriumi pressiesindaja Kalev Vapperi arvamusi. Vt. samas: Kadri Ibrus. Viielapseline pere laenu ei saa
Alo Streimann pääses Eesti Posti juhatusse suunatud konkursiga / Tõnis Arro ; interv. Toomas Kümmel
Arro, Tõnis
2003-01-01
Personaliotsingufirma Fontes nõukogu esimees Tõnis Arro tunnistab, et Eesti Posti juhi kohalt tagasiastunud Alo Streimanni ametisse valimisel oli tunda ettevõtte eelmise nõukogu soovi suruda sellele ametikohale Keskerakonnale lähedalseisev inimene. Vt. samas: Aastatagused arvamused Alo Streimannist: Kalev Kaal, Kostel Gerndorf, Küllo Arjakas
Koole hakkavad haldama riiulifirmad / Toivo Tänavsuu, Vallo Toomet
Tänavsuu, Toivo
2006-01-01
Kümme Tallinna kooli antakse 30 aastaks erafirmade renoveerida ja hallata. 32. keskkooli majandusjuhi Ants Ivaski, Kalev REC juhatuse liikme Peeter Lillestiku, U. S. Investi juhatuse liikme Tarmo Tomaki, RKAS-i juhi Jaak Saarniidu seisukohti. Vt. samas intervjuud Kaia Jäppineniga. Lisa: Rendisumma erineb mitu korda
Eksperdid peavad võrdlust Kuuba kriisiga liialduseks / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2016-01-01
Balti riikide ja teiste Venemaa naaberriikide julgeolekust seoses Iskander-M-tüüpi rakettide paigutamisega Kaliningradi oblastisse. NATO liitlasvägede kohalolust Baltimaades ja Poolas ning mõjudest Venemaa julgeolekupoliitilistele otsustele. Rahvusvahelise Kaitseuuringute Keskuse teadurite Tomas Jermalavičiuse ja Kalev Stoicescu kommentaarid
Laul, mis kõlas Venemaal paremini kui Eestis / Riho Nagel
Nagel, Riho
2018-01-01
Tapal asuva 1. jalaväebrigaadi staabi- ja sidekompanii ajateenijad valisid oma kompanii lauluks "Metsavendade laulu". Vene rahvusest ajateenija kaebuse tõttu laulust küll loobuti, kuid info sellest laulust jõudis Vene meediasse. Rahvusvahelise kaitseuuringute keskuse teaduri Kalev Stoicescu kommentaar
Omamise vaev või rendiõnn? / Merlis Nõgene
Nõgene, Merlis, 1976-
2006-01-01
Arvutite renditeenust tutvustavad Elioni finantseerimistoodete teenistuse juhataja Kalev Karus, Siemens Financial Services'i tegevjuht Virgo Jaani ja 3 Step IT müügidirektor Aivar Kraus. Kommenteerib Infoweb ASi arendusdirektor Tauri Purkas. Lisad: Rentimise plussid ja miinused; Tallinna koolide arvutite renditsükkel purunes
Uued omanikud tahavad Revinost näidisfarmi teha / Külli Kriis
Kriis, Külli, 1961-
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 9. jaan. 2004, lk. 4. Investeerimispank Trigon Capital omandas enamusosaluse osaühingus Revino. Pank kavatseb põllumajandusettevõttest kujundada näidisfarmi, mis aitaks muuta Eesti põllumajandust välisinvestoritele atraktiivsemaks Vt. samas lühiint. Kalev Mae, Ken Noble ja Joakim Heleniusega
Kalevite kange rahvas / Valter Lang
Lang, Valter, 1958-
2012-01-01
Autor uurib, kuidas võidi kutsuda sotsiaalselt paremal järjel olevaid inimesi muinasajal, juhtides tähelepanu ühele võimalusele omakeelse ülikunime väljaselgitamisel - selleks võiks olla meie rahvaluule vägilane Kalev. Pöördutakse nii rahvaluule, keeleajaloo kui ka arheoloogia poole
North Carolina State Dept. of Public Instruction, Raleigh. Div. for Exceptional Children.
The manual presents procedures for local school districts in North Carolina applying for federal funding under Title VI, Part B, Education of the Handicapped Act, as amended by Public Laws 93-320, 94-142, and 99-457. The first chapter gives instructions for submission of amendments for the third year of the 3-year plan and includes an introduction…
Moradi, Shahram; Lidestam, Björn; Rönnberg, Jerker
2016-06-17
The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. © The Author(s) 2016.
Lidestam, Björn; Rönnberg, Jerker
2016-01-01
The present study compared elderly hearing aid (EHA) users (n = 20) with elderly normal-hearing (ENH) listeners (n = 20) in terms of isolation points (IPs, the shortest time required for correct identification of a speech stimulus) and accuracy of audiovisual gated speech stimuli (consonants, words, and final words in highly and less predictable sentences) presented in silence. In addition, we compared the IPs of audiovisual speech stimuli from the present study with auditory ones extracted from a previous study, to determine the impact of the addition of visual cues. Both participant groups achieved ceiling levels in terms of accuracy in the audiovisual identification of gated speech stimuli; however, the EHA group needed longer IPs for the audiovisual identification of consonants and words. The benefit of adding visual cues to auditory speech stimuli was more evident in the EHA group, as audiovisual presentation significantly shortened the IPs for consonants, words, and final words in less predictable sentences; in the ENH group, audiovisual presentation only shortened the IPs for consonants and words. In conclusion, although the audiovisual benefit was greater for EHA group, this group had inferior performance compared with the ENH group in terms of IPs when supportive semantic context was lacking. Consequently, EHA users needed the initial part of the audiovisual speech signal to be longer than did their counterparts with normal hearing to reach the same level of accuracy in the absence of a semantic context. PMID:27317667
Directory of Open Access Journals (Sweden)
Farong Kou
2018-01-01
Full Text Available In order to coordinate the damping performance and energy regenerative performance of energy regenerative suspension, this paper proposes a structure of a vehicle semi-active energy regenerative suspension with an electro-hydraulic actuator (EHA. In light of the proposed concept, a specific energy regenerative scheme is designed and a mechanical properties test is carried out. Based on the test results, the parameter identification for the system model is conducted using a recursive least squares algorithm. On the basis of the system principle, the nonlinear model of the semi-active energy regenerative suspension with an EHA is built. Meanwhile, linear-quadratic-Gaussian control strategy of the system is designed. Then, the influence of the main parameters of the EHA on the damping performance and energy regenerative performance of the suspension is analyzed. Finally, the main parameters of the EHA are optimized via the genetic algorithm. The test results show that when a sinusoidal is input at the frequency of 2 Hz and the amplitude of 30 mm, the spring mass acceleration root meam square value of the optimized EHA semi-active energy regenerative suspension is reduced by 22.23% and the energy regenerative power RMS value is increased by 40.51%, which means that while meeting the requirements of vehicle ride comfort and driving safety, the energy regenerative performance is improved significantly.
Preparation and Characterization of Acrylic Primer for Concrete Substrate Application
Directory of Open Access Journals (Sweden)
El-Sayed Negim
2016-01-01
Full Text Available This study dealt with the properties of acrylic primer for concrete substrate using acrylic syrup, made from a methyl methacrylate monomer solution of terpolymers. Terpolymer systems consisting of methyl methacrylate (MMA, 2-ethylhexyl acrylate (2-EHA, and methacrylic acid (MAA with different chemical composition ratios of MMA and 2-EHA were synthesized through bulk polymerization using azobisisobutyronitrile (AIBN as initiator. The terpolymer composition is characterized by FTIR, 1H NMR, DSC, TGA, and SEM. The glass transition temperature and the thermal stability increased with increasing amounts of MMA in the terpolymer backbone. The effect of chemical composition of terpolymers on physicomechanical properties of primer films was investigated. However, increasing the amount of MMA in terpolymer backbone increased tensile and contact angle of primer films while elongation at break, water absorption, and bond strength are decreased. In particular, the primer syrup containing 65% 2-EHA has good bonding strength with concrete substrate around 1.1 MPa.
Directory of Open Access Journals (Sweden)
Boris Chong
2002-01-01
Full Text Available The genetic improvement of plantain and banana is of great importance for its level of consumption on a world-wide scale. Genetic transformation constitutes one alternative for genetic improvement and has complemented traditional techniques. In this work some parameters of genetic transformation of plantain were studied by means of transient expression of â-glucoronidase in the hybrid cultivar FHIA-21(AAAB by Agrobacterium tumefaciens. A study with the β-Agrobacterium tumefaciens strains AT-2260 and EHA-105, both with the plasmid pCAMBIA-3301 was done. A comparison between the time of infection and time of co-culture was studied. The strain of better behavior was EHA-105. In the study of the time of infection and co-culture, the best combination resulted to be the one with two hours of infection and six days of co-culture. Key words: At-2260, EHA-105, β-glucoronidase, Musa
Validation of the oesophageal hypervigilance and anxiety scale for chronic oesophageal disease.
Taft, T H; Triggs, J R; Carlson, D A; Guadagnoli, L; Tomasino, K N; Keefer, L; Pandolfino, J E
2018-05-01
Oesophageal hypervigilance and anxiety can drive symptom experience in chronic oesophageal conditions, including gastro-oesophageal reflux disease, achalasia and functional oesophageal disorders. To date, no validated self-report measure exists to evaluate oesophageal hypervigilance and anxiety. This study aims to develop a brief and reliable questionnaire assessing these constructs, the oesophageal hypervigilance and anxiety scale (EHAS). Questions for the EHAS were drawn from 4 existing validated measures that assessed hypervigilance and anxiety adapted for the oesophagus. Patients who previously underwent high-resolution manometry testing at a university-based oesophageal motility clinic were retrospectively identified. Patients were included in the analysis if they completed the EHAS as well as questionnaires assessing symptom severity and health-related quality of life at the time of the high-resolution manometry. Nine hundred and eighty-two patients aged 18-85 completed the study. The EHAS demonstrates excellent internal consistency (α = 0.93) and split-half reliability (Guttman = 0.87). Inter-item correlations indicated multicollinearity was not achieved; thus, no items were removed from the original 15-item scale. Principal components factor analysis revealed two subscales measuring symptom-specific anxiety and symptom-specific hypervigilance. Construct validity for total and subscale scores was supported by positive correlations with symptom severity and negative correlations with health-related quality of life. The EHAS is a 15-item scale assessing oesophageal hypervigilance and symptom-specfic anxiety. The EHAS could be useful in evaluating the role of these constructs in several oesophageal conditions in which hypersensitivity, hypervigilance and anxiety may contribute to symptoms and impact treatment outcomes. © 2018 John Wiley & Sons Ltd.
Environmental Influences on Daily Emergency Admissions in Sickle-Cell Disease Patients
Mekontso Dessap, Armand; Contou, Damien; Dandine-Roulland, Claire; Hemery, François; Habibi, Anoosha; Charles-Nelson, Anaïs; Galacteros, Frederic; Brun-Buisson, Christian; Maitre, Bernard; Katsahian, Sandrine
2014-01-01
Abstract Previous reports have suggested a role for weather conditions and air pollution on the variability of sickle cell disease (SCD) severity, but large-scale comprehensive epidemiological studies are lacking. In order to evaluate the influence of air pollution and climatic factors on emergency hospital admissions (EHA) in SCD patients, we conducted an 8-year observational retrospective study in 22 French university hospitals in Paris conurbation, using distributed lag non-linear models, a methodology able to flexibly describe simultaneously non-linear and delayed associations, with a multivariable approach. During the 2922 days of the study, there were 17,710 EHA, with a mean daily number of 6.1 ± 2.8. Most environmental factors were significantly correlated to each other. The risk of EHA was significantly associated with higher values of nitrogen dioxide, atmospheric particulate matters, and daily mean wind speed; and with lower values of carbon monoxide, ozone, sulfur dioxide, daily temperature (minimal, maximal, mean, and range), day-to-day mean temperature change, daily bright sunshine, and occurrence of storm. There was a lag effect for 12 of 15 environmental factors influencing hospitalization rate. Multivariate analysis identified carbon monoxide, day-to-day temperature change, and mean wind speed, along with calendar factors (weekend, summer season, and year) as independent factors associated with EHA. In conclusion, most weather conditions and air pollutants assessed were correlated to each other and influenced the rate of EHA in SCD patients. In multivariate analysis, lower carbon monoxide concentrations, day-to-day mean temperature drop and higher wind speed were associated with increased risk of EHA. PMID:25546672
DEFF Research Database (Denmark)
Craven, J.; Bjørn, H.; Barnes, E.H.
1999-01-01
This study reports a comparison between faecal egg count reduction test (FECRT), egg hatch assay (EHA) and larval development assay (LDA) for detecting anthelmintic resistance in equine strongyles. Resistance to benzimidazoles was demonstrated in 33 of 42 (79%) farms tested by FECRT and in 32 (62......%) of the 52 farms tested by EHA. As the reference strain used was not fully susceptible to benzimidazoles it was not possible to determine the level of resistance by LDA. Pyrantel resistance was indicated on three of 15 farms by faecal egg count reduction. Resistance was also indicated by LDA for one...
Kto samõi bogatõi v Estonii / Sten-Aleks Pihlak, Kärt Blumberg, Lemmi Kann
Pihlak, Sten-Aleks
2008-01-01
Eesti laevatranspordi kolmik - Ain Hanschmidt, Enn Pant ja Kalev Järvelill on Äripäeva rikaste edetabelis esimesed. Viimaste kuude suure aktsiahinnalanguse tõttu on paljud Äripäeva rikaste edetabelis olijad kaotanud igast kolmest kroonist kaks. Artiklis selgitatakse miks on Äripäeva Rikaste TOPis vähe naisi. Lisad: Iz TOP-500 samõhh bogatõhh ljudei v Estonii; Reitingi bogatshei za prezhnije godõ; Metodika
Kahtlustus: Reiljan ihkas krunti Tallinnas ja salaosalust firmas / Andrus Karnau
Karnau, Andrus
2007-01-01
Ilmunud ka: Postimees : na russkom jazõke, 23. okt. 2007, lk. 4. Riigiprokuratuuri neljast kahtlustusest Merko Ehituse ja selle suuromaniku Toomas Annuse suhtes: väidetav altkäemaksu lubamine Rahvaliidu endisele juhile, parlamendiliikmele Villu Reiljanile, väidetav altkäemaksu andmine maa-ameti endisele peadirektorile Kalev Kangurile, väidetav altkäemaksu andmine endisele põllumajandusministrile, parlamendiliikmele Ester Tuiksoole, T. Annuse väidetav usalduse kuritarvitamine Merko Ehituse suhtes
Salapärane Boeing tõi Eestisse konteinereid / Ester Vilgats
Vilgats, Ester
2005-01-01
Ilmunud ka: Pärnu Postimees 8. nov., lk. 3, Postimees : na russkom jazõke 10. nov. lk. 10. Pärnu lennujaama juhataja Erki Teemägi ja Kaitsepolitsei Pärnu osakonna politseidirektor Kalev Kont kinnitasid, et Pärnu lennuväljal 12. jaanuaril 2003. aastal maandunud Boeing 737 vedas kaubakonteinereid, mitte terroristidest sõjavange, nagu väitis ajaleht Washington Post. Vt. samas: Neeme Raud. Inimõiguslased ootavad euroliidu sekkumist
Short outlines of books by Estonian authors : [annotations] / Rutt Hinrikus, Janika Kronberg
Hinrikus, Rutt, 1946-
1999-01-01
Ehin, Andres. Seljatas sada meest; Ilmet, Peep. Tuuldunud luule; Kaplinski, Jaan. Öölinnud. Öömõtted; Kender, Kaur. Iseseisvuspäev; Kesküla, Kalev. Vabariigi laulud; Luik, Viivi. Maa taevas; Nõu, Helga. Hundi silmas; Raun, Mait. Wake up; Remsu, Olev. Haapsalu tragöödia; Sauter, Peeter. Kogu moos; Undusk, Jaan. Maagiline müstiline keel; Vint, Toomas. Kunstnikuromaan
Oliver Kruuda : Valitsus on loll. Riiki ei juhi keegi / Oliver Kruuda ; interv. Urmo Soonvald
Kruuda, Oliver, 1967-
2008-01-01
Ilmunud ka: Vesti Dnja 28. mai lk. 4. Ärimees Oliver Kruuda majandusprobleemide põhjustest Eestis, peaminister Andrus Ansipist, hüpoteegipanga rajamise vajadusest, Eesti ajakirjanduse erapoolikust suhtumisest tema ja Edgar Savisaare tegevusse, Kalevi ja Tere müümisest, Kalev Meedia asutamise ajenditest ja perspektiividest, jõukusest, võlgadest, poegade kasvatamisest. Lisad: Kuidas riigi raha säästa; Kes on Oliver Kruuda?
Töötaja leiab ka miinimumpalgaga / Ralf-Martin Soe
Soe, Ralf-Martin
2007-01-01
Ilmunud ka: Delovõje Vedomosti 31. okt. lk. 6. Madalate palkade TOP 10. Vt. samas: Küsimustele vastab Helter-R-i tegevjuht Kalev Kivipalu; Madal palk toob kaela maksuameti luubi alla sattumise; Endised töötajad: Helter-R-is sain palka osaliselt sulas; Tagant teine: suur juveelitootja - keskmine palk 3400 krooni kuus; Tagant kolmas koht: maksuamet uuris väikseid palku; Tabel. Kommenteerib Ruth Laatre
Karl Kello - elukutse olla saarlane / Aare Laine
Laine, Aare, 1951-
2004-01-01
Kuressaare Kuursaalis näidati kadripäeval nelja Ruta Celma ja Karl Kello kultuuriloolist dokumentaalfilmi : "Narr Jumala kojas" (2000), "Phaetonit otsides" (1999), "Eestlased Lätis" (2004) ja Kalevipoja temaatikat arendav "Küll siis Kalev..." (2004). Filmide operaator on Arvo Vilu. Artikli autor kõneleb Karl Kellost, tema Karja kiriku ja Kaali järve problemaatika arendustest peale filmide ka kirjasõnas
Kulka kroonis aasta kümme sulesangarit / Kaarel Kressa
Kressa, Kaarel, 1983-
2010-01-01
Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)
Aasta parimad teosed Krullilt ja Keskülalt / Heili Sibrits
Sibrits, Heili, 1977-
2010-01-01
Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)
Kommivabriku aura jääb Tondile. Ideid Kalevi kvartali tulevikuks / Piret Peensoo
Peensoo, Piret
2003-01-01
Tallinnas Järvevana tee ja Pärnu maantee vahelise ala ruumilise planeerimise ideeprojekti avalik arhitektuurikonkurss, võitjad Nikolai Volkov ja Liis Sagadi, 2. koht - Irina Raud, Toomas Tammis, Tarmo Teedumäe, Karl Luik, Renee Puusepp, 3. koht - Veronika Valk. Laste Maailma Galeriis võistlusprojektide näitus "Magus urbanism". Fakte kommivabriku "Kalev" ajaloost. Vabrik jätkab tööd Rae vallas Põrguväljal
2012-01-01
Noorte ettevõtluskonkursi Ajujaht finalistidest: Richard Murutar (Dolphin), Andrus Purde (Achoo), Kalev Külaase, Ülane Vilumets, Rait Kapp (Kohalik Giid), Mart Raus, Vahur Mäe (Grillcube), Dmitri Kuznetsov, Anna Agronova, Julia Abolina, Anatoly Loginov (Healthiest.mobi), Karin Juhe, Karin Aruots (Korsid), Raino Sinisalu, Märt Pikkani, Arkadi Tammik, Varje Papp (Raybike), Egle Loit, Kair Käsper (Pille toidukott)
Iõhvi ne sobral deneg na skulpturu dudotshnika
2008-01-01
Jõhvi vallakunstnik Kalev Prits plaanib Jõhvi kontserdimaja juurde puu otsa paigaldada vilepillimängija skulptuuri ja kogub selleks sponsorraha. Tõenäoliselt asuvad uue skulptuuri kallal tööle läti kunstnik Edvin Kruminsh ja Aivar Simson. Kruminshi kätetöö on Jõhvi sissesõidutee ääres seisev metallist siil. Simpson on Jõhvi teinud karude ja lindude kujusid ning siilikujulisi lillepotte
Indigolapsed - teistmoodi lapsed või lihtsalt lapsed? / Katrin Helend-Aaviku
Helend-Aaviku, Katrin
2009-01-01
Juuru rahvamajas näidati filmiõhtul James Twymani indigolastest rääkivat dokumentaalfilmi "Indigo evolutsioon" (USA, 2005). Filmi ning Lee Carrolli ja Jan Toberi raamatu "Indigolapsed: uus põlvkond on saabunud" põhjal järgnenud arutelust indigolastest koos psühholoog Pille Kuldkepi ja Kalev Veskimäega, kellel on soov luua Paidesse vabakool
The President and the Intelligence Community: The Importance of the Relationship
2017-12-01
Intelligence Successes and Failures in Operations Desert Shield/Storm, (Washington, DC: Government Printing Office, 1993), 2–3, http://www.dtic.mil... Intelligence as Leaders of the U.S. Intelligence Community 1946–2005. Washington, D.C.: Government Printing Office, 2005. Hedley, John Hollister...THE INTELLIGENCE COMMUNITY: THE IMPORTANCE OF THE RELATIONSHIP by Dane M. Holtmeyer December 2017 Thesis Advisor: Kalev I. Sepp
Improvement of Agrobacterium-mediated transformation and rooting of black cherry
Ying Wang; Paula M. Pijut
2014-01-01
An improved protocol for Agrobacterium-mediated transformation of an elite, mature black cherry genotype was developed. To increase transformation efficiency, vacuum infiltration, sonication, and a combination of the two treatments were applied during the cocultivation of leaf explants with Agrobacterium tumefaciens strain EHA105...
Regeneration and Agrobacterium -mediated transformation studies ...
African Journals Online (AJOL)
Leaf explants of carnation (Dianthus caryophyllus L. cv. Turbo) were used for the transformation of gene performed by the EHA 105 strain of Agrobacterium tumefaciens harboring the binary vector, pGA482GG. This vector carries the marker genes, neomycin phosphotansferase II (npt II) that determine resistance to ...
Immunization against Rumen Methanogenesis by Vaccination with a New Recombinant Protein.
Directory of Open Access Journals (Sweden)
Litai Zhang
Full Text Available Vaccination through recombinant proteins against rumen methanogenesis provides a mitigation approach to reduce enteric methane (CH4 emissions in ruminants. The objective of present study was to evaluate the in vivo efficacy of a new vaccine candidate protein (EhaF on methanogenesis and microbial population in the rumen of goats. We amplified the gene mru 1407 encoding protein EhaF using fresh rumen fluid samples of mature goats and successfully expressed recombinant protein (EhaF in Escherichia coli Rosetta. This product was evaluated using 12 mature goats with half for control and other half injected with 400ug/goat the purified recombinant protein in day 1 and two subsequent booster immunizations in day 35 and 49. All measurements were undertaken from 63 to 68 days after the initial vaccination, with CH4 emissions determined using respiration calorimeter chambers. The results showed that the vaccination caused intensive immune responses in serum and saliva, although it had no significant effect on total enteric CH4 emissions and methanogen population in the rumen, when compared with the control goats. However, the vaccination altered the composition of rumen bacteria, especially the abundance of main phylum Firmicutes and genus Prevotella. The results indicate that protein EhaF might not be an effective vaccine to reduce enteric CH4 emissions but our vaccine have potential to influence the rumen ecosystem of goats.
Eesti sajandilõpu kunst jõuab rahva ette / Johannes Saar
Saar, Johannes, 1965-
2002-01-01
Eesti Kunstimuuseumi Rüütekonna hoones ja Rotermanni soolalaos näitus "Kapital" aastail 1995-2002 muuseumile ostetud eesti kunstnike teostest. Ostetud 505 tööst on eksponeeritud kolm neljandikku. Kujundas Marko Laimre, kureeris Eha Komissarov
Vaal-galeriis on sajandi suurkujud / Külli Kariste
Kariste, Külli
2001-01-01
Vaal-galerii näitusest (avatud. 10. märtsini) "Suured ja unustamatud", kus eksponeeriti Georges Braque'i, Paul Delvaux, Francis Baconi, Pablo Picasso, Joan Mir̤ jt. töid. Näituse koostaja Eha Komissarovi kommentaare
Korralik inimene ostab jõulukingid raamatupoest / Valner Valme, Rebekka Lotman, Merit Kask
Valme, Valner, 1970-
2007-01-01
Peatselt ilmuvatest raamatutest: Kareva, Doris. Lõige : [luuletused] ; Rowling, Joanne Kathleen. Harry Potter ja surma vägised ; Sild, Ivar. Tantsiv linn ; Lee, Maria. Äramõte ; Christensen, Lars Saabye. Modell / tõlkinud Eha Vain ; Murakami, Haruki. Kafka mererannas / tõlkinud Kati Lindström
Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene
Bawareth, Bander
2012-01-01
in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L
Siib, Liina
2006-01-01
Kumu näitusekujundaja tähelepanekuid maja ja ekspositsiooni vahelistest seostest. Kumu põhiekspositsioonide kujundajad: Liina Siib (Eesti kunst 18. sajandist kuni 1944. aastani, kuraator Tiina Abel) ning Terje Kallast ja Urmas Luure (Eesti kunst 1945-1991, kuraatorid Eha Komissarov ja Kädi Talvoja)
Access to electronic information resources by students of federal ...
African Journals Online (AJOL)
The paper discusses access to electronic information resources by students of Federal Colleges of Education in Eha-Amufu and Umunze. Descriptive survey design was used to investigate sample of 526 students. Sampling technique used was a Multi sampling technique. Data for the study were generated using ...
Maakondade rahvakultuuri aastapreemiad 2001
2002-01-01
Fr. R. Kreutzwaldi nim mälestusmedali ja Kreutzwaldi-stipendiumi statuudid, lk. 89-00. Hendrik Lindepuu sai Jõgevamaa kirjanduspreemia; Mari Vallisoo sai Juhan Liivi nim. luuleauhinna, Elle-Eha Are sai Viljandimaa kultuuripreemia ja Contra B. Kangro nim. kirjanduspreemia. F. R. Kreutzwaldi mälestusmedali sai Aarand Roos
2005-01-01
Tartu Ülikooli kollektiivi liikmetest saavad Eesti vabariigi 87. aastapäeva puhul riikliku autasu külalisprofessorid Stig Erik örjan Ohlsson ja Uno lõhmus, professorid mati Erelt, Volli kalm, kalle merusk, Aadu Must, Paul varul, Jaan Eha, bibliograaf Marika Meltsas
Hüpates üle varju ehk Eesti millenniuminäitused / Henno Väri
Väri, Henno
1999-01-01
Ülevaatenäitused 'XX sajandi eesti kunstniku mälestuseks' (kuraator Eha Komissarov, üldkujundaja Jaan Toomik) Eesti Kunstimuuseumi Rüütelkonna hoones ja 'Hingeaeg 1900-2000' (kuraatorid Tiiu Talvistu, Mare Joonsalu) Tartu Kunstimuuseumi Kivisilla Pildigaleriis.
Hamidi, A. A.; Salimi, M. N.; Yusoff, A. H. M.
2017-04-01
The focus of bone graft properties has developed through generations, from the ability to withstand mechanical stress to the ability to integrate with the biological structure. In recent years, the use of hydroxyapatite (HA) as bone graft material in orthopedic and dental applications has been increasing. HA is a natural occuring mineral with excellent bioactivity but relatively poor mechanical properties. It constitutes 96% portion of enamel in teeth and 67% portion of bone. HA can be extracted from animal bones or fabricated from synthetic or biologic sources. In this study, eggshells were used as raw material to synthesize eggshell-derived HA (EHA) via mechanochemical method. The synthesis of EHA involved CaO, which was obtained from the calcination of eggshells, and reaction with dicalcium hydrogen phosphate dihydrous (DCPD) or phosphoric acid (H3PO4). The effects of rotational speed and heat treatment temperature on EHA's characteristics were investigated. The characterization studies were carried out by using the Fourier Transform Infrared Spectroscopy (FTIR), X-Ray Diffraction (XRD) analysis and Scanning Electron Microscopy (SEM). HA powder was successfully synthesized with crystallite and particle sizes in the range of 8-47 nm and 250-550 nm respectively. It was observed from this study that the increase of milling rotational speed had increased the phase purity of EHA samples. Furthermore, the higher heating temperature of HA samples resulted in higher degree of crystallinity of HA and the appearance of β-tricalcium phosphate (β-TCP) as secondary phase.
Kaubamaja "Lemon" - Arco Ärikeskus : Estonia pst. 1, Tallinn
2002-01-01
1958. a. valminud hoone rekonstrueerimine. Projekteerija: EA Reng. Arhitekt Martin Aunin. Ehituskonstruktsioonid: Riho Märtson. Insenertehnilised osad: Karmo Pajo, Maarika Kurvits, Eha Treial. Valgusinstallatsioon: Meeli Kõiva. Kaupluste mööbel, kohtvalgustus: Priit Põldme, Ants Tolli, Ruth-Helene Kaasik, Hugo Mitt, Mart Vesker, Tarmo Piirmets. Projekt 2001, valmis 2002. I korruse põhiplaan, 4 vaadet
2008-01-01
Kuidas möödus aasta 2007 ja mida toob 2008? Räägivad Järvamaa Arenduskeskuse juhataja Katrin Puusepp, Tööturuameti Järvamaa osakonna juhataja Eha Tasang, AS Comfort AE juhataja, Järva ettevõtjate seltsi president Enn Rõõs. Vt. samas: Järvamaa ettevõtlusaasta kulges mitmeti
Agrobacterium-mediated transformation of watermelon ( Citrullus ...
African Journals Online (AJOL)
Transformation of watermelon (Citrullus lanatus cv. Zaojia) using Agrobacterium tumefaciens strain EHA105 containing the plasmid pRD400 carrying Pti4 gene was studied in this work. Proximal cotyledons as explants were pre-cultivated for two day in the dark and it was found that the best condition for transformation of ...
Pablo Picasso on Kumus / Kadri Karro
Karro, Kadri
2010-01-01
Tallinna 15. graafikatriennaali sateliitnäitus "Mapping" Kumu Kunstimuuseumis 2.01.-17.04.2011, kuraator Lilijana Stepančič, kujundaja Liina Siib. Eksponeeritakse Ljubljana graafikabiennaali hitte (Pablo Picasso, Damien Hirsti jt.) ja Eha Komissarovi koostatud valikut biennaalil osalenud eestlaste (Malle Leis, Tõnis Vint jt.) töödest
14. II kell 14 esitletakse EKMi Rüütelkonna hoones...
2005-01-01
Esitletakse raamatuid "Eesti kunst. 101 teost Eesti kunstimuuseumi kogudest" (autorid: Tiina Abel, Eha Komissarov, Hanno Soans, koostanud T. Abel, E. Komissarov, H. Soans ja Kädi Talvoja, kujundanud Anu Lemsalu), "Kunstnik ja tema kodu. C. T. von Neffi kunstikogu Piira ja Muuga mõisast" (koostanud Tiina Abel, kujundanud Andres Tali) ja Kiwa "Roboti tee on nihe. Salatühik"
Uuringufondist kahele uurimisteemale 50 000 krooni / Teaduskomisjon
2000-01-01
Tallinna Pedagoogikaülikooli uuringufondist eraldatakse 25 000 krooni terviseuuringute labori uurimisteema "Koolistress, selle avaldumine ja leevendamisvõimalused" finantseerimiseks (taotleja Eha Rüütel) ja 25 000 krooni kognitiivse neuroteaduse ja eksperimentaalpsühholoogia labori uurimisteema "Psühholoogilised aspektid kognitiivses psühholoogias" jätkamiseks (taotleja Kaivo Thomson)
Transformation of multiple soybean cultivars by infecting ...
African Journals Online (AJOL)
Transformation of multiple soybean cultivars by infecting cotyledonary-node with Agrobacterium tumefaciens. ... In our study, the combination of Nannong88-1 with EHA105 is the optimum selection for explant and bacterial inoculum in soybean transformation, which could be applied in future functional study of soybean ...
Pärnograafiline / Andreas Trossek
Trossek, Andreas, 1980-
2007-01-01
Priit Pärna näitus Kumu Kunstimuuseumis kuni 21. X. Kuraator Eha Komissarov. 11. V toimus Kumu auditooriumis Priit Pärna loomingule pühendatud rahvusvaheline seminar, peaesinejaks oli Edwin Carels Belgiast. Esitamisele tuli filmiprogramm Priit Pärna filmidest ning toimus ümarlaud, milles osalesid Andreas Trossek, Mari Laaniste ja Priit Pärn
Armastus ja anarhia / J[aan] R[uus
J. R.
1993-01-01
Helsingi filmifestivali "Armastus ja anarhia" mängufilmid "Nekromantik I" (1987) ja "Nekromantik II" (1991), režissöör Jörg Buttgereit ja "Trellimõrtsukas" (1979), režissöör Abel Ferrara, Tallinna kinos "Eha". Arvustavad Rainer Sarnet, Jaak Kilmi, Marko Raat ja J. R. (Jaan Ruus)
Põhjamaade kunsti korraliku välimääraja leiab Kumust / Siram
Siram, pseud., 1968-
2009-01-01
Näitus "I Love Malmö" Kumu Kunstimuuseumis 17. jaanuarini 2010, kuraatorid Eha Komissarov ja Maria-Kristiina Soomre. Eksponeeritakse valikut Malmö kunstimuuseumi kogudest. Andy Warholilt on näitusel neli Mao Zedongi siiditrükis portreed. Joseph Beuys'i loomingust eksponeeritakse "Haisuskulptuuri". Nimetatud eksponeeritud töid ja nende autoreid
Mis jääb kunstist lõpuks sõelale? / Tanel Veenre
Veenre, Tanel, 1977-
2011-01-01
15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest
Agrobacterium-mediated transformation of Fraxinus pennsylvanica hypocotyls and plant regeneration
Ningxia Du; Paula M. Pijut
2009-01-01
A genetic transformation protocol for green ash (Fraxinus pennsylvanica) hypocotyl explants was developed. Green ash hypocotyls were transformed using Agrobacterium tumefaciens strain EHA105 harboring binary vector pq35GR containing the neomycin phosphotransferase (nptII) and β-glucuronidase (GUS) fusion...
Xiaomei Liu; Paula Pijut
2010-01-01
A protocol for Agrobacterium-mediated transformation was developed for in vitro leaf explants of an elite, mature Prunus serotina tree. Agrobacterium tumefaciens strain EHA105 harboring an RNAi plasmid with the black cherry AGAMOUS (AG) gene was used. Bacteria were induced...
Membrane Separation of 2-Ethyl Hexyl Amine/1-Decene
Bawareth, Bander
2012-12-01
1-Decene is a valuable product in linear alpha olefins plants that is contaminated with 2-EHA (2-ethyl hexyl amine). Using organic solvent nanofiltration membranes for this separation is quite challengeable. A membrane has to be a chemically stable in this environment with reasonable and stable separation factor. This paper shows that Teflon AF 2400 and cellulose acetate produced interesting results in 1-decene/2-EHA separation. The separation factor of Teflon AF 2400 is 3 with a stable permeance of 1.1x10-2 L/(m2·h·bar). Likewise, cellulose acetate gave 2-EHA/1-decene separation factor of 2 with a lower permeance of 3.67x10-3 L/(m2·h·bar). A series of hydrophilic membranes were tested but they did not give any separation due to high degree of swelling of 2-EHA with these polymers. The large swelling causes the membrane to lose its diffusivity selectivity because of an increase in the polymer\\'s chain mobility.
The european hematology association roadmap for european hematology research : A consensus document
A. Engert (Andreas); C.L. Balduini (Carlo); A. Brand (Anneke); B. Coiffier (Bertrand); C. Cordonnier (Charlotte); H. Döhner (Hartmut); De Wit, T.D. (Thom Duyvené); Eichinger, S. (Sabine); W.E. Fibbe (Willem); Green, T. (Tony); De Haas, F. (Fleur); A. Iolascon (Achille); T. Jaffredo (Thierry); F. Rodeghiero (Francesco); G. Salles (Gilles); J.J. Schuringa (Jan Jacob)
2016-01-01
textabstractThe European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European
Kolm tähelepanuväärset bibliograafiat / Tiina Ritson
Ritson, Tiina, 1955-
2011-01-01
Arvustus: Uku Masing 100 : bibliograafia 1923-2009 / koost. Anneli Sepp. Tartu : Ilmamaa, 2010. Voldemar Panso bibliograafia / koost. Katre Riisalu, Eha Garšnek, Mari Sibul. Tallinn : Eesti Draamateater, 2010. Pilv, Aare. Juhan Viidingu ja Jüri Üdi bibliograafia // Juhan Viiding, eesti luuletaja. Tartu, 2010.
Directory of Open Access Journals (Sweden)
Junhui ZHANG
2018-01-01
Full Text Available Electro-hydrostatic actuator (EHA pumps are usually characterized as high speed and small displacement. The tilting inertia moment on the cylinder block produced by the inertia forces of piston/slipper assemblies cannot be ignored when analyzing the cylinder block balance. A large tilting inertia moment will make the cylinder block tilt away from the valve plate, resulting in severe wear and significantly increased leakage. This paper presents an analytical expression for the tilting inertia moment on the cylinder block by means of vector analysis. In addition, a high-speed test rig was built up, and experiments on an EHA pump prototype were carried out at high speeds of up to 10,000 r/min. The predicted nature of the cylinder block tilt at high speeds corresponds closely to the witness marks on the dismantled EHA pump prototype. It is suggested that more attention should be given to the tilting inertia moment acting on the cylinder block of an EHA pump since both wear and leakage flow between the cylinder block and the valve plate are very much dependent on this tilting moment.
Kartinõ pribõli v Moskvu taikom / Vahur Koorits
Koorits, Vahur, 1981-
2008-01-01
9. detsembril avati Moskvas Zurab Tsereteli galeriis eesti kunstnike näitus ±Paradise is not lost¬. Kuraator Eha Komissarov. Vene tolliametnikud ei lubanud üle piiri Raul Meele ja Villem Jahu teoseid, sest pidasid neid poliitiliselt sobimatuks. Kunstnikud viisid oma tööd Moskvasse isikliku pagasi hulgas. Kommenteerinud Ksenia Repson "Moskvitshi poznakomjatsja s estonskimi hudozhnikami"
V stenah muzeja pulsirujet gorod / Kiwa
Kiwa, pseud., 1975-
2008-01-01
Näitus "Koht, mis paneb liikuma" Kumu Kunstimuuseumis. Kuraator Eha Komissarov. Grafitikunstnike Antoni, Uku ja Remi ruumiinstallatsioonist "Ajaviil". Reet Ausi, Ville Hyvöneni, HULA ja Tartu Kõrgema Kunstikooli tudengite ruumiinstallatsioonist "Üle prahi". Maarit Murka töö "Fotofoobia". Raoul Kurvitza arvutikunsti teosest "Pentatonic Color System II"
Omas mahlas / Raineras Vilumaa
Vilumaa, Raineras
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone
Riigikontrolli audit kritiseerib Tallinna korterijagamisi / Dannar Leitmaa
Leitmaa, Dannar, 1982-
2008-01-01
Riigikontrolli auditi tulemuste kohaselt pole Tallinn suutnud kõigile vajajatele eluasemeruumi tagada, sundüürnike probleemi lahenduses napib põhimõtteselgust, probleem on linna käitumine otsustuskorras eluruumide võõrandamisel. Abilinnapea Eha Võrgu vastus kriitikale. Lisa: 50 punkti - positiivne tulemus. Kaart
Eesti maalikunsti väljasuremist pole küll karta...
1999-01-01
Eesti Maalikunstnike Liidu näitused. 17. juunil seinamaali konkurss Tallinna Kunstihoone hoovis. 18. juunist Kursi koolkonna uudislooming Raatuse galeriis, Eha Komissarovi kureeritud "Maal'99" Tallinna Kunstihoones, Ants Juske projekt "Uus ja vana narratsioon", mis ühendab maalilisuse, figuratiivsuse ja jutustuse eri kunstiliikides, Rotermanni soolalaos. Avamisel trio "Fragile" happening
Muuseum - market? Bach või Meie Mees? / Valner Valme
Valme, Valner, 1970-
2005-01-01
28. septembril 2005. a. Rüütelkonna hoones toimunud avalikult arutelult muuseumi koha ja funktsiooni üle tänapäeva ühiskonnas. Vestlusringis Jaak Kangilaski, Rein Raud, Eha Komissarov, Merike Lang, Johannes Saar, Anders Härm, Sirje Helme jt
Hanson, Raimu, 1957-
2007-01-01
Tartu Kõrgema Kunstikooli Eha tänava õppehoone uutest ruumidest, kommenteerivad Vallo Nuust, Mati Karmin. Õppehoone rekonstruktsiooni eelprojekt valmis arhitektuuribüroos Künnapu ja Padrik. Kunstikooli toimetiste sarjas ilmusid Peeter Linnapi raamat "Silmakirjad" ja parimate diplomitööde teoreetilisi osi koondav kogumik "Lend 2006"
Effect of heavy atoms on photochemically induced dynamic nuclear polarization in liquids
Okuno, Yusuke; Cavagnero, Silvia
2018-01-01
Given its short hyperpolarization time (∼10-6 s) and mostly non-perturbative nature, photo-chemically induced dynamic nuclear polarization (photo-CIDNP) is a powerful tool for sensitivity enhancement in nuclear magnetic resonance. In this study, we explore the extent of 1H-detected 13C nuclear hyperpolarization that can be gained via photo-CIDNP in the presence of small-molecule additives containing a heavy atom. The underlying rationale for this methodology is the well-known external-heavy-atom (EHA) effect, which leads to significant enhancements in the intersystem-crossing rate of selected photosensitizer dyes from photoexcited singlet to triplet. We exploited the EHA effect upon addition of moderate amounts of halogen-atom-containing cosolutes. The resulting increase in the transient triplet-state population of the photo-CIDNP sensitizer fluorescein resulted in a significant increase in the nuclear hyperpolarization achievable via photo-CIDNP in liquids. We also explored the internal-heavy-atom (IHA) effect, which is mediated by halogen atoms covalently incorporated into the photosensitizer dye. Widely different outcomes were achieved in the case of EHA and IHA, with EHA being largely preferable in terms of net hyperpolarization.
Masajev, Matti
2004-01-01
M. Masajevi päeviku katkendeid ja kirju on varem ilmunud ajakirjas Carelia, 2002, nr. 4, 5, 9 ja 12, 2003, nr. 5 ja 12. M. Masajevi publitseerib ka kirju Eestisse: kirjad Eha Lättemäele, kirjad Jüri Tuulikule
Food preservation and security at household level in rural Nsukka ...
African Journals Online (AJOL)
In Nigeria, food insecurity at the household level can partly be attributed to poor preservation of post-harvest surpluses. This study sought to demonstrate a relationship (if any) between preservation of post harvest surpluses and food security at rural household level. Eha-Alumona and Opi-Uno, in Nsukka, Enugu State were ...
Mahtra muuseumis ja Juuru vallas käisid auväärsed külalised / Tiia Truu
Truu, Tiia, 1948-
2009-01-01
1. juulil 2009 külastasid Mahtra talurahvamuuseumi Mahtra sõja mälestusmärgi looja Johannes Tuti lesk Leili Tutt ja nende poeg Mait Tutt Rootsist ning tütar Eha Dascenzo USA-st Swanscast, nendega koos oli J. Tuti vennatütar Maie Vikat
Metsis, Anne, 1958-
2015-01-01
Mõisakultuurist ja -ajaloost räägivad Raikküla mõisa omanikud Karmel Jõesoo ja Ivo Lambing, Sargvere mõisa perenaised Eha Martma ja Saimi Sapp ning Vääna mõisakooli direktor Gled-Airiin Saarso
Preemia Marko Laimrele / Mare Pedanik
Pedanik, Mare, 1962-
1999-01-01
XXIII rahvusvaheline graafikabiennaal Ljubljanas 19. VI-30. IX. Eesti kuraator Eha Komissarov, kujundaja Liina Siib. Elutöö preemia ئ Lojze Spacal, grand prix ئ Richard Hamilton, peaauhind ئ Sang-Gon Chung, üks kolmest hõbemedalist ئ Marko Laimre installatsioon "Verelilled" (digitaaltrükk, segatehnika, 1999). Andres Tali, Liina Siibi, Marko Mäetamme väljapanekust
Luuk, Tamara
2002-01-01
21. VI-25. VIII Rotermanni soolalaos kunstimuuseumi saalis näitus "Vallooni aarded. Kunst Valloonias XX sajandil". Väljas on 53 kunstniku 74 teost. Valiku tegid Tamara Luuk ja Eha Komissarov koostöös Belgia Prantsuse Kogukonna ja Mons'i Kunstimuuseumiga. Belglastest, pikemalt keraamik Max van der Lindenist
XXI sajandi muuseum : kas rahvusluse tempel või kaasaegne institutsioon? / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2006-01-01
17. V Kumus toimunud avalikust püsiekspositsiooni diskussioonist "Milline peab olema XXI sajandi muuseumi ekspositsioon?". Arutelu teemad "Millist ajalugu me vajaksime?", "Kas Kumus on kohta kaasaegsele kunstile?", sõnastas Kumu kuraator Eha Komissarov, üritust modereeris Sirje Helme, paneelis osalesid Rael Artel, Marco Laimre, Ly Lestberg ja Leonhard Lapin
Kuus TÜ teadlast sai riigi teaduspreemia
2013-01-01
Eest Vabariigi aastapäeval pälvisid preemia täppisteaduste alal prof. Mikhail Brik, keemia ja molekulaarbioloogia alal prof. Jaanus Remme, arstiteaduse vallas prof-d Jaan Eha ning Mihkel Zilmer, geo- ja bioteaduste alal vanemteadur Peeter Hõrak, humanitaarteaduste alal vanemteadur Andres Tvauri
Arhiivi optiline alateadvus : kunstniku töö ja kuraatoritöö / Hanno Soans
Soans, Hanno, 1974-
2000-01-01
Moderna Museetis eksponeeritud šoti kunstniku Douglas Gordoni filmiinstallatsioonist, kus kuraatori ülesande võtnud kunstnik esitas läbilõike arhiivist ja visualiseeris ühe võimaluse selle lugemiseks. Eesti Kunstimuuseumis Eha Komissarovi kureeritud näitusest 'XX sajandi kunstniku mälestuseks' (kujundaja Jaan Toomik), mille esmane ülesanne oli arhiivi elustamine
Sõjad iseendas ja maailmas / Aita Kivi
Kivi, Aita, 1954-
2001-01-01
Sisu : Kerttu Rakke. [Kuus, Kadi]. Kolmas printsess; August Gailit. Purpurne surm; David Sweetman. Toulouse-Lautrec; Anne Stuart. Salaarmastaja; Loomismäng / Eha Rüütel, Taimi Elenurm, Aice Pehk jt.; Kuidas mõista maalikunsti / peatoim. Alexander Sturgis; Clay Perry. Imelised õied; Vicci Bentley. Igavesti noor; Poul Anderson. Jumalate sõda
DEFF Research Database (Denmark)
Maingi, N.; Bjørn, H.; Gichohi, V.M.
1998-01-01
The occurrence of anthelmintic resistance on 25 sheep farms in the Nyandarua District of Kenya was investigated, using the faecal egg count reduction test (FECRT), the egg hatch assay (EHA) and a larval development assay (LDA). In the FECRT, resistance to both benzimidazoles (BZs) and levamisole...
Kontor, Ana
2003-01-01
Autor vastab küsimusele, missugune kool tuleb valida normintellektiga lapsele, kes on tavalisest aeglasema mõtlemisega. Tartu Ülikooli haridusteaduskonna eripedagoogika osakonna logopeedia ja emakeele didaktika õppetooli dotsendi, pedagoogikadoktori Karl Karlepi ja Krooniaia kooli õpiabi- ja nõustamiskeskuse õpetaja Eha Vihma arvamused sel teemal
Effects of concurrent enteral hyperalimentation with chemo-radiotherapy in patients with oral cancer
International Nuclear Information System (INIS)
Morishita, Keiko; Ohno, Seiji; Kohno, Michiko; Narikawa, Gen; Sasabe, Eri; Yamamoto, Tetsuya
2010-01-01
We compared the nutritional condition, immunological function, and frequency of adverse effects during concurrent chemoradiotherapy for oral cancer between patients simultaneously receiving enteral hyperalimentation (Racol) (n=20; EHA group) and patients receiving peripheral vein nutrition (n=20; PVN group). Although there was no significant difference in the change of body weight between the two groups, the decrease of plasma albumin values in the EHA group appeared later than in the PVN group. In the PVN group, the number of lymphocytes and lymphocyte blastogenesis significantly decreased on and after day 14. On the other hand, in the EHA group, the number of lymphocytes decreased only on day 14 and no decrease in lymphocyte blastogenesis was observed. While stomatitis developed in all patients, the severity was lower in the EHA group than the PVN one. These results suggest that the simultaneous administration of Racol during concurrent chemoradiotherapy for oral cancer inhibits the deterioration of nutritional and immunological conditions as well as the severity of stomatitis. This nutrient therapy is therefore considered to be a supportive therapy for oral cancer patients. (author)
Numerical modeling for an electric-field hyperthermia applicator
Wu, Te-Kao; Chou, C. K.; Chan, K. W.; Mcdougall, J.
1993-01-01
Hyperthermia, in conjunction with radiation and chemotherapy for treatment of cancers, is an area of current concern. Experiments have shown that hyperthermia can increase the potency of many chemotherapy drugs and the effectiveness of radiation for treating cancer. A combination of whole body or regional hyperthermia with chemotherapy or radiation should improve treatment results. Conventional methods for inducing whole body hyperthermia, such as exposing a patient in a radiant cabinet or under a hot water blanket, conduct heat very slowly from the skin to the body core. Thus a more efficient system, such as the three-plate electric-field hyperthermia applicator (EHA), is developed. This three-plate EHA has one top plate over and two lower plates beneath the patient. It is driven at 27.12 MHz with 500 Watts through a matching circuit. Using this applicator, a 50 kg pig was successfully heated to 42 C within 45 minutes. However, phantom and animal studies have indicated non-uniform heating near the side of the body. In addition, changes in the size and distance between the electrode plates can affect the heating (or electromagnetic field) pattern. Therefore, numerical models using the method of moments (MOM) or the finite difference time domain (FDTD) technique are developed to optimize the heating pattern of this EHA before it is used for human trials. The accuracy of the numerical modeling has been achieved by the good agreement between the MOM and FDTD results for the three-plate EHA without a biological body. The versatile FDTD technique is then applied to optimize the EHA design with a human body. Both the numerical and measured data in phantom blocks will be presented. The results of this study will be used to design an optimized system for whole body or regional hyperthermia.
The European Hematology Association Roadmap for European Hematology Research: a consensus document.
Engert, Andreas; Balduini, Carlo; Brand, Anneke; Coiffier, Bertrand; Cordonnier, Catherine; Döhner, Hartmut; de Wit, Thom Duyvené; Eichinger, Sabine; Fibbe, Willem; Green, Tony; de Haas, Fleur; Iolascon, Achille; Jaffredo, Thierry; Rodeghiero, Francesco; Salles, Gilles; Schuringa, Jan Jacob
2016-02-01
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology research. Initiated by the EHA, around 300 experts contributed to the consensus document, which will help European policy makers, research funders, research organizations, researchers, and patient groups make better informed decisions on hematology research. It also aims to raise public awareness of the burden of blood disorders on European society, which purely in economic terms is estimated at €23 billion per year, a level of cost that is not matched in current European hematology research funding. In recent decades, hematology research has improved our fundamental understanding of the biology of blood disorders, and has improved diagnostics and treatments, sometimes in revolutionary ways. This progress highlights the potential of focused basic research programs such as this EHA Roadmap.The EHA Roadmap identifies nine 'sections' in hematology: normal hematopoiesis, malignant lymphoid and myeloid diseases, anemias and related diseases, platelet disorders, blood coagulation and hemostatic disorders, transfusion medicine, infections in hematology, and hematopoietic stem cell transplantation. These sections span 60 smaller groups of diseases or disorders.The EHA Roadmap identifies priorities and needs across the field of hematology, including those to develop targeted therapies based on genomic profiling and chemical biology, to eradicate minimal residual malignant disease, and to develop cellular immunotherapies, combination treatments, gene therapies, hematopoietic stem cell treatments, and treatments that are better tolerated by elderly patients. Copyright© Ferrata Storti Foundation.
Directory of Open Access Journals (Sweden)
Letícia De Toni
2008-04-01
Full Text Available The subject of this paper is to test antimicrobials activities by medicinal plants extracts against more important contagious bovine mastitis pathogens. Disinfectants solutions was made from Baccharis trimera (Less D.C., Compositae (Asteracea, Eucalyptus spp Labill., Myrtaceae e Tagetes minuta (Linn., Compositae (Asteracea plants by hidroalcoholic extraction (EHA or decoction (DEC. S. aureus, S. agalactiae, and P. aeruginosa were used. To test for in vitro efficacy, each solution disinfectant was mixed with bacterial suspension containing 105 CFU.mL-1, by 30 seconds, two, 10 ant 30 minutes, with and without 20% of integral milk. Viable bacteria were evaluated by directed plating of neutralized aliquots. The worked included chlorhexidine 0,18% by control and it was executed in duplicate. EHA Eucalytpus spp and EHA T. minuta were as effective as control chlorhexidine against S. aureus. This solutions plus EHA B. trimera, were as effective as control against S. agalactiae. DEC Eucalyptus and DEC B. trimera also inactivated S. agalactiae in more prolongated time. Chlorhexidine was the best against P. multocida in milk absence, although the EHA were effective at ten or thirty minutes. All solutions, inclusive control, it was sensibility to organic load. The observations from the in vitro studies presented here need to be substantiated by in vivo studies by to confirm the potentiality use of plants medicinal extracts as disinfectants/antisepsis in livestock health. O presente trabalho busca avaliar a cinética da atividade antimicrobiana de extratos de plantas medicinais frente a bactérias relacionadas com mastite bovina. Para tal, foram produzidas soluções desinfetantes a partir de folhas e talos de Baccharis trimera (Less D.C., Compositae (Asteraceae, Eucalyptus spp Labill., Myrtaceae e Tagetes minuta (Linn., Compositae (Asteraceae, através de extração hidroalcoólica (EHA e decocto (DEC. Os microrganismos utilizados foram S. aureus, S
2007-01-01
Kalev Saare näitus "Portfolio" Võru Linnagaleriis kuni 2. III. Arhitektuurinäitused "Praha kubism" ja Jozhe Plechnik" Eesti Arhitektuurimuuseumis 03.-04. 2007. Tallinnas Soo 4 avatud kunsti- ja sisustusgaleriist SooSoo (galeristid Kadi Kõpper, Ülle Jehe), kus avanäitusena on kuni 17. III väljas Martin Pedaniku graafikaseeria "Kizoo". Hando Tamme maalinäitus "Meie aja kangelased vol 2" Jõhvi Kunstikooli galeriis 5.-31. III. Kunstiteaduste Instituudi Talvefoorum 007 ja muusikaürituste sari Müsteerium 3.-4. III Juurus. Loetletud "Kujundite taaskasutusel" esinejaid
2008-01-01
Oma ettevõtte peresõbralikkusest ja paindlikkusest räägivad Kädi Vestberg HR factory OÜ-st, Kadri Johanson CV-Keskusest, Kati Oja reisibüroost Estravel, Helena Erm Scania Eesti AS-ist, Moonika Kähr kinnisvarafirmast Uus Maa, Liina Oks Sampo pangast, Reet Treial Balti Investeeringute Grupi Pank AS-ist, Ülle Matt elektroonikafirmast Elcoteq, Silvia Savik Nukuteatrist, Ülle Filin Tele2 Eesti AS-ist, Sirje Tammiste Sirje Tammiste Konsultandibüroost, Getri Järvsoo Fortum Termest AS-ist ja Kärt Kirso AS-ist Kalev Chocolate Factory
Magusaärist lahkuv Kruuda vajas raha investeeringuteks / Lauri Linnamäe
Linnamäe, Lauri
2007-01-01
Ärimees Oliver Kruuda müüs Kalevi ja Tere toiduainetööstused Eesti investeerimisfirmale Alta Capital, kelle esindaja Indrek Rahumaa sõnul on mõlemad pooled rahul. Finantsinspektsiooni taunivast suhtumisest müügiettevalmistuste väikeaktsionäride eest saladuses hoidmise pärast. Vt. samas: Võidusõitjast suurinvestor; Savisaar taunis Kalevi müüki; Andrus Karnau intervjuud Oliver Kruudaga: Meediaportaali nimeks saab Kalev.ee. Lisa: Alta Capital Partners; Kalevi grupi struktuur; Skandaalne K-kohuke
President tunnustab Pärnumaad kümne riikliku autasuga / Eno-Gerrit Link
Link, Eno-Gerrit
2007-01-01
Pärnumaalt saavad iseseisvuspäeva puhul riikliku autasu kümme inimest. Vt. samas: Ester Vilgats. Ivar Kaldasaunal on alati kollektiiviga vedanud; Vello Lahtvee kolmkümmend aastat kohtunikuna. Teenetemärgi pälvinute seas on Lääne-Eesti päästekeskuse direktor Ivar Kaldasaun ja Pärnu maakohtu kohtunik Vello Lahtvee. Vt. ka juhtkiri lk. 15: Vilgats, Kalev. Ebaõigluse visa vastupanu. Rüütliristi kavaler Harald Nugiseks jäi taas teenetemärgist ilma
Ettevõtja hea nime kaitseks / Olari Koppel
Koppel, Olari
2004-01-01
Ilmunud ka: Meie Maa, 1. dets. 2004, lk. 2; Põhjarannik, 30. nov. 2004, lk. 2; Severnoje Poberezhje, 30. nov. 2004, lk. 2; Pärnu Postimees, 2. dets. 2004, lk. 11; Koit, 2. dets. 2004, lk. 6; Sakala, 3. dets. 2004, lk. 2; Hiiu Leht, 3. dets. 2004, lk. 2. Sotsiaaldemokraatide arvates peab ettevõtte ja ettevõtja hea käekäik kajastuma ka töötajate heaolu kasvus. Vastuseks Kalev Kuke art. 24. nov. ajal. Vali Uudised
Unistused muudavad maailma / Enn Tammearu
Tammearu, Enn
2000-01-01
Rocca al Mare koolimaja ehitamisest, AS KGM Ehitus meeskonnast ja juhatuse esimehest Tiit Nurklikust. Projekti autor: AB Urbel & Peil. Arhitektid Emil Urbel, Indrek Erm, sisearhitekt Taso Mähar, projektijuht Ivar Aus. Konstruktiivne osa: E-Inseneribüroo. Kooli direktori Rein Rebase, I. Ausi, I. Ermi ja T. Nurkliku kommentaarid. Nr. 11, lk. 4-6: Rocca al Mare koolile 2000. a. parima betoonehitise tiitel. Akustik Linda Madalik. Monoliitbetoonitööd: AS Roxor Ehitus. Arvamust avaldavad: T. Nurklik, I. Erm, OÜ Roxoe Ehituse tehniline juht Kalev Ramjalg, žürii esimees Aadu Kana
Juhtimisülesanne : ja kalad saavad ka kinga / Ergo Metsla ; kommenteerinud Algis Perens, Liis Luuk
Metsla, Ergo, 1968-
2010-01-01
Juhtimisülesanne, kus ettevõte on pärast turu kokkulanemist sattunud majanduslikesse raskustesse ning ettevõtte juhid on valiku ees, kas lõhkuda aastaid koos töötanud meeskond ja koondada töötajaid või leida firma püsimajäämiseks mõni muu variant. Lahendust otsivad konsultantsioonifirma Helvetia Balti Partnerid juhatuse esimees Algis Perens ja Kalev SPA Veekeskuse müügi- ja turundusassistent Liis Luuk
Advice and Frequently Asked Questions (FAQs) for Citizen-Science Environmental Health Assessments.
Barzyk, Timothy M; Huang, Hongtai; Williams, Ronald; Kaufman, Amanda; Essoka, Jonathan
2018-05-11
Citizen science provides quantitative results to support environmental health assessments (EHAs), but standardized approaches do not currently exist to translate findings into actionable solutions. The emergence of low-cost portable sensor technologies and proliferation of publicly available datasets provides unparalleled access to supporting evidence; yet data collection, analysis, interpretation, visualization, and communication are subjective approaches that must be tailored to a decision-making audience capable of improving environmental health. A decade of collaborative efforts and two citizen science projects contributed to three lessons learned and a set of frequently asked questions (FAQs) that address the complexities of environmental health and interpersonal relations often encountered in citizen science EHAs. Each project followed a structured step-by-step process in order to compare and contrast methods and approaches. These lessons and FAQs provide advice to translate citizen science research into actionable solutions in the context of a diverse range of environmental health issues and local stakeholders.
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
Kotiyan, P. N.; Vavia, P. R.; Bharadwaj, Y. K.; Sabarwal, S.; Majali, A. B.
2002-12-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak ®1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed.
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
Energy Technology Data Exchange (ETDEWEB)
Kotiyan, P.N. E-mail: pramila-kotiyan@uiowa.edu; Vavia, P.R.; Bharadwaj, Y.K.; Sabarwal, S.; Majali, A.B
2002-12-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak[reg]1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed.
The European Hematology Association Roadmap for European Hematology Research
DEFF Research Database (Denmark)
Engert, Andreas; Balduini, Carlo; Brand, Anneke
2016-01-01
The European Hematology Association (EHA) Roadmap for European Hematology Research highlights major achievements in diagnosis and treatment of blood disorders and identifies the greatest unmet clinical and scientific needs in those areas to enable better funded, more focused European hematology...... research. Initiated by the EHA, around 300 experts contributed to the consensus document, which will help European policy makers, research funders, research organizations, researchers, and patient groups make better informed decisions on hematology research. It also aims to raise public awareness...... of the burden of blood disorders on European society, which purely in economic terms is estimated at €23 billion per year, a level of cost that is not matched in current European hematology research funding. In recent decades, hematology research has improved our fundamental understanding of the biology...
Directory of Open Access Journals (Sweden)
Bishnu Prasad Koiry
2014-10-01
Full Text Available Copolymerization is an important synthetic tool to prepare polymers with desirable combination of properties which are difficult to achieve from the different homopolymers concerned. This investigation reports the copolymerization of 2-ethylhexyl acrylate (EHA and styrene using copper bromide (CuBr as catalyst in combination with N,N,N’,N,N- pentamethyldiethylenetriamine (PMDETA as ligand and 1-phenylethyl bromide (PEBr as initiator. Linear kinetic plot and linear increase in molecular weights versus conversion indicate that copolymerization reactions were controlled. The copolymer composition was calculated using 1H NMR studies. The reactivity ratio of styrene and EHA (r1 and r2 were determined using the Finemann-Ross (FR, inverted Finemann-Ross (FR and Kelen-Tudos (KT methods. Thermal properties of the copolymers were also studied by using TGA and DSC analysis.
Electron beam processed transdermal delivery system for administration of an anti-anginal agent
International Nuclear Information System (INIS)
Kotiyan, P.N.; Vavia, P.R.; Bharadwaj, Y.K.; Sabarwal, S.; Majali, A.B.
2002-01-01
Electron beam irradiation was used to synthesize a matrix type transdermal system of isosorbide dinitrate, an effective anti-anginal agent. The drug was dissolved in two monomeric systems, 2-ethylhexyl acrylate (EHA) and 2-ethylhexyl acrylate : methyl methacrylate (9 : 1). The solutions were then directly irradiated on a backing membrane (Scotchpak[reg]1006) at different doses to get transdermal patches. The developed systems were evaluated for residual monomer content, equilibrium weight swelling ratio, weight uniformity, thickness uniformity, drug content, peel strength, in vitro release and skin permeation kinetics. They possessed excellent tack and adhesive properties. In the case of isosorbide dinitrate-EHA systems, an increase in the peel strength values with respect to the skin was observed with increasing radiation doses. The systems exhibited promising skin permeation kinetics favorable for transdermal drug delivery. The radiation stability of the drug in the pure solid state form was also assessed
Preparation of an Adhesive in Emulsion for Maxillofacial Prosthetic
Directory of Open Access Journals (Sweden)
Joaquín Palacios-Alquisira
2010-10-01
Full Text Available Maxillofacial prostheses is a dental medicine specialty aimed at restoring anatomical facial defects caused by cancer, trauma or congenital malformations through an artificial device, which is commonly attached to the skin with the help of an adhesive. The purpose of our research was to develop a pressure-sensitive adhesive (PSA based on acrylic monomers, characterizing and determining its drying kinetics, that is to say the time it takes to lose 50 to 90% of its moisture. The adhesive synthesis was realized by means of emulsion polymerization; the composition of formulations was: (AA‑MMA‑EA and (AA‑MMA‑2EHA with different molar ratios. The formulation based on (AA‑MMA‑2EHA with 50 w% of solids, presented good adhesive properties such as tack, bond strength, and short drying time. We propose this formulation as a PSA, because it offers an alternative for systemically compromised patients, by less irritation compared to organic solvent-based adhesives.
Zangueu, Calvin Bogning; Olounlade, Abiodoun Pascal; Ossokomack, Marlyse; Djouatsa, Yolande Noelle Nangue; Alowanou, Goue Géorcelin; Azebaze, Anatole Guy Blaise; Llorent-Martínez, Eulogio José; de Córdova, Maria Luisa Fernández; Dongmo, Alain Bertrand; Hounzangbe-Adote, Mawulé Sylvie
2018-05-02
Maytenus senegalensis is a common shrub which is scattered in tropical Africa. Different parts of this plant have been reported to be useful in traditional medicine against gastrointestinal disorders and intestinal worms. This study evaluated the anthelmintic activity of the aqueous stem bark extract of M. senegalensis using egg hatch assay (EHA), larval migration inhibition assay (LMIA) and adult worms' motility inhibition assay (AMIA). On EHA, the extract concentrations tested resulted in a significant (p 50%). These in vitro results suggest the presence of some anthelmintic properties in M. senegalensis extract, which is traditionally used by small farmers in west and central Africa. These effects may be due to the flavonoids and proanthocyanidins present in the extract and need to be studied under in vivo conditions.
NARINGENIN ENHANCED EFFICIENCY OF GUS ACTIVITY IN Passiflora mollissima (H.B.K. Bailey
Directory of Open Access Journals (Sweden)
G.O. Cancino
2004-06-01
Full Text Available The flavonoid naringenin has been investigated as a possible vir gene inducer in Agrobacterium-mediated transformation in Passiflora mollissima, P. giberti and Nicotiana tabacum cv. Xanthi. The transformation efficiency percentage of explants showing blue GUS expression and the extent of staining following inoculation with Agrobacterium tumefaciens strains EHA 105 and 1065, carrying gus and nptII genes was enhanced with the supplementation of the co-cultivation medium with naringenin. Supplementation of medium with 100µM (strain EHA 105 and 300 µM (strain 1065 naringenin was most effective at enhancing mean (±s.e.m., n=3 GUS activity in leaf explants (20.3 ± 2.4%, strain EHA; 105; 6.0 ± 0.57%, strain 1065 and nodal segments (16.7 ± 2.4% strain EHA 105; 8.3 ± 0.57% strain 1065 of P. mollissima. In P. giberti and N. tabacum maximum GUS activity was obtained in leaf and root explants with 100µM naringenin for both strains analysed. Additionally, when naringenin was added to Luria Bertani (LB medium, both bacterial growth via optical density and colony forming units were higher when compared to control. This is the first report of the use of naringenin to enhance gene transfer from Agrobacterium to plants. These findings suggest that naringenin can be used as an alternative to acetosyringone for vir gene induction in Agrobacterium. This approach may be especially useful in plants that are generally recalcitrant to Agrobacterium-mediatedtransformation.
Exhibition of photography from the Estonian diaspora / Ellu Maar
Maar, Ellu, 1982-
2010-01-01
Näitus "Photography from the Estonian Diaspora / Väliseesti foto" Kumu Kunstimuuseumis 8.10.-19.11.2010, kuraatorid Eha Komissarov ja Ellu Maar. Näitus tutvustas 1944. a. Eestist lahkunud või juba võõrsil sündinud fotograafide (Eric Soovere, Karl Hintzer, Priit Vesilind, Rein Välme jt.) loomingut ja valikut väliseesti fotoarhiividest
1994-07-15
34,AR V3 APR edrtion may be ved until eha uv’ed. CURITY" Sf ’’ NO F G .. Towsrds Talared lnterphae F .- wmon qjdM to 0 Surfzce-Actlve BenzyWM*irn Sa, -l...min with nltrog, purge. Solution "C NMR were preformed on a Bruker AC-200 wle so state ’C CPMAS, A b f • and "Sl CPMAS were run on a Bnker \\4SL.-400
Kaliningradi biennaal / Sandra Jõgeva
Jõgeva, Sandra, 1976-
2008-01-01
IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen
Kuidas sünnib pealkiri? / Pärt Lias
Lias, Pärt
2003-01-01
Eesti kirjanikud vastavad Pärt Liase küsimusele oma teoste pealkirjade saamisloo kohta: Doris Kareva, Ilona Laaman, Eha Lättemäe, Priidu Beier, Oskar Kruus, Jaan Kruusvall, Paul-Eerik Rummo ja Andres Vanapa (1); Triin Soomets, Priit Aimla, Aarne Puu, Einar Sander, Jüri Tuulik ja Ülo Tuulik (2); Nikolai Baturin, Leo Metsar, Toomas Vint, Leonid Stolovitš ja Pärt Lias (3)
Ecotoxicological hazard assessment of hydrocarbon contaminated soils: A case study
International Nuclear Information System (INIS)
Roy, Y.; Pauwels, S.J.; Chasse, R.
1994-01-01
The Ecotoxicological Hazard Assessment (EHA) developed by the Quebec Ministry of Environment and Wildlife was used as part of the management scheme of contaminated soils from a former refinery. The study consists of assessing five types of soils (reference, heavily contaminated, slightly contaminated, thermally-treated, and biotreated) to determine their relative intrinsic hazard. During the exploratory activities a series of ten assessment endpoints where identified to support this typical EHA. During SOURCE characterization, the physicochemical make-up of the soils is described and the presence and concentrations of priority pollutants is determined. During FATE characterization, the potential for bioconcentration, mobility, and persistence of pollutants is determined. During EFFECTS characterization, the soils and their leachates are tested using standard terrestrial and aquatic bioassays. The data from the toxicological and analytical testing program are evaluated semi-quantitatively on the basis of a scoring system developed by consensus. The discussion will highlight how data are used within an EHA to streamline the decision-making process regarding the follow-up cleanup and disposal of contaminated soils
Directory of Open Access Journals (Sweden)
Cun SHI
2018-05-01
Full Text Available This paper presents a novel transient lubrication model for the analysis of the variable load failure mechanism of high-speed pump used in Load Sensing Electro-Hydrostatic Actuator (LS-EHA. Focusing on the slipper/swashplate pair partial abrasion, which is considered as the dominant failure mode in the high-speed condition, slipper dynamic models are established. A forth sliding motion of the slipper on the swashplate surface is presented under the fact that the slipper center of mass will rotate around the center of piston ball when the swashplate angle is dynamically adjusted. Besides, extra inertial tilting moments will be produced for the slipper based on the theorem on translation of force, which will increase rapidly when LS-EHA pump operates under high-speed condition. Then, a dynamic lubricating model coupling with fluid film thickness field, temperature field and pressure field is proposed. The deformation effects caused by thermal deflection and hydrostatic pressure are considered. A numerical simulation model is established to validate the effectiveness and accuracy of the proposed model. Finally, based on the load spectrum of aircraft flight profile, the variable load conditions and the oil film characteristics are analyzed, and series of variable load rules of oil film thickness with variable speed/variable pressure/variable displacement are concluded. Keywords: Coupling lubrication model, Electro-Hydrostatic Actuator (EHA, High-speed pump, Partial abrasion, Slipper pair, Variable load
Alexithymia and emotional regulation: A cluster analytical approach.
Chen, Jie; Xu, Ting; Jing, Jin; Chan, Raymond C K
2011-02-23
Alexithymia has been a familiar conception of psychosomatic phenomenon. The aim of this study was to investigate whether there were subtypes of alexithymia associating with different traits of emotional expression and regulation among a group of healthy college students. 1788 healthy college students were administered with the Chinese version of the 20-item Toronto Alexithymia Scale (TAS-20) and another set of questionnaires assessing emotion status and regulation. A hierarchical cluster analysis was conducted on the three factor scores of the TAS-20. The cluster solution was cross-validated by the corresponding emotional regulation. The results indicated there were four subtypes of alexithymia, namely extrovert-high alexithymia (EHA), general-high alexithymia (GHA), introvert-high alexithymia (IHA) and non-alexithymia (NA). The GHA was characterized by general high scores on all three factors, the IHA was characterized by high scores on difficulty identifying feelings and difficulty describing feelings but low score on externally oriented cognitive style of thinking, the EHA was characterized by high score on externally oriented cognitive style of thinking but normal score on the others, and the NA got low score on all factors. The GHA and IHA were dominant by suppressive character of emotional regulation and expression with worse emotion status as compared to the EHA and NA. The current findings suggest there were four subtypes of alexithymia characterized by different emotional regulation manifestations.
Alexithymia and emotional regulation: A cluster analytical approach
Directory of Open Access Journals (Sweden)
Xu Ting
2011-02-01
Full Text Available Abstract Background Alexithymia has been a familiar conception of psychosomatic phenomenon. The aim of this study was to investigate whether there were subtypes of alexithymia associating with different traits of emotional expression and regulation among a group of healthy college students. Methods 1788 healthy college students were administered with the Chinese version of the 20-item Toronto Alexithymia Scale (TAS-20 and another set of questionnaires assessing emotion status and regulation. A hierarchical cluster analysis was conducted on the three factor scores of the TAS-20. The cluster solution was cross-validated by the corresponding emotional regulation. Results The results indicated there were four subtypes of alexithymia, namely extrovert-high alexithymia (EHA, general-high alexithymia (GHA, introvert-high alexithymia (IHA and non-alexithymia (NA. The GHA was characterized by general high scores on all three factors, the IHA was characterized by high scores on difficulty identifying feelings and difficulty describing feelings but low score on externally oriented cognitive style of thinking, the EHA was characterized by high score on externally oriented cognitive style of thinking but normal score on the others, and the NA got low score on all factors. The GHA and IHA were dominant by suppressive character of emotional regulation and expression with worse emotion status as compared to the EHA and NA. Conclusions The current findings suggest there were four subtypes of alexithymia characterized by different emotional regulation manifestations.
Poverty Reduction in India through Palliative Care: A Pilot Project.
Ratcliff, Cathy; Thyle, Ann; Duomai, Savita; Manak, Manju
2017-01-01
EMMS International and Emmanuel Hospital Association (EHA) implemented a pilot project, poverty reduction in India through palliative care (PRIPCare). A total of 129 interviews with patients and family enrolled in palliative care at three EHA hospitals (in Fatehpur, Lalitpur and Utraula) and staff discussions established that 66% of palliative care patients had lost livelihoods due to illness, 26% of patients' families had members who had lost livelihoods due to the illness, 98% of enrolled households had debts, 59% had loans for which they had sold assets, 69% of households took out debt after their family member fell ill, many patients do not know about government benefits and lack necessary documents, many village headmen require bribes to give people access to benefits, and many bereaved women and children lose everything. Palliative care enabled 85% of patients and families to spend less on medicines, 31% of patients received free medicines, all patients reduced use of out-patient departments (OPDs), 20% reduced use of inpatient departments (IPDs), and therefore spent less on travel, 8% of patients had started earning again due to improved health, members of 10% of families started earning again, and one hospital educated 171 village headmen and increased by 5% the number of patients and their families receiving government benefits. If only 0.7% of needy adults are receiving palliative care, these benefits could be delivered to 143 times more families, targeted effectively at poverty reduction. Palliative care has great scope to reduce that most desperate poverty in India caused by chronic illness. This article concerns a study by the UK NGO EMMS International and Indian NGO EHA, to assess whether palliative care reduces household poverty. EHA staff had noticed that many patients spend a lot on ineffective treatment before joining palliative care, many families do not know their entitlement to government healthcare subsidies or government pensions, and many
Sooman, Linda; Wennman, Anneli; Hamberg, Mats; Hoffmann, Inga; Oliw, Ernst H
2016-02-01
The genome of Aspergillus niger codes for a fusion protein (EHA25900), which can be aligned with ~50% sequence identity to 9S-dioxygenase (DOX)-allene oxide synthase (AOS) of Fusarium oxysporum, homologues of the Fusarium and Colletotrichum complexes and with over 62% sequence identity to homologues of Aspergilli, including (DOX)-9R-AOS of Aspergillus terreus. The aims were to characterize the enzymatic activities of EHA25900 and to identify crucial amino acids for the stereospecificity. Recombinant EHA25900 oxidized 18:2n-6 sequentially to 9R-hydroperoxy-10(E),12(Z)-octadecadienoic acid (9R-HPODE) and to a 9R(10)-allene oxide. 9S- and 9R-DOX-AOS catalyze abstraction of the pro-R hydrogen at C-11, but the direction of oxygen insertion differs. A comparison between twelve 9-DOX domains of 9S- and 9R-DOX-AOS revealed conserved amino acid differences, which could contribute to the chirality of products. The Gly616Ile replacement of 9R-DOX-AOS (A. niger) increased the biosynthesis of 9S-HPODE and the 9S(10)-allene oxide, whereas the Phe627Leu replacement led to biosynthesis of 9S-HPODE and the 9S(10)-allene oxide as main products. The double mutant (Gly616Ile, Phe627Leu) formed over 90% of the 9S stereoisomer of HPODE. 9S-HPODE was formed by antarafacial hydrogen abstraction and oxygen insertion, i.e., the original H-abstraction was retained but the product chirality was altered. We conclude that 9R-DOX-AOS can be altered to 9S-DOX-AOS by replacement of two amino acids (Gly616Ile, Phe627Leu) in the DOX domain. Copyright © 2015 Elsevier B.V. All rights reserved.
Arafa, Waleed M; Shokeir, Khalid M; Khateib, Abdelrahman M
2015-11-30
This study aimed to compare between the efficiency of in vivo fecal egg reduction test (FERT) and in vitro egg hatching assay (EHA) in evaluating of the anti-Fasciola activity of albendazole, triclabendazole, oxyclozanide and praziquantel. A field trial was carried out on fifty naturally Fasciola infected cattle that were divided equally into 5 groups (A-E). On day zero; groups A-D were drenched with albendazole, triclabendazole, oxyclozanide or praziquantel, respectively, while the remaining one, group E, was kept as untreated control. Fecal egg counts of the different groups were conducted weekly over a period of one month post-treatment. In vitro, commercial albendazole and oxyclozanide were diluted to 0.0002, 0.002, 0.02, 0.2 and 2.0 μg/ml, while commercial triclabendazole and praziquantel were diluted to concentrations of 25, 50, 75 and 100 μg/ml with dimethyl sulfoxide (DMSO). In vivo, at the 2nd week post-treatment, triclabendazole and oxyclozanide showed 100% fecal egg reduction (FER), and albendazole had a maximum of 73.7% reduction (P egg counts. In vitro, triclabendazole treated Fasciola gigantica eggs showed early embryonic lysis with zero% hatching at the different concentrations (P egg development and hatching percentage of oxyclozanide or praziquantel treated groups. In conclusion, the efficacy of triclabendazole and albendazole as fasciolicdes could be predicted by Egg Hatching Assay (EHA). Meanwhile fasciolicide activity of oxyclozanide could not be assessed with EHA. Based on in vivo and in vitro findings, paraziquantel did not show any fasciolicide effect. Copyright © 2015 Elsevier B.V. All rights reserved.
Ribas, Alessandra Ferreira; Kobayashi, Adilson Kenji; Pereira, Luiz Filipe Protasio; Vieira, Luiz Gonzaga Esteves
2006-01-01
Transgenic plants of Coffea canephora P. resistant to the herbicide ammonium glufosinate were regenerated from leaf explants after co-culture with Agrobacterium tumefaciens strain EHA105 harboring pCambia3301, a plasmid that contains the bar and the uidA genes both under control of 35S promoter. Direct somatic embryogenesis was induced on basal medium contained ¼ strength macro salts and half strength micro salts of MS medium, organic constituents of B5 medium and 30 g.L-1 sucrose supp...
Genetic transformation of switchgrass.
Xi, Yajun; Ge, Yaxin; Wang, Zeng-Yu
2009-01-01
Switchgrass (Panicum virgatum L.) is a highly productive warm-season C4 species that is being developed into a dedicated biofuel crop. This chapter describes a protocol that allows the generation of transgenic switchgrass plants by Agrobacterium tumefaciens-mediated transformation. Embryogenic calluses induced from caryopses or inflorescences were used as explants for inoculation with A. tumefaciens strain EHA105. Hygromycin phosphotransferase gene (hph) was used as the selectable marker and hygromycin was used as the selection agent. Calluses resistant to hygromycin were obtained after 5-6 weeks of selection. Soil-grown switchgrass plants were regenerated about 6 months after callus induction and Agrobacterium-mediated transformation.
Inhibition of Human Serine Racemase, an Emerging Target for Medicinal Chemistry
Czech Academy of Sciences Publication Activity Database
Jirásková-Vaníčková, Jana; Ettrich, Rüdiger; Vorlová, Barbora; Hoffman, Hillary Elizabeth; Lepšík, Martin; Jansa, Petr; Konvalinka, Jan
2011-01-01
Roč. 12, č. 7 (2011), s. 1037-1055 ISSN 1389-4501 R&D Projects: GA MŠk 1M0508; GA ČR GA203/08/0114 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z60870520 Keywords : amino acid analogs * L-erythro-3-hydroxyaspartate (L-EHA) * D-serine * neurodegenerative diseases * NMDA receptors * pyridoxal-5´-phosphate (PLP) Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.553, year: 2011
Me aiaäärne tsivilisatsioon / Andri Ksenofontov
Ksenofontov, Andri, 1962-
2008-01-01
Gerhard Richteri näitus "Ülevaade" 6. VI-17. VIII ja Eha Komissarovi kureeritud eesti kunstnike linnakeskkonna-teemaline näitus "Koht, mis paneb liikuma" 20. VI-17. VIII Kumu Kunstimuuseumis. Lühidalt Tõnis Saadoja Gerhard Richteri portreede seeriast "Mainstream" Kumu Kunstimuuseumis. Maarit Murka töödest, Kaarel Nurga fotodest, Anton Kooviti, Uku ja Remi grafititoast, Raoul Kurvitza arvutiinstallatsioonist "Pentatonic Color System II" (helilooja Ariel Lagle), Reet Ausi, Marit Ahvena,Ville Hyvöneni, Hula, EKA moedisaini ja Tartu Kõrgema Kunstikooli tekstiili- ja fotoosakonna projektist "Üle prahi", Kaido Ole installatsioonist "Koosolek"
Dicty_cDB: Contig-U01649-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 54 0.009 1 ( FL645158 ) TS48-B12 Reticulitermes flavipes symbiont library...um slug cDNA, clone SSL339. 357 5e-94 1 ( CX086000 ) EHACD50TR E. histolytica Normalized cDNA library... ... 86 5e-21 3 ( CX079571 ) EHAA042TF E. histolytica Normalized cDNA library ... 86 6e-...21 3 ( CX089649 ) EHAE215TR E. histolytica Normalized cDNA library ... 86 6e-21 3 ( CX098388 ) EHAHL09TR E. histolytic...a Normalized cDNA library ... 86 7e-21 3 ( CX095481 ) EHAGE33TR E. histolytic
Fu, Chunxiang; Hernandez, Timothy; Zhou, Chuanen; Wang, Zeng-Yu
2015-01-01
Alfalfa (Medicago sativa L.) is a high-quality forage crop widely grown throughout the world. This chapter describes an efficient protocol that allows for the generation of large number of transgenic alfalfa plants by sonication-assisted Agrobacterium-mediated transformation. Binary vectors carrying different selectable marker genes that confer resistance to phosphinothricin (bar), kanamycin (npt II), or hygromycin (hph) were used to generate transgenic alfalfa plants. Intact trifoliates collected from clonally propagated plants in the greenhouse were sterilized with bleach and then inoculated with Agrobacterium strain EHA105. More than 80 % of infected leaf pieces could produce rooted transgenic plants in 4-5 months after Agrobacterium-mediated transformation.
DEFF Research Database (Denmark)
Kohlenbach, Ulrich Wilhelm
2002-01-01
We show that the so-called weak Markov's principle (WMP) which states that every pseudo-positive real number is positive is underivable in E-HA + AC. Since allows one to formalize (atl eastl arge parts of) Bishop's constructive mathematics, this makes it unlikely that WMP can be proved within...... the framework of Bishop-style mathematics (which has been open for about 20 years). The underivability even holds if the ine.ective schema of full comprehension (in all types) for negated formulas (in particular for -free formulas) is added, which allows one to derive the law of excluded middle...
International Nuclear Information System (INIS)
Wu Jie; Yan Wenzhao; Zhou Yu; Zhang Xuemei
2010-01-01
Sweet potato which is one of the most important crops in the world has many advantages as a new bioreactor. Helicobacter pylori, as a kind of cancer-causing factor by the World Health Organization, has a strong immunogenicity, and its monoclonal antibody has bactericidal activity, which has the possibility as the vaccine components. In this research, we have constructed the plant expression vector with heat shock protein gene (HspB-C) of Helicobacter pylori. This vector was transformed by agrobactrium tumefaciens EHA105 into four sweet potato varieties. After callus-induction and re-differentiation, we got the transgenic plants from sweet potato variety of Nancy holl. (authors)
2012-09-27
ultralong lifetimes and their tomographic state analysis Phys. Rev. Lett. 92 220402 [7] Resch K J, Walther P and Zeilinger A 2005 Full characterization...of a three-photon Greenberger– Horne– Zeilinger state using quantum state tomography Phys. Rev. Lett. 94 070402 [8] Häffner H et al 2005 Scalable...Iterative algorithm for reconstruction of entangled states Phys. Rev. A 63 040303 [74] Molina-Terriza G, Vaziri A, Řeháček J, Hradil Z and Zeilinger
Anneli Remme soovitab : "Peeter!". Ciacinto Scelsi - mees Ida ja Lääne piirilt / Anneli Remme
Remme, Anneli, 1968-
2002-01-01
21. mail ja 1. juunil etendub Kanuti Gildi saalis tragikoomiline ning ühiskonnakriitiline dokumentaalooper "Peeter!", kus Areeni toimetajad Barbi Pilvre ja Tõnu Kaalep toovad avalikkuse ette tõlgenduse toimetaja Kalev Kesküla ja kirjanduskriitik Peeter Künstleri sõpruse tähelepanuväärsetest omadustest. Vastavaid osi esitavad laval Jaan-Villem Sibul ja Indrek Taalmaa. Eesti värskeima multimeediumi juurde kuulub tants ning Andres Maimiku - Jaak Kilmi filmikaadrid mitmete "avalike loomeinimeste" osalusel. Helilooja Toomas Trass. 30. mail toimub Eesti Muusikaakadeemia orelisaalis loeng-kontsert Scelsi muusikast, esinevad Tarmo Johannes (flöödid ja loeng) ning Vambola Krigul (löökpillid)
Avestik, Rait, 1974-
2006-01-01
17.-19. veebr. Viljandis toimunud üliõpilasteatrite festivalist, millest võtsid osa Tartu Üliõpilasteater : S. Kane "Puhastatud", lavastaja Kalev Kudu ; TÜ Pärnu kolledži üliõpilasteater K-äng2 : kohvikuprogramm "Maailma lõpus on kohvik" ; TÜ Viljandi Kultuuriakadeemia üliõpilased (mitte näitlejasuuna õppurid) : lavaline kompositsioon "Actus interruptus" ; Tallinna Tehnikaülikooli T-teater : Kurt Wonneguti "Õnne sünnipäevaks, Wanda June!", lavastaja Tamur Tohver ning Tallinna Ülikooli Tudengiteater : John Boynton Priestley "Nad tulid linna", lavastaja Juta Terali. Eraldi vaadeldakse TÜ Viljandi Kultuuriakadeemia 3. kursuse näitekunsti tudengite tööd : Dario Fo "Müsteerium Buff", lavastaja Peeter Raudsepp
DePass, L R; Maronpot, R R; Weil, C S
1985-01-01
Several important components of photocurable coatings were studied for dermal tumorigenic activity by repeated application to the skin of mice. The substances tested were 2-ethylhexyl acrylate (EHA) and methylcarbamoyloxyethyl acrylate (MCEA) (monomers); neopentyl glycol diacrylate (NPGDA), esterdiol-204-diacrylate (EDDA), and pentaerythritol tri(tetra)acrylate (PETA) (cross-linkers); and three acrylated urethane oligomers. For each bioassay, 40 C3H/HeJ male mice were dosed 3 times weekly on the dorsal skin for their lifetime with the highest dose of the test agent that caused no local irritation or reduction in body weight gain. Two negative control groups received acetone (diluent) only. A positive control group received 0.2% methylcholanthrene (MC). NPGDA and EHA had significant tumorigenic activity with tumor yields of eight and six tumor-bearing mice (three and two malignancies), respectively. The MC group had 34 mice with carcinomas and 1 additional mouse with a papilloma. MCEA had no dermal tumorigenic activity but resulted in early mortality. No skin tumors in the treatment area were observed in the other groups. Additional studies will be necessary to elucidate possible relationships between structure and tumorigenic activity for the acrylates.
Srinivasan, Ramachandran; Gothandam, Kodiveri Muthukalianan
2016-01-01
An effective transformation protocol for Dunaliella, a β-carotene producer, was developed using the synergistic mechanism of D-glucose and Acetosyringone on three different Agrobacterium strains (EHA105, GV3101 and LBA4404). In the present study, we investigated the pre-induction of Agrobacterium strains harboring pMDC45 binary vector in TAP media at varying concentrations of D-glucose (5 mM, 10 mM, and 15mM) and 100 μM of Acetosyringone for co-cultivation. Induction of Agrobacterium strains with 10 mM D-glucose and 100 μM Acetosyringone showed higher rates of efficiency compared to other treatments. The presence of GFP and HPT transgenes as a measure of transformation efficiency from the transgenic lines were determined using fluorescent microscopy, PCR, and southern blot analyzes. Highest transformation rate was obtained with the Agrobacterium strain LBA4404 (181 ± 3.78 cfu per 106 cells) followed by GV3101 (128 ± 5.29 cfu per 106 cells) and EHA105 (61 ± 5.03 cfu per 106 cells). However, the Agrobacterium strain GV3101 exhibited more efficient single copy transgene (HPT) transfer into the genome of D. salina than LBA4404. Therefore, future studies dealing with genetic modifications in D. salina can utilize GV3101 as an optimal Agrobacterium strain for gene transfer.
Directory of Open Access Journals (Sweden)
Qianru LV
2017-05-01
Full Text Available In this study, an efficient plant regeneration protocol in vitro and transformation by Agrobacterium-mediated method of Camellia sinensis was achieved, which would lay the foundation for genetic improvement of tea plant by genetic engineering technology. The cotyledon callus of C. sinensis were used as the receptors for transformation by Agrobacterium tumefaciens EHA105 containing PS1aG-3. Some factors which affected the result of Agrobacterium-mediated transformation of C. sinensis were studied on the basis of GUS transient expression system. The optimum system of Agrobacterium-mediated transformation was that the cotyledon callus were pre-cultured for 3 d, and then infected by EHA105 for 15 min followed by 3 d co-culture in the dark on the YEB medium containing 150 µmol⋅L−1 acetosyringone (AS. The transient expression rate of GUS gene was 62.6%. After being delayed selective culture for 3 d, infected callus were transferred into the differentiation medium and the root induction medium both of which were supplemented with 100 mg⋅L−1 spectinomycin, and then resistant seedlings of C. sinensis were obtained. The conversion rate was 3.6%.
International Nuclear Information System (INIS)
Polsuksiri, C.
1989-01-01
Experiments on using 3 different compounds of polythiol and an acrylate as sensitizer for radiation vulcanization were conducted. It was found that 1,4 butane diol propane tris-3-mercapto propionate showed the tendency to be a good sensitizer. The tensile strength of the rubber film prepared from the irradiated latex was found to be 14 MPa at sensitizer concentration of 1 phr and radiation dose of 45 kGy. As for 2-ethyl hexyl acrylate (2EHA), the maximum tensile strength of rubber film was found to be 23 MPa at concentration of 3 phr and radiation dose of 35 kGy. The mixture of 2 EHA and CCl 4 at various ratio was also used as sensitizer. The optimum ratio was found to be 5:1 at concentration of 6 phr and radiation dose of 15 kGy. The maximum tensile strength was as high as 25 MPa. The study also revealed that the radiation vulcanized latex with crosslink density of about 18x10 18 C.L./cm 3 would give the rubber film of highest tensile strength
EDTA assisted synthesis of hydroxyapatite nanoparticles for electrochemical sensing of uric acid
Energy Technology Data Exchange (ETDEWEB)
Kanchana, P.; Sekar, C., E-mail: Sekar2025@gmail.com
2014-09-01
Hydroxyapatite nanoparticles have been synthesized using EDTA as organic modifier by a simple microwave irradiation method and its application for the selective determination of uric acid (UA) has been demonstrated. Electrochemical behavior of uric acid at HA nanoparticle modified glassy carbon electrode (E-HA/GCE) has been investigated by electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), linear sweep voltammetry (LSV) and amperometry. The E-HA modified electrode exhibits efficient electrochemical activity towards uric acid sensing without requiring enzyme or electron mediator. Amperometry studies revealed that the fabricated electrode has excellent sensitivity for uric acid with the lowest detection limit of 142 nM over a wide concentration range from 1 × 10{sup −7} to 3 × 10{sup −5} M. Moreover, the studied E-HA modified GC electrode exhibits a good reproducibility and long-term stability and an admirable selectivity towards the determination of UA even in the presence of potential interferents. The analytical performance of this sensor was evaluated for the detection of uric acid in human urine and blood serum samples. - Highlights: • EDTA- hydroxyapatite (HA) nanoparticles have been synthesized by microwave irradiation method. • A novel amperometric Uric Acid biosensor has been fabricated using E-HA/GCE. • The fabricated sensor exhibits a wide linear range, good stability and high reproducibility. • The sensor was applied for the detection of UA in human blood serum and urine.
EDTA assisted synthesis of hydroxyapatite nanoparticles for electrochemical sensing of uric acid
International Nuclear Information System (INIS)
Kanchana, P.; Sekar, C.
2014-01-01
Hydroxyapatite nanoparticles have been synthesized using EDTA as organic modifier by a simple microwave irradiation method and its application for the selective determination of uric acid (UA) has been demonstrated. Electrochemical behavior of uric acid at HA nanoparticle modified glassy carbon electrode (E-HA/GCE) has been investigated by electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), linear sweep voltammetry (LSV) and amperometry. The E-HA modified electrode exhibits efficient electrochemical activity towards uric acid sensing without requiring enzyme or electron mediator. Amperometry studies revealed that the fabricated electrode has excellent sensitivity for uric acid with the lowest detection limit of 142 nM over a wide concentration range from 1 × 10 −7 to 3 × 10 −5 M. Moreover, the studied E-HA modified GC electrode exhibits a good reproducibility and long-term stability and an admirable selectivity towards the determination of UA even in the presence of potential interferents. The analytical performance of this sensor was evaluated for the detection of uric acid in human urine and blood serum samples. - Highlights: • EDTA- hydroxyapatite (HA) nanoparticles have been synthesized by microwave irradiation method. • A novel amperometric Uric Acid biosensor has been fabricated using E-HA/GCE. • The fabricated sensor exhibits a wide linear range, good stability and high reproducibility. • The sensor was applied for the detection of UA in human blood serum and urine
EDTA assisted synthesis of hydroxyapatite nanoparticles for electrochemical sensing of uric acid.
Kanchana, P; Sekar, C
2014-09-01
Hydroxyapatite nanoparticles have been synthesized using EDTA as organic modifier by a simple microwave irradiation method and its application for the selective determination of uric acid (UA) has been demonstrated. Electrochemical behavior of uric acid at HA nanoparticle modified glassy carbon electrode (E-HA/GCE) has been investigated by electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), linear sweep voltammetry (LSV) and amperometry. The E-HA modified electrode exhibits efficient electrochemical activity towards uric acid sensing without requiring enzyme or electron mediator. Amperometry studies revealed that the fabricated electrode has excellent sensitivity for uric acid with the lowest detection limit of 142 nM over a wide concentration range from 1 × 10(-7) to 3 × 10(-5)M. Moreover, the studied E-HA modified GC electrode exhibits a good reproducibility and long-term stability and an admirable selectivity towards the determination of UA even in the presence of potential interferents. The analytical performance of this sensor was evaluated for the detection of uric acid in human urine and blood serum samples. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Ramachandran Srinivasan
Full Text Available An effective transformation protocol for Dunaliella, a β-carotene producer, was developed using the synergistic mechanism of D-glucose and Acetosyringone on three different Agrobacterium strains (EHA105, GV3101 and LBA4404. In the present study, we investigated the pre-induction of Agrobacterium strains harboring pMDC45 binary vector in TAP media at varying concentrations of D-glucose (5 mM, 10 mM, and 15mM and 100 μM of Acetosyringone for co-cultivation. Induction of Agrobacterium strains with 10 mM D-glucose and 100 μM Acetosyringone showed higher rates of efficiency compared to other treatments. The presence of GFP and HPT transgenes as a measure of transformation efficiency from the transgenic lines were determined using fluorescent microscopy, PCR, and southern blot analyzes. Highest transformation rate was obtained with the Agrobacterium strain LBA4404 (181 ± 3.78 cfu per 106 cells followed by GV3101 (128 ± 5.29 cfu per 106 cells and EHA105 (61 ± 5.03 cfu per 106 cells. However, the Agrobacterium strain GV3101 exhibited more efficient single copy transgene (HPT transfer into the genome of D. salina than LBA4404. Therefore, future studies dealing with genetic modifications in D. salina can utilize GV3101 as an optimal Agrobacterium strain for gene transfer.
Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends
Directory of Open Access Journals (Sweden)
Ying Nie
2008-03-01
Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.
Dearman, Rebecca J; Betts, Catherine J; Farr, Craig; McLaughlin, James; Berdasco, Nancy; Wiench, Karin; Kimber, Ian
2007-10-01
There are currently available no systematic experimental data on the skin sensitizing properties of acrylates that are of relevance in occupational settings. Limited information from previous guinea-pig tests or from the local lymph node assay (LLNA) is available; however, these data are incomplete and somewhat contradictory. For those reasons, we have examined in the LLNA 4 acrylates: butyl acrylate (BA), ethyl acrylate (EA), methyl acrylate (MA), and ethylhexyl acrylate (EHA). The LLNA data indicated that all 4 compounds have some potential to cause skin sensitization. In addition, the relative potencies of these acrylates were measured by derivation from LLNA dose-response analyses of EC3 values (the effective concentration of chemical required to induce a threefold increase in proliferation of draining lymph node cells compared with control values). On the basis of 1 scheme for the categorization of skin sensitization potency, BA, EA, and MA were each classified as weak sensitizers. Using the same scheme, EHA was considered a moderate sensitizer. However, it must be emphasized that the EC3 value for this chemical of 9.7% is on the borderline between moderate (10%) categories. Thus, the judicious view is that all 4 chemicals possess relatively weak skin sensitizing potential.
Directory of Open Access Journals (Sweden)
M. Saeed
2007-01-01
Full Text Available This study was carried out to screen goat farms for anthelmintic resistance (AR against oxfendazole (OXF and to determine contributory factors for its development. For this purpose, Beetal goat farms (n = 18 were randomly selected, with natural mixed gastrointestinal nematodosis infection. In vivo (faecal egg count reduction test and in vitro (egg hatch assay tests were used to ascertain the presence of AR while a scorecard was used to determine the role of possible contributory factors for oxfendazole resistance. For in vivo test, the experimental animals were divided into two groups of 10 animals each; one group received OXF treatment, while the other served as control. Pre- and post-treatment coproculture was performed to identify the species and genera of nematodes. Egg hatch assay (EHA was used to confirm the results of FECRT. Fecal egg count reduction test (FECRT revealed the development of resistance on six farms and post-treatment larval cultures indicated Haemonchus contortus, Trichostrongylus colubriformis, Cooperia curticei, Teladorsagia circumcincta and Oesophagostomum spp. as dominant species with resistance. Furthermore, EHA confirmed the results of FECRT. Among the presumptive factors for AR, the highest composite score was for rotation of anthelmintics followed by treatment frequency, dose rate and nature of medication. The scorecard for the development of AR, used in this study, may be helpful for the assessment of contributory factors of AR.
Directory of Open Access Journals (Sweden)
Guo Hong
2018-05-01
Full Text Available With the rapid development of technology, motors have drawn increasing attention in aviation applications, especially in the more electrical aircraft and all electrical aircraft concepts. Power weight ratio and reliability are key parameters for evaluating the performance of equipment applied in aircraft. The temperature rise of the motor is closely related to the reliability of the motor. Therefore, based on Taguchi, a novel multi-objective optimization method for the heat dissipation structural design of an electro-hydrostatic actuator (EHA drive motor was proposed in this paper. First, the thermal network model of the EHA drive motor was established. Second, a sensitivity analysis of the key parameters affecting the cooling performance of the motor was conducted, such as the thickness of fins, the height of fins, the space of fins, the potting materials and the slot fill factor. Third, taking the average temperature of the windings and the power weight ratio as the optimization goal, the multi-objective optimal design of the heat dissipation structure of the motor was carried out by applying Taguchi. Then, a 3-D finite element model of the motor was established and the steady state thermal analysis was carried out. Furthermore, a prototype of the optimal motor was manufactured, and the temperature rise under full load condition tested. The result indicated that the motor with the optimized heat dissipating structure presented a low temperature rise and high power weight ratio, therefore validating the proposed optimization method.
Benzimidazoles Pharmacodynamics in Equine Strongyles
Directory of Open Access Journals (Sweden)
Laura Catana
2016-11-01
Full Text Available Our research aimed to assess the effectiveness of four benzimidazoles: albendazole, fenbendazole, mebendazole and thiabendazole against equine strongyles. The tests were performed between March 2015 and May 2016, on samples collected from 20 horses and 8 donkeys living in Harghita County. In vivo, Faecal Egg Count Reduction Test (FECRT was used to evaluate fenbendazole pharmacodynamics. In vitro, Egg hatch assay (EHA and Larval development assay (LDA were used to evaluate the effectiveness of albendazole, fenbendazole, mebendazole and thiabendazole. The predominance of small strongyle species was observed, mostly Cyathostomum type A. In the horse group, before treatment, the average intensity was 1595.5 EPG, the maximum value being 4000, and extensivity 55%. Tested again at 14 days after treatment, all samples were negative. In the donkey group, before treatment, the total number was 6550 EPG, intensity of 935.7 and extensivity of 87.5%. 14 days after treatment, the average intensity was 150 and the extensivity 50%. In the horse group, EHA proved the efficacy of fenbendazole (0.0192%, albendazole (0.3740% and thiabendazole (11.62% and a major risk of inducing adaptive phenomena for mebendazole (Y parameter 1009.92. In the donkey group, all benzimidazoles had limited effectiveness: thiabendazole (73.93%, mebendazole (87.51%, fenbendazole (94.05%, albendazole (111.67%. All benzimidazoles inhibited larval development. For all tested benzimidazoles, the resistance induction predictive comparative risk analysis highlighted the benefit of their use, provided that the treatment protocol allows sufficient contact time.
Directory of Open Access Journals (Sweden)
Laura CĂTANĂ
2017-11-01
Full Text Available The present study was aimed to evaluate the efficacy of anthelmintic agents against intestinal nematodes found in European bison. It was performed between October 2016 and May 2017, using Egg Hatch Assay (EHA and Larval Development Assay (LDA. The parasites were obtained from faecal samples, harvested from bisons in Romania and Sweden. The efficacy of albendazole (ABZ, mebendazole (MBZ thiabendazole (TBZ and pyrantel (PYR was tested. In EHA, the maximum efficacy was observed in MBZ (EC50 = - 0.227 μg/ml, and then TBZ (EC50 = - 0.2228. ABZ had a weaker result, EC50 being 0.326 μg/ml. All tested benzimidazoles registered hatching percentages below 50%, reflecting the lack of parasitic resistance. MIC obtained in the LDA tests were 0.2144 μg/ml for TBZ, 0.2792 μg/ml for PYR, 0.5429 μg/ml for MBZ, while ABZ came last (MIC = 0.8187 μg/ml. The in vitro tests proved the antiparasitic molecules efficacy against bisons nematode population and a limited risk of inducing resistance phenomena.
Directory of Open Access Journals (Sweden)
Kelly J. Henrickson
2009-10-01
Full Text Available Assays to simultaneously detect multiple potential agents of bioterrorism are limited. Two multiplex PCR and RT-PCR enzyme hybridization assays (mPCR-EHA, mRT-PCR-EHA were developed to simultaneously detect many of the CDC category “A” bioterrorism agents. The “Bio T” DNA assay was developed to detect: Variola major (VM, Bacillus anthracis (BA, Yersinia pestis (YP, Francisella tularensis (FT and Varicella zoster virus (VZV. The “Bio T” RNA assay (mRT-PCR-EHA was developed to detect: Ebola virus (Ebola, Lassa fever virus (Lassa, Rift Valley fever (RVF, Hantavirus Sin Nombre species (HSN and dengue virus (serotypes 1-4. Sensitivity and specificity of the 2 assays were tested by using genomic DNA, recombinant plasmid positive controls, RNA transcripts controls, surrogate (spiked clinical samples and common respiratory pathogens. The analytical sensitivity (limit of detection (LOD of the DNA asssay for genomic DNA was 1×100~1×102 copies/mL for BA, FT and YP. The LOD for VZV whole organism was 1×10-2 TCID50/mL. The LOD for recombinant controls ranged from 1×102~1×103copies/mL for BA, FT, YP and VM. The RNA assay demonstrated LOD for RNA transcript controls of 1×104~1×106 copies/mL without extraction and 1×105~1×106 copies/mL with extraction for Ebola, RVF, Lassa and HSN. The LOD for dengue whole organisms was ~1×10-4 dilution for dengue 1 and 2, 1×104 LD50/mL and 1×102 LD50/mL for dengue 3 and 4. The LOD without extraction for recombinant plasmid DNA controls was ~1×103 copies/mL (1.5 input copies/reaction for Ebola, RVF, Lassa and HSN. No cross-reactivity of primers and probes used in both assays was detected with common respiratory pathogens or between targeted analytes. Clinical sensitivity was estimated using 264 surrogate clinical samples tested with the BioT DNA assay and 549 samples tested with the BioT RNA assay. The clinical specificity is 99.6% and 99.8% for BioT DNA assay and BioT RNA assay, respectively. The
Directory of Open Access Journals (Sweden)
E.J.R. Silva
Full Text Available Os efeitos da administração oral subcrônica do extrato hidroalcoólico (EHA preparado de flores de Calendula officinalis L. foram investigados sobre os parâmetros hematológicos e bioquímicos em ratas Wistar adultas. Quarenta ratas (n=10/grupo foram tratadas durante 30 dias consecutivos com EHA por via oral nas doses de 0,25, 0,5, e 1,0 g/kg de peso e, em seguida, determinados os perfis bioquímico e hematológico e a massa dos órgãos. Os resultados mostram que durante o período do tratamento não se observou sinais de toxicidade ou morte. Os parâmetros bioquímicos e hematológicos, assim como a massa dos órgãos não foram modificados pela administração subcrônica do EHA, excetuando-se aumento significativo de 24,2% para uréia na maior dose estudada e aumento, respectivamente, de 62,3, 30,2 e 44,4%, para ALT. Na hematologia, registrou-se flutuação dentro dos valores de referência na contagem diferencial de neutrófilos, linfócitos e monócitos. Dessa forma, a administração subcrônica do extrato hidroalcoólico de Calendula officinalis não produz efeitos tóxicos sobre a maioria dos parâmetros bioquímicos e hematológicos estudados em ratas Wistar adultas. Entretanto, o aumento dos níveis séricos de uréia e alanina aminotransferase (ALT em doses elevadas sugere sobrecargas renal e hepática, respectivamente, as quais devem ser investigadas em maiores detalhes.
Lima, Helimar Gonçalves; Gomes, Danilo Cavalcante; Santos, Nathália Silva; Dias, Êuder Reis; Botura, Mariana Borges; Batatinha, Maria José Moreira; Branco, Alexsandro
2017-10-01
This study was designed to assess the in vitro anthelmintic activity of the fraction containing alkaloid from Prosopis juliflora pods on goat gastrointestinal nematodes using the egg hatch assay (EHA), larval migration inhibition assay (LMIA), and larval motility assay (LMA). The alkaloid-rich fraction (AF) - content juliprosopine as major alkaloid - was obtained from ethyl acetate extract after fractionation in Sephadex LH-20 chromatography column and its characterization were made by nuclear magnetic resonance analysis together with literature data comparison. The concentrations tested were 4.0, 2.67, 1.78, 1.19, and 0.79 mg/mL (EHA) and 4 mg/mL (LMIA and LMA). The in vitro cytotoxicity on Vero cell cultures was determined with the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide and trypan blue tests. High ovicidal activity was observed with IC 50 and IC 90 values at 1.1 and 1.43 mg/mL for AF. On the other hand, this fraction showed low larvicidal activity and high toxic effect. Thus, P. juliflora pod alkaloid rich-fraction has ovicidal activity in vitro against goat gastrointestinal nematodes and cytotoxic in Vero cell cultures. Prosopis juliflora alkaloid-rich fraction (AF) showed in vitro anthelmintic effect against gastrointestinal nematodes of goatsThe AF was more effective against eggs than third larval stage (L 3 ) of gastrointestinal nematodesThe AF showed cytotoxicity activity on Vero cell lineThe juliprosopine was the main alkaloid found in the AF from P. juliflora pods. Abbreviations used: AF: Alkaloid-rich fraction; DMSO: Dimethyl sulfoxide; EE: Ethyl acetate extract; EHA: Egg hatch assay; IC50: Inhibitory concentration 50%; IC90: Inhibitory concentration 90%; L3: Infective larvae; LMA: Larval motility assay; LMIA: Larval migration inhibition assay; MTT: Bromide 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide; NMR: Nuclear magnetic resonance; PBS: Phosphate buffered saline; RPMI: Roswell Park Memorial Institute médium; TLC
Directory of Open Access Journals (Sweden)
González, J. A.
2004-04-01
Full Text Available It is well known that in normal circumstances steel remains passive in concrete, due to the highly alkaline pH, and that the passivity of the rebars guarantees the practically unlimited durability of reinforced concrete structures (RCS. However, a number of matters continue to cause controversy, with the risk of promoting the acceptance of behaviours or mechanisms that cannot be extended to all circumstances; for instance: a that when carbonation is ruled out, concrete "always" imposes a highly alkaline pH on rebars. b that in RCSs corroding active state, cathodic control by oxygen diffusion in the aqueous phase of the pore network is "usual", c that the influence of galvanic macrocouples strongly conditions the rebar corrosion process, d that the concrete coating "always" has a protective effect on rebars. e that the initial grade of corrosion of rebars does not matter, since the concrete's great alkalinity guarantees their passivation. This paper presents results which demonstrate that the response of RCSs in the above cases is variable, at times contradictory, depending on the set of experimental conditions.
Resulta bien conocido que el acero permanece pasivo en el hormigón, en circunstancias normales, debido al pH fuertemente alcalino, y que la pasividad de las armaduras garantiza la durabilidad prácticamente ilimitada de las estructuras de hormigón armado (EHA. Sin embargo, existen cuestiones que siguen planteando, aún, activas controversias, con el riesgo de propiciar la aceptación de comportamientos o mecanismos que no son extensibles a todas las circunstancias, por ejemplo: a que, descartada la carbonatación, el hormigón impone "siempre" un pH muy alcalino a los refuerzos, b que, en las EHA que se corroen en estado activo, es "usual" un control catódico por difusión del oxígeno en la fase acuosa de la red de poros, c que la influencia de los macropares galvánicos condiciona fuertemente el proceso de corrosión de las
Multistate analysis of life histories with R
Willekens, Frans
2014-01-01
This book provides an introduction to multistate event history analysis. It is an extension of survival analysis, in which a single terminal event (endpoint) is considered and the time-to-event is studied. Multistate models focus on life histories or trajectories, conceptualized as sequences of states and sequences of transitions between states. Life histories are modeled as realizations of continuous-time Markov processes. The model parameters, transition rates, are estimated from data on event counts and populations at risk, using the statistical theory of counting processes. The Comprehensive R Network Archive (CRAN) includes several packages for multistate modeling. This book is about Biograph. The package is designed to (a) enhance exploratory analysis of life histories and (b) make multistate modeling accessible. The package incorporates utilities that connect to several packages for multistate modeling, including survival, eha, Epi, mvna, etm, mstate, msm, and TraMineR for sequence analysis. The book ...
DEFF Research Database (Denmark)
Habicht, Julia; Behler, Oliver; Kollmeier, Birger
2018-01-01
on the cognitive processes underlying speech comprehension. Eye-tracking and functional magnetic resonance imaging (fMRI) measurements were carried out with acoustic sentence-in-noise (SIN) stimuli complemented by pairs of pictures that either correctly (target) or incorrectly (competitor) depicted the sentence...... meanings. For the eye-tracking measurements, the time taken by the participants to start fixating the target picture (the ‘processing time’) was measured. For the fMRI measurements, brain activation inferred from blood oxygenation level dependent (BOLD) responses following sentence comprehension...... frontal areas for SIN relative to noise-only stimuli in the eHA group compared to the iHA group. Together, these results imply that HA experience leads to faster speech-in-noise processing, possibly related to less recruitment of brain regions outside the core sentence-comprehension network. Follow...
DEFF Research Database (Denmark)
Ross, Fiona M; Avet-Loiseau, Hervé; Ameye, Geneviève
2012-01-01
The European Myeloma Network has organized two workshops on fluorescence in situ hybridization in multiple myeloma. The first aimed to identify specific indications and consensus technical approaches of current practice. A second workshop followed a quality control exercise in which 21 laboratories...... analyzed diagnostic cases of purified plasma cells for recurrent abnormalities. The summary report was discussed at the EHA Myeloma Scientific Working Group Meeting 2010. During the quality control exercise, there was acceptable agreement on more than 1,000 tests. The conclusions from the exercise were...... that the primary clinical applications for FISH analysis were for newly diagnosed cases of MM or frank relapse cases. A range of technical recommendations included: 1) material should be part of the first draw of the aspirate; 2) samples should be sent at suitable times to allow for the lengthy processing...
Ma, Zhiying; Liu, Jianfeng; Wang, Xingfen
2013-01-01
Cotton is an important world economic crop plant. It is considered that cotton is recalcitrant to in vitro proliferation. Somatic embryogenesis and plant regeneration has been successful by using hypocotyl, whereas it is highly genotype dependent. Here, a genotype-independent cotton regeneration protocol from shoot apices is presented. Shoot apices from 3- to 5-day-old seedlings of cotton are infected with an Agrobacterium strain, EHA105, carrying the binary vector pC-KSA contained phytase gene (phyA) and the marker gene neomycin phosphotransferase (NPTII), and directly regenerated as shoots in vitro. Rooted shoots can be obtained within 6-8 weeks. Plants that survived by leaf painting kanamycin (kan) were -further analyzed by DNA and RNA blottings. The transgenic plants with increased the phosphorus (P) acquisition efficiency were obtained following the transformation method.
Jatropha (Jatropha curcas L.).
Maravi, Devendra Kumar; Mazumdar, Purabi; Alam, Shamsher; Goud, Vaibhav V; Sahoo, Lingaraj
2015-01-01
The seed oil of Jatropha (Jatropha curcas L.) as a source of biodiesel fuel is gaining worldwide importance. Commercial-scale exploration of Jatropha has not succeeded due to low and unstable seed yield in semiarid lands unsuitable for the food production and infestation to diseases. Genetic engineering is promising to improve various agronomic traits in Jatropha and to understand the molecular functions of key Jatropha genes for molecular breeding. We describe a protocol routinely followed in our laboratory for stable and efficient Agrobacterium tumefaciens-mediated transformation of Jatropha using cotyledonary leaf as explants. The 4-day-old explants are infected with Agrobacterium tumefaciens strain EHA105 harboring pBI121 plant binary vector, which contains nptII as plant selectable marker and gus as reporter. The putative transformed plants are selected on kanamycin, and stable integration of transgene(s) is confirmed by histochemical GUS assay, polymerase chain reaction, and Southern hybridization.
In memoriam 2000 / Vello Tõnso
Tõnso, Vello
2001-01-01
Maailm: Friedensreich Hundertwasser (15. XII 1928-19. II), Georg Segal (26. XI 1924-9. VI). Eesti: Mari Adamson (1. III 1908-3. I), Jaan Allpere (28. IV 1923-20. I), Aksel Eist (18. IX 1930-21. VII), Heiki Halla (3. VIII 1931-27. III), Lagle Israel (20. X 1923-24. IV), Helgi Koppel (8. V 1949-23. II), Jaak Olep (27. VIII 1945-18. VII), Laine Pisa (16. V 1923-24. I), Eha Ratnik (18. III 1928-2. III), Adele Ulm-Augustas (25. III 1908-6. IV), Aino Voolma (5. X 1920-15. IV), Roman Väli (29. VI 1910-15. V)
Vana õpetaja meenutab / Valter Voole
Voole, Valter
2000-01-01
Meenutusi koolielust pärast Teist maailmasõda. Autorid: Ilmar Oja, Ella Laaneorg, Laine Mägi, Liia Toom, Volli Mäeumbaed, Milvi Mett, Aune Ork, Aavo Lind, Rein Väljas, Toivo Pruul, Leo Tikerpuu, Lembit Sauer, Erna Kivi (Raavel), Salme Raave-Sõeruer, Ervin Norgan, Peeter Luiga, Maimo Hõbessaar, Heino Topp, Eha Remmelkoor (Türnpuu), Hermi Vain, Peeter Laredei. Meenutatakse ka koolinõunik Ernst Ennot ; Ülevaade Käinast ja president Pätsi külaskäigust. Algus: 1999, 20. nov. Järgneb 11.,18.,22.,25.,29. jaan., 1;5;8;10;15;19;26;29. veebr., 2;4;7;11;21;25. märts, 1;4;8;11;18;25;29. apr., 4;6;9;11;13;16;20;23;27;30. mai, 3;6;10;13;17;20;27. juuni, 1;4;8. juuli, 12. aug
Marie-Magdeleine, C; Udino, L; Philibert, L; Bocage, B; Archimede, H
2014-02-01
This study was carried out to evaluate the in vitro effect of Musa x paradisiaca stem and leaf against the parasitic nematode of small ruminants Haemonchus contortus. Three extracts (aqueous, methanolic and/or dichloromethane) of Musa x paradisiaca stem and leaf were tested in vitro on four developmental stages of H. contortus using egg hatch assay (EHA), larval development assay (LDA), L3 migration inhibition assay (LMI) and adult worm motility assay (AWM). The highly significant (P67% for each extract) and the negative effect of the dichloromethane extract of leaf on adult worm motility (43% of inhibition of motility after 24h of incubation) compared to the negative controls, suggest anthelmintic properties of Musa x paradisiaca stem and leaf against H. contortus. The active principles responsible for the activity could be secondary metabolites such as terpenoid and flavonoid compounds present in the leaf and stem of the plant. Copyright © 2013 Elsevier Ltd. All rights reserved.
HAMRI, Salah
2009-01-01
La préparation des solutions de PH différents, ainsi que la synthèse des réseaux de poly(acrylate de nbutyle)( PABu) et de poly(acrylate de 2-éthylhexyl)(PEHA), par photo polymérisation, constitue la première étape de notre travail, Le comportement de gonflement de réseaux réticulés acryliques l’ABu et l’EHA a été étudié en fonction de trois paramètres : le PH du milieu, le taux de réticulation et la température, Suivant les courbes que nous ayons obtenues, l’influence du PH reste...
Feeney, Mistianne; Punja, Zamir K
2015-01-01
Hemp (Cannabis sativa L.) suspension culture cells were transformed with Agrobacterium tumefaciens strain EHA101 carrying the binary plasmid pNOV3635. The plasmid contains a phosphomannose isomerase (PMI) selectable marker gene. Cells transformed with PMI are capable of metabolizing the selective agent mannose, whereas cells not expressing the gene are incapable of using the carbon source and will stop growing. Callus masses proliferating on selection medium were screened for PMI expression using a chlorophenol red assay. Genomic DNA was extracted from putatively transformed callus lines, and the presence of the PMI gene was confirmed using PCR and Southern hybridization. Using this method, an average transformation frequency of 31.23% ± 0.14 was obtained for all transformation experiments, with a range of 15.1-55.3%.
Dicty_cDB: Contig-U16300-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina
Dicty_cDB: Contig-U06890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 ) CLLX1301.b1_J13.ab1 CLL(XYZ) lettuce saligna Lact... 38 0.056 2 ( CX084866 ) EHABX22TR E. histolytica Normalized cDNA library...4-storage roo... 50 0.071 1 ( CX089593 ) EHAE127TR E. histolytica Normalized cDNA library...09.T7.185889.ab1 non-sporulating culture o... 54 0.005 1 ( EL926280 ) NY4ThAmp1_1...EST2947 Zea mays sperm cell cDNA library Zea mays... 38 0.21 2 ( BG320461 ) Zm03_10d10_A Zm03_AAFC_ECORC_cold_stre... ( AI438501 ) 486006A05.x4 486 - leaf primordia cDNA library fr... 38 0.21 2 ( AI861145 ) 603012G11.x1 603 - stressed root cDNA libra
Dicty_cDB: Contig-U15175-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available whol... 78 1e-28 4 ( CX092180 ) EHAF326TR E. histolytica Normalized cDNA library ... 50 3e-26 6 ( CX0...98602 ) EHAHN96TR E. histolytica Normalized cDNA library ... 50 3e-26 6 ( CX09268...5 ) EHAFA48TR E. histolytica Normalized cDNA library ... 50 4e-26 6 ( CX091758 ) EHAEX18TR E. histolytica Normalized cDNA library... ... 50 5e-26 6 ( CX095913 ) EHAGK43TR E. histolytica Normalized cDNA library ... 50 5e...-26 6 ( CX089873 ) EHAE527TR E. histolytica Normalized cDNA library ... 50 6e-26 6 ( CX095112 ) EHAG895TR E. histolytic
Directory of Open Access Journals (Sweden)
Luis A. Ríos-Osuna
2016-01-01
Full Text Available In this paper, polystyrene colloidal microspheres have been prepared using hexyl acrylate (HA, ethylhexyl acrylate (EHA, isooctyl acrylate (IOA, butyl acrylate (BA, or isobutyl acrylate (IBA as comonomers. Microspheres with diameters from 212 to 332 nm and with a polystyrene content of 65–78% were prepared. The particles prepared in this work do not present the typical core-shell structure; as a consequence, DSC analysis showed that the microspheres exhibited only one Tg. TEM images show that the particles with comonomer content below ~30% were spherical and regular. Microspheres containing comonomer between 21 to 25% produced the less brittle films showing very iridescent colors. The films prepared from microspheres containing hexyl, ethylhexyl, and isooctyl acrylate as comonomers are firmly attached to the substrate due to their adhesive properties. The large decrease of the fragility observed in these films makes them much more attractive materials in sensing applications.
UV-crosslinkable photoreactive self-adhesive hydrogels based on acrylics
Directory of Open Access Journals (Sweden)
Czech Zbigniew
2016-06-01
Full Text Available Hydrogels are a unique class of macromolecular networks that can hold a large fraction of an aqueous solvent within their structure. They are suitable for biomedical area including controlled drug delivery and for technical applications as self-adhesive materials for bonding of wet surfaces. This paper describes photoreactive self-adhesive hydrogels based on acrylics crosslinked using UV radiation. They are prepared in ethyl acetate through radical polymerization of monomers mixture containing 2-ethylhexyl acrylate (2-EHA, butyl acrylate (BA, acrylic acid (AA and copolymerizable photoinitiator 4-acryloyloxy benzophenone (ABP at presence of radical starter 2.2’-azobis-diisobutyronitrile AIBN. The synthesized acrylic copolymers were determined by viscosity and GPC analysis and later modified using ethoxylated amines. 4-acryloyloxy benzophenone (ABP was used as crosslinking monomer. After UV crosslinking the properties of these novel synthesized hydrogels, such as tack, peel adhesion, shears strength, elongation and water adsorption were also studied.
Sunflower (Helianthus annuus L.).
Radonic, Laura M; Lewi, Dalia M; López, Nilda E; Hopp, H Esteban; Escandón, Alejandro S; Bilbao, Marisa López
2015-01-01
Sunflower (Helianthus annuus L.) is still considered as a recalcitrant species to in vitro culture and transformation in spite of the publication of different protocols. Here we describe a routine transformation system of this crop which requires mature HA89 genotype seeds and Agrobacterium tumefaciens EHA105 strain for gene delivery, being both easily available. Selection of transformed shoots depends on root development in kanamycin-selective media, instead of shoot color, avoiding selection of escapes. The establishment of this protocol proved successful for the incorporation of both reporter and agronomic important genes and also for the evaluation of the specific expression patterns of different promoters in transgenic sunflower plants. Stable expression of the incorporated transgenes was confirmed by RT-PCR and GUS reporter gene visualization. Stable inheritance of transgenes was successfully followed until T2 generation in several independent lines.
Welding of heterogeneous 12Kh2MFSR steels with the Mn-Cr-Si-Ni system
International Nuclear Information System (INIS)
Smirnov, A.N.; Belogolov, E.I.
1978-01-01
The process of welding pipes of the 12Kh2MFSR pearlitic steels and austenitic steels of the Mn-Cr-Si-Ni system was studied. The filler materials were selected, and the working capacity of welded joints was examined in ageing and cyclic heatings. The microhardness of steels was measured, and the ultimate strength of welded joints was determined. The following has been established: the composite joints of steels of the Mn-Cr-Si-Ni system and 12Kh2MFSR steel are advisable to be welded on a coating layer welded by the EhA395/9 electrodes on the surface of a pipe of the 12Kh2MFSR pearlitic steel; this guarantees the sufficient working capacity of welded joints
Proceedings from the 1st Insights in Hematology Symposium, Cluj-Napoca, Romania March 11-12, 2016.
Bojan, Anca; Berindan-Neagoe, Ioana; Ciurea, S; Dima, Delia; Fuji, Shigeo; Ghiaur, G; Grewal, Ravnit; Mccormack, Emmet; Tanase, Alina; Trifa, A; Tomuleasa, Ciprian
2016-09-01
In the March 2016 issue of the Lancet Haematology, the editorial office published a paper stating the roadmap for European research in hematology, based on the European Hematology Association (EHA) consensus document that outlines the directions in hematology for the following years across the continent. The meeting entitled "Insights in hematology" is organized a support for the initiative of a roadmap for European hematologists regarding research, may it be basic research or clinical research, but this consensus should not be focused mainly on European institutions, but rather form the backbone of global research between Europe and the United States, Japan or any other country. This will allow Europeans to learn as well as to share their experience with the rest of the scientific and medical community. And the Cluj-Napoca meeting should be followed by other such meetings all across the EU.
Modeling Continuous-Time Random Processes in Digital Computer Simulations of Physical Systems
1986-08-27
hf) + BD1QD1B31 + BD2QD2B62 + BD3QD3BZ3 + BD4QD4BZ4 (51) where ODk = E[NDk-_•k] for k = 1 to 4. Note that PD(ti+l) has four BDiQDiBZi terms, one from...3 , collecting terms, and rearrang- ing equation (95), results in (aUz 3 + a 2 z 2 + a3z + ag4)hBV(z)Xlz) , (96) z 4 - alhAz 3 - (1 + a2 hA)z 2 - a 3...approximate the Taylor series form of I(h,I)? To answer this question, expand equation (1ll) in a series form , collect terms and compare it to 1(hI) . EhA
Proceedings from the 1st Insights in Hematology Symposium, Cluj-Napoca, Romania March 11-12, 2016
Directory of Open Access Journals (Sweden)
Bojan Anca
2016-09-01
Full Text Available In the March 2016 issue of the Lancet Haematology, the editorial office published a paper stating the roadmap for European research in hematology, based on the European Hematology Association (EHA consensus document that outlines the directions in hematology for the following years across the continent. The meeting entitled “Insights in hematology” is organized a support for the initiative of a roadmap for European hematologists regarding research, may it be basic research or clinical research, but this consensus should not be focused mainly on European institutions, but rather form the backbone of global research between Europe and the United States, Japan or any other country. This will allow Europeans to learn as well as to share their experience with the rest of the scientific and medical community. And the Cluj-Napoca meeting should be followed by other such meetings all across the EU.
Agrobacterium tumefaciens-mediated transformation of blueberry (Vaccinium corymbosum L.).
Song, Guo-Qing; Sink, K C
2004-12-01
Transient expression studies using blueberry leaf explants and monitored by beta-glucuronidase (GUS) assays indicated Agrobacterium tumefaciens strain EHA105 was more effective than LBA4404 or GV3101; and the use of acetosyringone (AS) at 100 microM for inoculation and 6 days co-cultivation was optimum compared to 2, 4, 8, 10 or 12 days. Subsequently, explants of the cultivars Aurora, Bluecrop, Brigitta, and Legacy were inoculated with strain EHA105 containing the binary vector pBISN1 with the neomycin phosphotransferase gene (nptII) and an intron-interrupted GUS gene directed by the chimeric super promoter (Aocs)3AmasPmas. Co-cultivation was for 6 days on modified woody plant medium (WPM) plus 100 microM AS. Explants were then placed on modified WPM supplemented with 1.0 mg l(-1) thidiazuron, 0.5 mg l(-1) alpha-naphthaleneacetic, 10 mg l(-1) kanamycin (Km), and 250 mg l(-1) cefotaxime. Selection for Km-resistant shoots was carried out in the dark for 2 weeks followed by culture in the light at 30 microE m(-2) s(-1) at 25 degrees C. After 12 weeks, selected shoots that were both Km resistant and GUS positive were obtained from 15.3% of the inoculated leaf explants of cultivar Aurora. Sixty-eight independent clones derived from such shoots all tested positive by the polymerase chain reaction using a nptII primer. Eight of eight among these 68 clones tested positive by Southern hybridization using a gusA gene derived probe. The transformation protocol also yielded Km-resistant, GUS-positive shoots that were also PCR positive at frequencies of 5.0% for Bluecrop, 10.0% for Brigitta and 5.6% for Legacy.
Eguale, Tadesse; Chaka, Hassen; Gizaw, Daniel
2009-10-01
A suspected case of albendazole resistance in a goat farm of Hawassa University was examined using faecal egg count reduction test (FECRT), controlled anthelmintic efficacy test and egg hatch assay (EHA) to verify the development of resistance and/or the need for higher doses of the drug in goats than in sheep. The experiment was conducted in 12 sheep (2 groups: treatment versus control) and 24 goats (4 groups: 3 treatments versus control, n = 6; per group) following artificial infection with infective larvae of Haemonchus contortus and Oesophagostomum columbianum. The first group of sheep and goats were treated orally with albendazole at the dose rate of 3.8 mg/kg body weight (i.e. manufacturer's recommended dose for sheep) while the second group of sheep and the fourth group of goats were left untreated. The second and the third group of goats were treated with albendazole at 5.7 and 7.6 mg/kg respectively. The FECRT showed an efficacy of albendazole in goats to be 65.5, 81.4 and 84.1% at the dose rate of 3.8, 5.7 and 7.6 mg/kg body weight respectively while in sheep it was 62% at the dose rate of 3.8 mg/kg. Increasing the dose to 1.5 the sheep recommended dose induced minor improvement of efficacy in goats; however the efficacy was almost the same at 1.5 and twice the dose recommended for sheep. Worm counts at day 15 post-treatment revealed that H. contortus has developed resistance to albendazole. EHA results also supported these findings. On the other hand, O. columbianum was 100% susceptible at all dose levels tested.
Emulsion templated scaffolds with tunable mechanical properties for bone tissue engineering.
Owen, Robert; Sherborne, Colin; Paterson, Thomas; Green, Nicola H; Reilly, Gwendolen C; Claeyssens, Frederik
2016-02-01
Polymerised High Internal Phase Emulsions (PolyHIPEs) are manufactured via emulsion templating and exhibit a highly interconnected microporosity. These materials are commonly used as thin membranes for 3D cell culture. This study uses emulsion templating in combination with microstereolithography to fabricate PolyHIPE scaffolds with a tightly controlled and reproducible architecture. This combination of methods produces hierarchical structures, where the microstructural properties can be independently controlled from the scaffold macrostructure. PolyHIPEs were fabricated with varying ratios of two acrylate monomers (2-ethylhexyl acrylate (EHA) and isobornyl acrylate (IBOA)) and varying nominal porosity to tune mechanical properties. Young's modulus, ultimate tensile stress (UTS) and elongation at failure were determined for twenty EHA/IBOA compositions. Moduli ranged from 63.01±9.13 to 0.36±0.04MPa, UTS from 2.03±0.33 to 0.11±0.01MPa and failure strain from 21.86±2.87% to 2.60±0.61%. Selected compositions were fabricated into macro-porous woodpile structures, plasma treated with air or acrylic acid and seeded with human embryonic stem-cell derived mesenchymal progenitor cells (hES-MPs). Confocal and two-photon microscopy confirmed cell proliferation and penetration into the micro- and macro-porous architecture. The scaffolds supported osteogenic differentiation of mesenchymal cells and interestingly, the stiffest IBOA-based scaffolds that were plasma treated with acrylic acid promoted osteogenesis more strongly than the other scaffolds. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.
Directory of Open Access Journals (Sweden)
Julia Habicht
2016-08-01
Full Text Available This study assessed the effects of hearing aid (HA experience on how quickly a participant can grasp the meaning of an acoustic sentence-in-noise stimulus presented together with two similar pictures that either correctly (target or incorrectly (competitor depict the meaning conveyed by the sentence. Using an eye tracker, the time taken by the participant to start fixating the target (the processing time was measured for two levels of linguistic complexity (low vs. high and three HA conditions: clinical linear amplification (National Acoustic Laboratories-Revised, single-microphone noise reduction with National Acoustic Laboratories-Revised, and linear amplification ensuring a sensation level of ≥ 15 dB up to at least 4 kHz for the speech material used here. Timed button presses to the target stimuli after the end of the sentences (offline reaction times were also collected. Groups of experienced (eHA and inexperienced (iHA HA users matched in terms of age, hearing loss, and working memory capacity took part (N = 15 each. For the offline reaction times, no effects were found. In contrast, processing times increased with linguistic complexity. Furthermore, for all HA conditions, processing times were longer (poorer for the iHA group than for the eHA group, despite comparable speech recognition performance. Taken together, these results indicate that processing times are more sensitive to speech processing-related factors than offline reaction times. Furthermore, they support the idea that HA experience positively impacts the ability to process noisy speech quickly, irrespective of the precise gain characteristics.
Habicht, Julia; Kollmeier, Birger; Neher, Tobias
2016-09-05
This study assessed the effects of hearing aid (HA) experience on how quickly a participant can grasp the meaning of an acoustic sentence-in-noise stimulus presented together with two similar pictures that either correctly (target) or incorrectly (competitor) depict the meaning conveyed by the sentence. Using an eye tracker, the time taken by the participant to start fixating the target (the processing time) was measured for two levels of linguistic complexity (low vs. high) and three HA conditions: clinical linear amplification (National Acoustic Laboratories-Revised), single-microphone noise reduction with National Acoustic Laboratories-Revised, and linear amplification ensuring a sensation level of ≥ 15 dB up to at least 4 kHz for the speech material used here. Timed button presses to the target stimuli after the end of the sentences (offline reaction times) were also collected. Groups of experienced (eHA) and inexperienced (iHA) HA users matched in terms of age, hearing loss, and working memory capacity took part (N = 15 each). For the offline reaction times, no effects were found. In contrast, processing times increased with linguistic complexity. Furthermore, for all HA conditions, processing times were longer (poorer) for the iHA group than for the eHA group, despite comparable speech recognition performance. Taken together, these results indicate that processing times are more sensitive to speech processing-related factors than offline reaction times. Furthermore, they support the idea that HA experience positively impacts the ability to process noisy speech quickly, irrespective of the precise gain characteristics. © The Author(s) 2016.
Directory of Open Access Journals (Sweden)
Y. A. Petrov
2014-01-01
Full Text Available The work concerns the constructive characteristics optimization of brushless D.C. (direct current motors used in electromechanical spacecraft drives.The spacecraft electromechanical drives and units use rather widely the brushless D.C. motors in which a motor commutator is replaced with more reliable semiconductor commutator controlled by the rotor position sensors. However, these motors are of low power.Electrohydraulic actuators (EHA use simple permanent-magnet motors (PMM of rather high power and commutator motors with graphite brush variable contacts.High reliability of brush motors, and, therefore a reliability of EHA in general, substantially depends on the quality of motor commutator operation. There are different reasons for a possible impact on the normal motor commutator operation. One of them is brush wear. Sparking brushes and burning commutator bars are possible in case brushes are poorly grinded to fit, brushes cannot freely move true in the brush holder box, and in case an incorrect force to clamp brushes to the commutator is chosen.It is established that drive wear resistance and operability depends on the gas environment composition being under sealed motor housing. In dry nitrogen environment brush wear suddenly raises because of the changing tribological performances of the commutator thus leading to essentially falling isolation resistance and no motor start.It is recommended to fill a space under sealed motor housing with air. Positive experience of operating spacecraft device containers with mobile electromechanical couples allowed us to find that in this case a dew point of filled air must be minus 20˚C.The paper offers an electromechanical alternative of design to the electrohydraulic actuators, with a ball-screw gear of the actuation mechanism, possessing a number of advantages.
Ademola, I O; Eloff, J N
2010-04-19
Parasitic nematodes, especially Haemonchus contortus (Rudolphi), are among the most common and economically important causes of disease in sheep and goats owned by pastoralists and small holder farmers in Africa. The control of these infections relies mainly on the use of anthelmintic drugs. However, herbal preparations are widely used by pastoralists and small holder farmers for the treatment of their livestock against helminth parasites. The anthelmintic effect of acetone leaf extract and fractions of Combretum molle was investigated to determine the relative efficacy of the components against gastrointestinal sheep nematodes. The fractions were obtained by solvent:solvent extraction from the acetone extract. These were evaluated for nematocidal activity by means of an egg hatch (EHA) and larval a development and viability assay (LDVA) in vitro. The effect of the test extracts on the hatchability of eggs and development of first to third stage larvae and the survival rate of the third stage larvae. H. contortus, were used to determine the relative bioactivities. Best-fit LC(50) values were computed using global model of nonlinear regression curve-fitting. The extracts inhibited egg hatching and development of the larvae of H. contortus in a concentration-dependent manner. Best-fit LC(50) values for the egg hatch test were 0.866, 0.333, 0.833, 0.747, and 0.065mg/mL for acetone extract, n-butanol, hexane, chloroform, and 35% water in methanol fractions, respectively. The best-fit LC(50) values for the LDVA were 0.604, 0.362, 1.077, 0.131 and 0.318mg/mL for the acetone extract, butanol, hexane, chloroform, and 35% water in methanol fractions, respectively. In the EHA the 35% water in methanol fraction was significantly more active than all the other fractions (pmolle leaf could find application in anthelmintic therapy in veterinary practice.
Short outlines of books by Estonian authors / Janika Kronberg, Rutt Hinrikus
Kronberg, Janika, 1963-
2003-01-01
Talvet, Jüri. ElegÍa Estonia y otros poemas = Eesti eleegia ja teisi luuletusi / Spanish transl. by the author and Albert L̉zaro Tinaut. Ciudad de València : Palmart, 2002 ; Ehlvest, Jüri. Hobune eikuskilt. Tallinn : Tänapäev, 2002 ; Raudam, Toomas. Saint-Prousti vastu. Tallinn : Eesti Keele Sihtasutus, 2002 ; Tode, Emil. Raadio. Tallinn : Eesti Keele Sihtasutus, 2002 ; Vene, Ilmar. Pahustumine ehk Uusaja olemus. Tallinn : Eesti Keele Sihtasutus, 2002 ; Annus, Epp. Kuidas kirjutada aega. Tallinn : Underi ja Tuglase Kirjanduskeskus, 2002 ; Lepik, Kalju. Valguse riie ei vanu. Kogutud luuletused 1938-1999 ; Barker, Matt. Waanenburgi tapatalgud. Tartu : EYS Veljesto, 2002 ; Kesküla, Kalev. Platoni riik. Tallinn : Tuum, 2002 ; Vahing, Vaino. Mängud ja kõnelused. Tallinn : Eesti Keele Sihtasutus, 2002 ; Tuulik, Jüri. Üksik lind mere kohal. Tallinn : Maalehe Raamat, 2002 ; Tätte, Jaan. Näidendid. Tallinn : Maalehe Raamat, 2002 ; Kareva, Doris. Mandragora. Tallinn : Huma, 2002
Directory of Open Access Journals (Sweden)
Weliton Antonio Bastos de Almeida
2003-02-01
Full Text Available Genetic transformation allows the release of improved cultivars with desirable characteristics in a shorter period of time and therefore may be useful in citrus breeding programs. The objective of this research was to establish a protocol for genetic transformation of Valencia and Natal sweet oranges (Citrus sinensis L. Osbeck and Rangpur lime (Citrus limonia L. Osbeck. Epicotyl segments of germinated in vitro plantlets (three weeks in darkness and two weeks in a 16-h photoperiod were used as explants. These were co-cultivated with Agrobacterium tumefaciens strain EHA-105 and different experiments were done to evaluate the transformation efficiency: explants were co-cultivated with Agrobacterium for one, three or five days; explants were incubated with Agrobacterium suspension for 5, 10, 20 or 40 minutes; co-cultivation medium was supplemented with acetosyringone at 0, 100 or 200 µmol L-1; Explants ends had a longitudinal terminal incision (2-3 mm; co-cultivation temperatures of 19, 23 or 27°C were imposed. The experimental design was completely randomized in all experiments with five replications, each consisted of a Petri dish (100 x 15 mm with 30 explants and resulted in a total of 150 explants per treatment. Longitudinal terminal incision in the explant ends did not improve shoot regeneration. However, transgenic plants of all three cultivars were confirmed from explants that had been subjected to inoculation time of 20 minutes, co-culture of three days at 23-27°C, in the absence of acetosyringone.A transformação genética permite produzir cultivares com características específicas e pode, dessa forma ser associada a programas de melhoramento de citros. O objetivo deste trabalho foi estabelecer protocolos de transformação genética para as laranjas doce 'Valência' e 'Natal' (Citrus sinensis L. Osbeck, bem como para o limão 'Cravo'(Citrus limonia L. Osbeck. Segmentos de epicótilo de plântulas germinadas in vitro (três semanas no
Carbon footprint of dairy goat milk production in New Zealand.
Robertson, Kimberly; Symes, Wymond; Garnham, Malcolm
2015-07-01
The aim of this study was to assess the cradle-to-farm gate carbon footprint of indoor and outdoor dairy goat farming systems in New Zealand, identifying hotspots and discussing variability and methodology. Our study was based on the International Organization for Standardization standards for life cycle assessment, although only results for greenhouse gas emissions are presented. Two functional units were included: tonnes of CO2-equivalents (CO2e) per hectare (ha) and kilograms of CO2e per kilogram of fat- and protein-corrected milk (FPCM). The study covered 5 farms, 2 farming systems, and 3yr. Two methods for the calculation of enteric methane emissions were assessed. The Lassey method, as used in the New Zealand greenhouse gas inventory, provided a more robust estimate of emissions from enteric fermentation and was used in the final calculations. The alternative dry matter intake method was shown to overestimate emissions due to use of anecdotal assumptions around actual consumption of feed. Economic allocation was applied to milk and co-products. Scenario analysis was performed on the allocation method, nitrogen content of manure, manure management, and supplementary feed choice. The average carbon footprint for the indoor farms (n=3) was 11.05 t of CO2e/ha and 0.81kg of CO2e/kg of FPCM. For the outdoor farms (n=2), the average was 5.38 t of CO2e/ha and 1.03kg of CO2e/kg of FPCM. The average for all 5 farms was 8.78 t of CO2e/ha and 0.90kg of CO2e/kg of FPCM. The results showed relatively high variability due to differences in management practices between farms. The 5 farms covered 10% of the total dairy goat farms but may not be representative of an average farm. Methane from enteric fermentation was a major emission source. The use of supplementary feed was highly variable but an important contributor to the carbon footprint. Nitrous oxide can contribute up to 18% of emissions. Indoor goat farming systems produced milk with a significantly higher carbon
Directory of Open Access Journals (Sweden)
Alessandra Ferreira Ribas
2006-01-01
Full Text Available Transgenic plants of Coffea canephora P. resistant to the herbicide ammonium glufosinate were regenerated from leaf explants after co-culture with Agrobacterium tumefaciens strain EHA105 harboring pCambia3301, a plasmid that contains the bar and the uidA genes both under control of 35S promoter. Direct somatic embryogenesis was induced on basal medium contained ¼ strength macro salts and half strength micro salts of MS medium, organic constituents of B5 medium and 30 g.L-1 sucrose supplemented with 5µM N6 - (2-isopentenyl-adenine (2-iP. Ten µM ammonium glufosinate was used for putative transgenic somatic embryos selection. Presence and integration of the bar gene were confirmed by PCR and Southern blot analysis. Selected transgenic coffee plants sprayed with up to 1600 mg.L-1 of FinaleTM, a herbicide containing glufosinate as the active ingredient, retained their pigmentation and continued to grow normally during ex vitro acclimation.Plantas transgênicas de Coffea canephora P resistentes ao herbicida glufosinato de amônio foram regeneradas a partir de explantes foliares co-cultivados com Agrobacterium tumefaciens EHA105 contendo o plasmídio pCambia3301 que contém os genes bar e uidA ambos sob controle do promotor 35S. Embriogênese somática direta foi induzida no meio contendo ¼ da concentração de macro, metade da concentração de micronutrientes do meio MS, constituintes orgânicos do meio B5 e 30 g.L-1 de sacarose suplementado com 5µM N6 - (2-isopentenil-adenina (2-iP e 10 µM de glufosinato de amônio para seleção de embriões transgênicos putativos. A presença e a integração do gene bar foram confirmados pelas análises de PCR e Southern blot. As plantas transgênicas selecionadas de café, pulverizadas com 1600 mg.L-1 do herbicida FinaleTM que contém glufosinato como ingrediente ativo, mantiveram a coloração e continuaram crescendo normalmente na aclimatação ex vitro.
Directory of Open Access Journals (Sweden)
Hernández, L. S.
2007-03-01
Full Text Available The present study compared the response of rust-free and corroded steel electrodes in Ca(OH2-saturated solutions and in cement mortar, essentially defined in terms of polarization resistance as measured with gravimetric, metallographic and electrochemical methods. Answers were sought for the following questions, which persist despite the use of reinforced concrete (RC in building for over a century: At what corrosion rate is RC durability seriously compromised? Does restoration of the initial conditions in properly manufactured concrete guarantee repassivation of corroded steel? Does the use of inhibitors enhance repassivation? Does the nature of the corrosion products have any significant effect on the response of corroded steel reinforcement? The results obtained in indicated that the effectiveness of preventive methods is much more closely related to the degree of existing corrosion than to the nature of the corrosion products.En el presente trabajo se analizan las respuestas de electrodos de acero, limpios y precorroídos, en soluciones saturadas de Ca(OH2 y en mortero de cemento, recurriendo para ello a técnicas gravimétricas, metalográficas y electroquímicas, esencialmente a medidas de resistencia de polarización. Se intenta encontrar respuesta a las siguientes dudas persistentes después de más de un siglo de utilización de las estructuras de hormigón armado (EHA: ¿qué velocidades de corrosión comprometen seriamente la durabilidad de las EHA? ¿La restauración de las condiciones iniciales de un hormigón correctamente fabricado garantiza la recuperación del estado pasivo en los refuerzos ya corroídos? ¿La utilización de inhibidores facilita la repasivación de los refuerzos? ¿Cambia la naturaleza de los productos de corrosión sustancialmente la respuesta de las armaduras ya corroídas? Los resultados obtenidos indican que la eficacia de las medidas preventivas resulta mucho más condicionada por el grado de
Hernández-Villegas, M M; Borges-Argáez, R; Rodriguez-Vivas, R I; Torres-Acosta, J F J; Méndez-Gonzalez, M; Cáceres-Farfan, M
2011-06-30
The development of anthelmintic resistance has impacted on the success of conventional anthelmintics (AH) for the control of gastrointestinal nematodes in grazing/browsing sheep and goats. Medicinal plants from the traditional herbolary in Mexico may provide new candidates that can be explored as alternative sources of AHs for ruminants. This study evaluated the leaf extracts derived from Phytolacca icosandra against infective L(3) larvae and eggs from Haemonchus contortus collected from sheep. Three extracts of different polarities were obtained from the leaf plants using ethanol, n-hexane and dichloromethane as the solvents. The effectiveness of the in vitro AH activity of the plant extracts was evaluated using larval migration inhibition (LMI) and egg hatch (EHA) assays. For the LMI assays, the ethanolic extract of P. icosandra showed 55.4% inhibition of larval migration at 2mg/mL (p<0.05). The dichloromethane extract of P. icosandra showed 67.1% inhibition of migration at 3mg/mL (p<0.05) and a dose-dependent response with an LD(50) of 0.90 mg/mL. The n-hexane extract failed to show inhibition of larval migration at any concentration explored. In the EHA for the ethanol extract, the lowest concentration tested (0.15 mg/mL) resulted in inhibition of egg hatching greater than 72.6%. Therefore, the LD(50) could not be calculated for this extract. The LD(50) of the dichloromethane extract of P. icosandra was 0. 28 mg/mL. An egg hatch inhibition greater than 90% was observed with both the ethanolic and dichloromethane extracts when using a concentration of 0.90 mg/mL or higher. The n-hexane extract failed to show egg hatch inhibition at any concentration tested. The AH activity reported for P. icosandra could be attributable to the flavonoids, steroids, terpenoids, coumarins and/or saponins that were present in the ethanolic and dichloromethane extracts. A combination of more than one component may also explain the observed AH activity against the H. contortus life
Directory of Open Access Journals (Sweden)
Gisele Dias da Silva
2016-10-01
Full Text Available ABSTRACT. da Silva G.D., Botura M.B., de Lima H.G., de Oliveira J.V.A., Moreira E.L.T., Santos F.O., de Souza T.S., de Almeida M.A.O. & Batatinha M.J.M. Evaluation of the anthelmintic activity and toxicity of an aqueous extract of Chenopodium ambrosioides in goats. [Avaliação da atividade anti-helmíntica e toxicidade do extrato aquoso de Chenopodium ambrosioides em caprinos.] Revista Brasileira de Medicina Veterinária, 38(Supl.1:156-162, 2016. Programa de Pós-Graduação em Ci- ência Animal nos Trópicos, Universidade Federal da Bahia, Av. Ademar de Barros, 500, Ondina, Salvador, BA 40170-110, Brasil. E-mail: mjmb@ufba.br The objective of this study was to evaluate the anthelmintic activity of an aqueous extract (AE from Chenopodium ambrosioides on goat gastrointestinal nematodes (GINs and its toxic effects. The anthelmintic activity in vitro was investigated using the inhibition of egg hatching assay (EHA, while cytotoxicity on Vero cells was evaluated using the MTT test. In vivo, thirty goats that were naturally infected with GINs were divided into three groups: group I, treated with a daily dose of AE C. ambrosioides (700mg/kg for eight days; group II (positive control, treated with a single dose of levamisole phosphate (6.3mg/kg; and Group III, untreated (negative control. Treatment efficacy was assessed on the basis of egg counts (FEC, faecal cultures and post-mortem worm burden counts. Clinical and laboratory evaluations were performed to detect toxic effects associated with treatment. In the EHA, the EC50 and EC90 corresponded to 1.6 and 1.9mg/mL, respectively. The AE promoted a slight reduction in cell viability in the cytotoxicity test. The AE reduced (p <0.05 the number of infective larvae of the genera Haemonchus and Oesophagostomum. The anthelmintic treatment of goats with AE C.ambrosioides resulted in moderate efficacy against infective larvae, but revealed neither ovicidal nor toxic activity towards adult nematodes. No toxic
Relevant in times of turmoil: WHO and public health in unstable situations.
Loretti, A; Leus, X; Van Holsteijn, B
2001-01-01
For millions of people world-wide, surviving the pressure of extreme events is the predominant objective in daily existence. The distinction between natural and human-induced disasters is becoming more and more blurred. Some countries have known only armed conflict for the last 25 years, and their number is increasing. Recently, humanitarian sources reported 24 ongoing emergencies, each of them involving at least 300,000 people "requiring international assistance to avoid malnutrition or death". All together, including the countries still only at risk and those emerging from armed conflicts, 73 countries, i.e., almost 1.8 trillion people, were undergoing differing degrees of instability. Instability must be envisioned as a spectrum extending between "Utopia" and "Chaos". As emergencies bring forward extreme challenges to human life, medical and public health ethics make it imperative for the World Health Organisation (WHO) to be involved. As such, WHO must enhance its presence and effectiveness in its capacity as a universally accepted advocate for public health. Furthermore, as crises become more enmeshed with the legitimacy of the State, and armed conflicts become more directed against countries' social capital, they impinge more on WHO's work, and WHO must reconcile its unique responsibility in the health sector, the humanitarian imperative and the mandate to assist its primary constituents. Health can be viewed as a bridge to peace. The Organization specifically has recognised that disasters can and do affect the achievement of health and health system objectives. Within WHO, the Department of Emergency and Humanitarian Action (EHA) is the instrument for intervention in such situations. The scope of EHA is defined in terms of humanitarian action, emergency preparedness, national capacity building, and advocacy for humanitarian principles. The WHO's role is changing from ensuring a two-way flow of information on new scientific developments in public health in
Directory of Open Access Journals (Sweden)
Esra Yilmaz
2017-12-01
Full Text Available Benzimidazoles (BZs remain amongst the most widely used anthelmintic drug classes against gastro-intestinal nematode infections, although their efficacy is increasingly compromised by resistance. The primary underlying mechanisms for BZ resistance are single-nucleotide polymorphisms (SNPs in the isotype 1 β-tubulin gene causing the substitutions F167Y, E198A or F200Y. However, resistance is believed to be multi-genic and previous studies have shown that isolates carrying 90–100% F200Y can vary considerably in their resistance level in the egg hatch assay (EHA. Cytochrome P450 monooxygenases (CYPs are associated with drug resistance in mammals and arthropods and have been considered as mediators of anthelmintic resistance. In Caenorhabditis elegans, several members of the CYP34/35 and CYP31 families are BZ and/or xenobiotic inducible and thiabendazole (TBZ is metabolised by CYP35D1. Here, expression of all 5 CYPs closely related to the C. elegans CYP34/35 and CYP31 families was investigated in fourth-stage larvae of two susceptible and three BZ-resistant Haemonchus contortus isolates following in vitro exposure to TBZ for 3 and 6 h using real-time RT-PCR. The resistance status of all isolates was determined using EHAs and quantification of resistance-associated β-tubulin SNPs using pyrosequencing. While none of the CYPs was TBZ inducible, constitutive expression of CYP34/35 family member HCOI100383400 was significantly 2.4–3.7-fold higher in the multi-drug resistant WR isolate with the strongest BZ resistance phenotype compared to susceptible and intermediate-level BZ-resistant isolates. Although this increase is only moderate, HCOI100383400 might still be involved in high-level BZ resistance by further decreasing susceptibility in isolates already carrying 100% of a β-tubulin SNP causing BZ resistance. Lower transcript levels were observed for all CYPs in the intermediately resistant IRE isolate in comparison to the susceptible Hc
Shri, Manju; Rai, Arti; Verma, Pankaj Kumar; Misra, Prashant; Dubey, Sonali; Kumar, Smita; Verma, Sikha; Gautam, Neelam; Tripathi, Rudra Deo; Trivedi, Prabodh Kumar; Chakrabarty, Debasis
2013-04-01
Agrobacterium-mediated transformation of indica rice varieties has been quite difficult as these are recalcitrant to in vitro responses. In the present study, we established a high-efficiency Agrobacterium tumefaciens-mediated transformation system of rice (Oryza sativa L. ssp. indica) cv. IR-64, Lalat, and IET-4786. Agrobacterium strain EHA-101 harboring binary vector pIG121-Hm, containing a gene encoding for β-glucuronidase (GUS) and hygromycin resistance, was used in the transformation experiments. Manipulation of different concentrations of acetosyringone, days of co-culture period, bacterial suspension of different optical densities (ODs), and the concentrations of L-cysteine in liquid followed by solid co-culture medium was done for establishing the protocol. Among the different co-culture periods, 5 days of co-culture with bacterial cells (OD600 nm = 0.5-0.8) promoted the highest frequency of transformation (83.04 %) in medium containing L-cysteine (400 mg l(-1)). Putative transformed plants were analyzed for the presence of a transgene through genomic PCR and GUS histochemical analyses. Our results also suggest that different cultural conditions and the addition of L-cysteine in the co-culture medium improve the Agrobacterium-mediated transformation frequencies from an average of 12.82 % to 33.33 % in different indica rice cultivars.
Cho, Myeong-Je; Wu, Emily; Kwan, Jackie; Yu, Maryanne; Banh, Jenny; Linn, Wutt; Anand, Ajith; Li, Zhi; TeRonde, Susan; Register, James C; Jones, Todd J; Zhao, Zuo-Yu
2014-10-01
An improved Agrobacterium -mediated transformation protocol is described for a recalcitrant commercial maize elite inbred with optimized media modifications and AGL1. These improvements can be applied to other commercial inbreds. This study describes a significantly improved Agrobacterium-mediated transformation protocol in a recalcitrant commercial maize elite inbred, PHR03, using optimal co-cultivation, resting and selection media. The use of green regenerative tissue medium components, high copper and 6-benzylaminopurine, in resting and selection media dramatically increased the transformation frequency. The use of glucose in resting medium further increased transformation frequency by improving the tissue induction rate, tissue survival and tissue proliferation from immature embryos. Consequently, an optimal combination of glucose, copper and cytokinin in the co-cultivation, resting and selection media resulted in significant improvement from 2.6 % up to tenfold at the T0 plant level using Agrobacterium strain LBA4404 in transformation of PHR03. Furthermore, we evaluated four different Agrobacterium strains, LBA4404, AGL1, EHA105, and GV3101 for transformation frequency and event quality. AGL1 had the highest transformation frequency with up to 57.1 % at the T0 plant level. However, AGL1 resulted in lower quality events (defined as single copy for transgenes without Agrobacterium T-DNA backbone) when compared to LBA4404 (30.1 vs 25.6 %). We propose that these improvements can be applied to other recalcitrant commercial maize inbreds.
Directory of Open Access Journals (Sweden)
Manuel Mateo Hernandez-Villegas
2014-04-01
Full Text Available The use of local resources for food and health care of animals is a highly profitable and sustainable strategy. Among these resources are native trees and shrubs which in addition to providing good quality nutrients, produce secondary metabolites with anthelmintic (AH effect. Therefore the aim of this study was to evaluate the in vitro AH effect of Gliricidia sepium leaves methanol extract (GSME, through the egg hatch inhibition assay (EHA. Three concentrations of the extracts were tested: 125, 250 and 500 μg/mL.  Also a negative control (distilled water and a positive control (levamisole 2 mg/mL were included. The GSME showed significant differences P<0.05 when compared with the positive control. The GSME also showed a dose-dependent response in inhibition of eggs hatching. Effectiveness percentages found were: 27.7%, 46.2%, 49.7% of inhibition at 125, 250, and 500 μg/mL respectively. The average dose (ED50 obtained through probit analysis was 394.96 μg/mL. These results suggest that the ME of leaves of G. sepium has anthelmintic activity against eggs of gastrointestinal nematodes.
Development of antibiotic marker-free creeping bentgrass resistance against herbicides.
Lee, Ki-Won; Kim, Ki-Yong; Kim, Kyung-Hee; Lee, Byung-Hyun; Kim, Jin-Seog; Lee, Sang-Hoon
2011-01-01
Herbicide-resistant creeping bentgrass plants (Agrostis stolonifera L.) without antibiotic-resistant markers were produced by Agrobacterium-mediated transformation. Embryogenic callus tissues were infected with Agrobacterium tumefaciens EHA105, harboring the bar and the CP4-EPSPS genes for bialaphos and glyphosate resistance. Phosphinothricin-resistant calli and plants were selected. Soil-grown plants were obtained at 14-16 weeks after transformation. Genetic transformation of the selected, regenerated plants was validated by PCR. Southern blot analysis revealed that at least one copy of the transgene was integrated into the genome of the transgenic plants. Transgene expression was confirmed by Northern blot. CP4-EPSPS protein was detected by ELISA. Transgenic plants remained green and healthy when sprayed with Basta, containing 0.5% glufosinate ammonium or glyphosate. The optimized Agrobacterium-mediated transformation method resulted in an average of 9.4% transgenic plants. The results of the present study suggest that the optimized marker-free technique could be used as an effective and reliable method for routine transformation, which may facilitate the development of varieties of new antibiotic-free grass species.
In vivo assessment of closantel ovicidal activity in Fasciola hepatica eggs.
Solana, María Victoria; Mera y Sierra, Roberto; Scarcella, Silvana; Neira, Gisela; Solana, Hugo Daniel
2016-01-01
Anthelmintic resistance in livestock parasites is currently a worldwide problem. Fasciola hepatica is a cosmopolitan parasite which causes considerable loss in sheep and cattle production systems all over the world. Chemotherapy is currently the main tool available for its control. The intensive use of triclabendazole, the drug of choice for more than 20 years, has resulted in the development of resistant strains. The therapeutic options are adulticides such as closantel (salicylanilide anthelmintic that binds extensively to plasma albumin) to treat chronic fascioliasis in sheep, and cattle. In the present work, an Egg Hatch Assay (EHA) and morphometric studies were used to evaluate in vivo the ovicidal activity and morphology F. hepatica eggs, recovered from closantel treated sheep collected at different time intervals post treatment. Statistically significant differences (p < 0.0001) were observed in egg morphometry between the control and the treated groups in all the parameters studied. Eggs recovered from treated animals tend to be narrower and longer. Significant differences were found in the embryonation and hatching of eggs between 36 h post treatment (32, 5%) vs. approximately 85% in control, 12 h and 24 h post treatment. Our results confirm that closantel affects in vivo the normal development of the eggs. As one of the first effects, this drug affects the performance of the trematode's reproductive physiology. Even though closantel treated animals may still eliminate eggs in the first days post treatment, these are not viable. Copyright © 2015 Elsevier Inc. All rights reserved.
Genetic transformation of deciduous fruit trees conferring resistance against diseases
International Nuclear Information System (INIS)
Mansvelt, E.L.; Glyn-Woods, T.; Watts, L.; Rabie, A.; Appel, M.; Bellstedt, D.U.
1998-01-01
Long breeding cycles make cultivar development a lengthy process in deciduous fruit species. Gene transfer is, accordingly, a goal with significant commercial value. In many plant species, especially in woody plants, a prerequisite for genetic engineering is the ability to regenerate plants from transformed cells. Development of single cell regeneration is the first step towards exploration of gene transfer techniques. In this investigation media for plum and apple leaf disk regeneration were developed. Transformation experiments were performed. The vector EHA105 containing the gus-intron gene was found to be effective for gene transfer. Induction of the virG genes with aceto-syringone did not enhance transformation. Cefotaxime that was supplemented in the plum selection medium to suppress the Agrobacterium vector seriously inhibited leaf disk regeneration. However, in applies it was not detrimental. With further apple transformation experiments, factors such as preculturing, age of leaves, sucrose and cefotaxime concentrations did not increase the transformation efficiency of the marker gene. The harpin protein, essential for the pathogenicity of Pseudomonas syringae pv. syringae which incites bacterial canker of stone fruit, ws amplified and cloned into an expression vector. The fusion protein was purified. This will be used in future studies to elucidate the host-pathogen interaction, and to identify antibacterial genes. (author)
Directory of Open Access Journals (Sweden)
Gerda Fouche
2016-07-01
Full Text Available The nematode, Haemonchus contortus, is responsible for major economic losses in the livestock industry. The management of parasites such as H. contortus has been through the use of synthetic parasiticides. This has resulted in the presence of residues in meat and milk, which affects food safety. The development of resistance to available anthelmintics coupled with their high cost has further complicated matters. This has led to the investigation of alternative methods to manage nematodes, including the use of plants and plant extracts as a potential source of novel anthelmintics. Acetone extracts were prepared from 15 South African plant species and their anthelmintic activity determined using the egg hatch assay (EHA. The leaf extract of Cleome gynandra had the best inhibitory activity (68% ± 3% at a concentration of 2.5 mg/mL, followed by the stem extract of Maerua angolensis (65% ± 5%. The extracts had a relatively low toxicity on Vero cells determined by the MTT (3-(4,5-dimethylthiazol-2-yl-2,5- diphenyltetrazolium bromide cellular assay.
Energy Technology Data Exchange (ETDEWEB)
Pang, Beili; Ryu, Chong-Min; Kim, Hyung-Il, E-mail: hikim@cnu.ac.kr
2013-11-01
Highlights: • Silica nanoparticles were modified to carry the vinyl groups for photo-crosslinking. • Acrylic copolymer was modified to have the vinyl groups for photo-crosslinking. • Strong and extensive interfacial bondings were formed between polymer and silica. • Thermal stability of PSA was improved by forming nanocomposite with modified silica. -- Abstract: Pressure sensitive adhesives (PSAs) with higher thermal stability were successfully prepared by forming composite with the silica nanoparticles modified via reaction with 3-methacryloxypropyltrimethoxysilane. The acrylic copolymer was synthesized as a base resin for PSAs by solution polymerization of 2-EHA, EA, and AA with AIBN as an initiator. The acrylic copolymer was further modified with GMA to have the vinyl groups available for UV curing. The peel strength decreased with the increase of gel content which was dependent on both silica content and UV dose. Thermal stability of the composite PSAs was improved noticeably with increasing silica content and UV dose mainly due to the strong and extensive interfacial bonding between the organic polymer matrix and silica.
Jaganath, Balusamy; Subramanyam, Kondeti; Mayavan, Subramanian; Karthik, Sivabalan; Elayaraja, Dhandapani; Udayakumar, Rajangam; Manickavasagam, Markandan; Ganapathi, Andy
2014-05-01
An efficient and reproducible Agrobacterium-mediated in planta transformation was developed in Jatropha curcas. The various factors affecting J. curcas in planta transformation were optimized, including decapitation, Agrobacterium strain, pin-pricking, vacuum infiltration duration and vacuum pressure. Simple vegetative in vivo cleft grafting method was adopted in the multiplication of transformants without the aid of tissue culture. Among the various parameters evaluated, decapitated plants on pin-pricking and vacuum infiltrated at 250 mmHg for 3 min with the Agrobacterium strain EHA 105 harbouring the binary vector pGA 492 was proved to be efficient in all terms with a transformation efficiency of 62.66%. Transgene integration was evinced by the GUS histochemical analysis, and the GUS positive plants were subjected to grafting. Putatively transformed J. curcas served as "Scion" and the wild type J. curcas plant severed as "Stock". There was no occurrence of graft rejection and the plants were then confirmed by GUS histochemical analysis, polymerase chain reaction (PCR) and Southern hybridization. Genetic stability of the grafted plants was evaluated by using randomly amplified polymorphic DNA (RAPD), marker which showed 100% genetic stability between mother and grafted plants. Thus, an efficient in planta transformation and grafting based multiplication of J. curcas was established.
Piechnick, Ronny; Heck, Martin; Sommer, Martha E
2011-08-23
Besides Lys-296 in the binding pocket of opsin, all-trans-retinal forms adducts with peripheral lysine residues and phospholipids, thereby mimicking the spectral and chemical properties of metarhodopsin species. These pseudophotoproducts composed of nonspecific retinylidene Schiff bases have long plagued the investigation of rhodopsin deactivation and identification of decay products. We discovered that, while hydroxylamine can enter the retinal binding pocket of light-activated rhodopsin, the modified hydroxylamine compounds o-methylhydroxylamine (mHA), o-ethylhydroxylamine (eHA), o-tert-butylhydroxylamine (t-bHA), and o-(carboxymethyl)hydroxylamine (cmHA) are excluded. However, the alkylated hydroxylamines react quickly and efficiently with exposed retinylidene Schiff bases to form their respective retinal oximes. We further investigated how t-bHA affects light-activated rhodopsin and its interaction with binding partners. We found that both metarhodopsin II (Meta II) and Meta III are resistant to t-bHA, and neither arrestin nor transducin binding is affected by t-bHA. This discovery suggests that the hypothetical solvent channel that opens in light-activated rhodopsin is extremely stringent with regard to size and/or polarity. We believe that alkylated hydroxylamines will prove to be extremely useful reagents for the investigation of rhodopsin activation and decay mechanisms. Furthermore, the use of alkylated hydroxylamines should not be limited to in vitro studies and could help elucidate visual signal transduction mechanisms in the living cells of the retina. © 2011 American Chemical Society
International Nuclear Information System (INIS)
Munir, I.; Hussan, W.; Kazi, M.; Mian, A.
2016-01-01
Brassica juncea is an important oil seed crop throughout the world. The demand and cultivation of oil seed crops has gained importance due to rapid increase in world population and industrialization. Fungal diseases pose a great threat to Brassica productivity worldwide. Absence of resistance genes against fungal infection within crossable germplasms of this crop necessitates deployment of genetic engineering approaches to produce transgenic plants with resistance against fungal infections. In the current study, hypocotyls and cotyledons of Brassica juncea, used as explants, were transformed with Agrobacterium tumefacien strain EHA101 harboring binary vector pEKB/NIC containing synthetic chitinase gene (NIC), an antifungal gene under the control of cauliflower mosaic virus promoter (CaMV35S). Bar genes and nptII gene were used as selectable markers. Presence of chitinase gene in trangenic lines was confirmed by PCR and southern blotting analysis. Effect of the extracted proteins from non-transgenic and transgenic lines was observed on the growth of Alternaria brassicicola, a common disease causing pathogen in brassica crop. In comparison to non-transgenic control lines, the leaf tissue extracts of the transgenic lines showed considerable resistance and antifungal activity against A. brassicicola. The antifungal activity in transgenic lines was observed as corresponding to the transgene copy number. (author)
Adaptation of the vertical vestibulo-ocular reflex in cats during low-frequency vertical rotation.
Fushiki, Hiroaki; Maruyama, Motoyoshi; Shojaku, Hideo
2018-04-01
We examined plastic changes in the vestibulo-ocular reflex (VOR) during low-frequency vertical head rotation, a condition under which otolith inputs from the vestibular system are essential for VOR generation. For adaptive conditioning of the vertical VOR, 0.02Hz sinusoidal pitch rotation for one hour about the earth's horizontal axis was synchronized with out-of-phase vertical visual stimulation from a random dot pattern. A vertical VOR was well evoked when the upright animal rotated around the earth-horizontal axis (EHA) at low frequency due to the changing gravity stimulus and dynamic stimulation of the otoliths. After adaptive conditioning, the amplitude of the vertical VOR increased by an average of 32.1%. Our observations showing plasticity in the otolithic contribution to the VOR may provide a new strategy for visual-vestibular mismatch training in patients with otolithic disorders. This low-frequency vertical head rotation protocol also provides a model for investigating the mechanisms underlying the adaptation of VORs mediated by otolith activation. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Idalmis Bermúdez-Caraballoso
2004-01-01
Full Text Available The black Sigatoka (Mycosphaerella fijiensis Morelet has become in the last years, the most destructive disease that affects the production of banana and plantains world-wide. The present work was made with the objective to obtain transgenic plants of banana cultivar Grand naine (AAA resistant to this disease with the use of genetic transformation. Embryogenenic cell suspensions obtained from somatic embryos formed from immature male flowers, were used for the transformation by Agrobacterium tumefaciens. The bacterial strain EHA-105 was used with the binary plasmids pHCA-58, pHCG-59 and pHGA-91, which contain different combinations of genes that encode for the antifungal chitinase, glucanase enzymes and the AP-24 osmotin. The commercial herbicide BASTA® was used as selective agent. One hundred ten putative transformed lines of the three constructions were obtained, after three selection months in the culture medium. The transgenic events were verified by means of Polymerase Chain Reaction analysis. Key words: AP-24, chitinase, glucanase, Musa, Mycosphaerella fijiensis
Morphological Evaluation of Shoots Regenerated from Hygromycin-Resistant Rice Callus (cv IACuba-28
Directory of Open Access Journals (Sweden)
Maylin Pérez Bernal
2007-01-01
Full Text Available An evaluation system based on the morphological characteristics of regenerated hygromycin-resistant rice callus shoots was established for correlating such characteristics with shoot viability on hygromycin. Embryogenic rice calli were transformed by Agrobacterium tumefaciens (EHA105/ pCAMBIA1300, containing the hygromycin-phosphotransferase gene as selection marker. After two weeks on selection medium, hygromycin-resistant calli were transferred to regeneration medium. Regenerated shoots were extracted every 5 days (over a 30-day period and classified into three classes according to their morphological structure: class I: vigorous shoot having typical bipolar structure; class II: shoot having small root compared to apical length, or shoot without roots; class III: shoots having an abnormal appearance, such as malformed leaves or albinism. Individualised shoots were transferred to MS medium containing hygromycin for evaluating their resistance to antibiotics. A relationship was observed between regenerated shoots’ morphological characteristics and the percentage of shoots’ viability on hygromycin. Class I prevailed at early shoot extraction and was the most resistant to hygromycin. Drastic class I reduction was found with later shoot extraction, whilst classes II and III became increased. Likewise, shoot viability became radically reduced on MS medium containing hygromycin. This result might be applied for improving efficiency regarding obtaining transgenic rice plants, taking into account the best time for obtaining high percentages of hygromycin-resistant shoots having the best morphological characteristics.
The preparation of RVNRL using Malaysian-produced latexes
International Nuclear Information System (INIS)
Zin, W.M. bin W.; Mohid, N. bte; Hasan, J. bin; Noor, W.K.A. bte W.M.; Jaafar, Zulkifli
1993-01-01
This research project was carried out using latexes supplied by three of the suppliers in Malaysia. From the results of studies carried out in search of the best sensitiser for RVNRL preparation, the use of n-butyl acrylate (n-BA) as a sensitiser gave the most promising results. However, its use as a sensitiser is not universal to all latexes available in the country. The problem was overcome by using different formulations for different latexes. For the latex supplied by Golden Hope (Hytex), a combination of sensitisers i.e. n-BA plus 2-ethyl hexyl acrylate (2-EHA) with a 10% potassium hydroxide solution as the stabilizer, was required. Latex supplied by MARDEC (Matex), seemed to need only n-BA as the sensitiser. However, a stabilizer was still required and the use of a 10% KOH solution was found to be suitable. A large range of stabilizers and sensitisers were applicable to Guthrie latex. The use of n-BA as the sensitiser and potassium laurylic acid as the stabilizer seemed the most favourable formulation. All the results are discussed in the form of a correlation between dose and the tensile properties of RVNRL vulcanizates, equilibrium swelling ratio and standing time of the latex formulation. (author)
Karthik, Sivabalan; Pavan, Gadamchetty; Sathish, Selvam; Siva, Ramamoorthy; Kumar, Periyasamy Suresh; Manickavasagam, Markandan
2018-04-01
Agrobacterium infection and regeneration of the putatively transformed plant from the explant remains arduous for some crop species like peanut. Henceforth, a competent and reproducible in planta genetic transformation protocol is established for peanut cv. CO7 by standardizing various factors such as pre-culture duration, acetosyringone concentration, duration of co-cultivation, sonication and vacuum infiltration. In the present investigation, Agrobacterium tumefaciens strain EHA105 harboring the binary vector pCAMBIA1301- bar was used for transformation. The two-stage selection was carried out using 4 and 250 mg l -1 BASTA ® to completely eliminate the chimeric and non-transformed plants. The transgene integration into plant genome was evaluated by GUS histochemical assay, polymerase chain reaction (PCR), and Southern blot hybridization. Among the various combinations and concentrations analyzed, highest transformation efficiency was obtained when the 2-day pre-cultured explants were subjected to sonication for 6 min and vacuum infiltrated for 3 min in Agrobacterium suspension, and co-cultivated on MS medium supplemented with 150 µM acetosyringone for 3 days. The fidelity of the standardized in planta transformation method was assessed in five peanut cultivars and all the cultivars responded positively with a transformation efficiency ranging from minimum 31.3% (with cv. CO6) to maximum 38.6% (with cv. TMV7). The in planta transformation method optimized in this study could be beneficial to develop superior peanut cultivars with desirable genetic traits.
Cobalt(2) and nickel(2) tris-acetylacetonates with alkali metal cations in outer sphere
International Nuclear Information System (INIS)
Steblyanko, A.Yu.; Grigor'ev, A.N.; Martynenko, L.I.
1996-01-01
Anhydrous tris-acetylacetonates of Co(2) and Ni(2) with alkali metal cations in outer sphere were synthesized and investigated by different physicochemical methods. Chemical analysis and IR-spectroscopy show, that complex composition corresponds to the formula Eh[MA 3 ] (where Eh + - Li + , Na + , K + , Rb + , Cs + ; M - Co(2), Ni(2); A - - acetyacetonate-ion). Eh[MA 3 ] heating in vacuum leads to transition of volatile Co(2) and Ni(2) acetylacetonates to gaseous phase. The data of photoelectron spectroscopy and vacuum sublimation show, that Li[MA 3 ] is transformed to gaseous phase congruently and only partially dissociates to EhA and MA 2 . Li[MA 3 ] and Cs[MA 3 ] are characterized by the lowest thermal stability at atmospheric pressure. Low stability of Li[MA 3 ] is related with detachment of one of A - radical from [MA 3 ] complex anion by Li + cation under conditions, when LiA and Li[MA 3 ] are volatile. 11 refs.; 2 figs.; 3 tabs
Transformation of pecan and regeneration of transgenic plants.
McGranahan, G H; Leslie, C A; Dandekar, A M; Uratsu, S L; Yates, I E
1993-09-01
A gene transfer system developed for walnut (Juglans regia L.) was successfully applied to pecan (Carya illinoensis [Wang] K. Koch). Repetitively embryogenic somatic embryos derived from open-pollinated seed of 'Elliott', 'Wichita', and 'Schley' were co-cultivated with Agrobacterium strain EHA 101/pCGN 7001, which contains marker genes for beta-glucuronidase activity and resistance to kanamycin. Several modifications of the standard walnut transformation techniques were tested, including a lower concentration of kanamycin and a modified induction medium, but these treatments had no measurable effect on efficiency of transformation. Nineteen of the 764 viable inoculated embryos produced transgenic subclones; 13 of these were from the line 'Elliott'6, 3 from 'Schley'5/3, and 3 from 'Wichita'9. Transgenic embryos of 'Wichita'9 germinated most readily and three subclones were successfully micropropagated. Three transgenic plants of one of these subclones were obtained by grafting the tissue cultured shoots to seedling pecan rootstock in the greenhouse. Gene insertion, initially detected by GUS activity, was confirmed by detection of integrated T-DNA sequences using Southern analysis.
Clinical use of PI3K inhibitors in B-cell lymphoid malignancies: today and tomorrow.
Greenwell, I B; Flowers, C R; Blum, K A; Cohen, J B
2017-03-01
PI3K inhibitors are an important new therapeutic option for the treatment of relapsed and refractory B-cell lymphoid malignancies. Idelalisib is a PI3Kδ inhibitor that has been approved for the treatment of lymphoma and chronic lymphocytic leukemia in the relapsed/refractory setting, and several other PI3K inhibitors are being developed targeting other isoforms of the PI3K enzyme, which results in distinct toxicities and variable efficacy in the clinical setting. Areas covered: We provide a general overview of PI3K inhibitors, recommended applications, and the mechanism and management of toxicities. We further review trials, ongoing and completed, leading to the approval of idelalisib as well other PI3K inhibitors currently in development. Articles were obtained from PubMed, and abstracts were searched for the past 5 years from the websites for ASCO, ASH, EHA, and ICML/Lugano. Expert commentary: PI3K inhibitors provide an important and powerful pharmacologic tool in the armamentarium against hematologic malignancies, especially for relapsed/refractory B-cell lymphoid malignancies. Unique toxicities are associated with inhibition of different isoforms of the PI3K enzyme, as demonstrated with the infectious and autoimmune toxicities associated with the PI3Kδ inhibitor, idelalisib. Due to these unique toxicities, PI3K inhibitors should only be used in formally approved combinations and settings.
Zhang, Jiaxin; Movahedi, Ali; Wang, Xiaoli; Wu, Xiaolong; Yin, Tongming; Zhuge, Qiang
2015-06-01
The increasing resistance of bacteria and fungi to currently available antibiotics is a major concern worldwide, leading to enormous efforts to develop new antibiotics with new modes of actions. In this paper, cDNA encoding cecropin A was amplified from drury (Hyphantria cunea) (dHC) pupa fatbody total RNA using RT-PCR. The full-length dHC-cecropin A cDNA encoded a protein of 63 amino acids with a predicted 26-amino acid signal peptide and a 37-amino acid functional domain. We synthesized the antibacterial peptide (ABP) from the 37-amino acid functional domain (ABP-dHC-cecropin A), and amidated it via the C-terminus. Time-of-flight mass spectrometry showed its molecular weight to be 4058.94. The ABP-dHC-cecropin A was assessed in terms of its protein structure using bioinformatics and CD spectroscopy. The protein's secondary structure was predicted to be α-helical. In an antibacterial activity analysis, the ABP-dHC-cecropin A exhibited strong antibacterial activity against E. coli K12D31 and Agrobacterium EHA105. Copyright © 2014 Elsevier Inc. All rights reserved.
POTENSI EKOWISATA DAN STRATEGI PENGEMBANGAN TAHURA NIPA-NIPA, KOTA KENDARI, SULAWESI TENGGARA
Directory of Open Access Journals (Sweden)
Alamsyah Flamin
2013-12-01
Full Text Available This study aims to determine the potency and nature tourism development strategy in the region of Tahura Nipa-Nipa. The research was conducted at the Regions Tahura Nipa-Nipa Kendari City in Southeast Sulawesi Province in 2010. The methodology of this study is to use surveys and The results showed that the potential attraction of Nipa-Nipa Tahura Region consists of potential flora-fauna and natural scenery. Potential flora consists of various plant species habitus trees, including the type of wood resin, Bintangur, Eha, including species of palm Nongella sp, and rattan. The endemic fauna are anoa, deer, Sulawesi black monkey, wild boar, species such as reptiles lizard, python. Some species of bird such as the pigeon forest, cuckoo. The potential natural beauty consists of objects such as Lahundape waterfall and a campground. Alternative strategies for developing ecotourism in the Nipa-Nipa Tahura is SO strategy to develop an optimal potential of flora, fauna, natural scenery and indigenous communities in package by using the support from the government and local communities. While WO strategies take advantage of the support of the community and the local government to improve the quality of tourism, particularly in the sights of Waterfall Lahundape.
Migration kinetics of four photo-initiators from paper food packaging to solid food simulants.
Cai, Huimei; Ji, Shuilin; Zhang, Juzhou; Tao, Gushuai; Peng, Chuanyi; Hou, Ruyan; Zhang, Liang; Sun, Yue; Wan, Xiaochun
2017-09-01
The migration behaviour of four photo-initiators (BP, EHA, MBP and Irgacure 907) was studied by 'printing' onto four different food-packaging materials (Kraft paper, white cardboard, Polyethylene (PE)-coated paper and composite paper) and tracking movement into the food simulant: Tenax-TA (porous polymer 2,6-diphenyl furan resin). The results indicated that the migration of the photo-initiators was related to the molecular weight and log K o/w of each photo-initiator. At different temperatures, the migration rates of the photo-initiators were different in papers with different thicknesses. The amount of each photo-initiator found in the food was closely related to the food matrix. The Weibull model was used to predict the migration load into the food simulants by calculating the parameters τ and β and determining the relationship of the two parameters with temperature and paper thickness. The established Weibull model was then used to predict the migration of each photo-initiator with respect to different foods. A two-parameter Weibull model fitted the actual situation, with some deviation from the actual migration amount.
Genomic Characterization of Methanomicrobiales Reveals Three Classes of Methanogens
Energy Technology Data Exchange (ETDEWEB)
Anderson, Iain; Ulrich, Luke E.; Lupa, Boguslaw; Susanti, Dwi; Porat, Iris; Hooper, Sean D.; Lykidis, Athanasios; Sieprawska-Lupa, Magdalena; Dharmarajan, Lakshmi; Goltsman, Eugene; Lapidus, Alla; Saunders, Elizabeth; Han, Cliff; Land, Miriam; Lucas, Susan; Mukhopadhyay, Biswarup; Whitman, William B.; Woese, Carl; Bristow, James; Kyrpides, Nikos
2009-05-01
Methanomicrobiales is the least studied order of methanogens. While these organisms appear to be more closely related to the Methanosarcinales in ribosomal-based phylogenetic analyses, they are metabolically more similar to Class I methanogens. In order to improve our understanding of this lineage, we have completely sequenced the genomes of two members of this order, Methanocorpusculum labreanum Z and Methanoculleus marisnigri JR1, and compared them with the genome of a third, Methanospirillum hungatei JF-1. Similar to Class I methanogens, Methanomicrobiales use a partial reductive citric acid cycle for 2-oxoglutarate biosynthesis, and they have the Eha energy-converting hydrogenase. In common with Methanosarcinales, Methanomicrobiales possess the Ech hydrogenase and at least some of them may couple formylmethanofuran formation and heterodisulfide reduction to transmembrane ion gradients. Uniquely, M. labreanum and M. hungatei contain hydrogenases similar to the Pyrococcus furiosus Mbh hydrogenase, and all three Methanomicrobiales have anti-sigma factor and anti-anti-sigma factor regulatory proteins not found in other methanogens. Phylogenetic analysis based on seven core proteins of methanogenesis and cofactor biosynthesis places the Methanomicrobiales equidistant from Class I methanogens and Methanosarcinales. Our results indicate that Methanomicrobiales, rather than being similar to Class I methanogens or Methanomicrobiales, share some features of both and have some unique properties. We find that there are three distinct classes of methanogens: the Class I methanogens, the Methanomicrobiales (Class II), and the Methanosarcinales (Class III).
Greenhouse gas emissions and energy balance of palm oil biofuel
Energy Technology Data Exchange (ETDEWEB)
de Souza, Simone Pereira; Pacca, Sergio [Graduate Program on Environmental Engineering Science, School of Engineering of Sao Carlos, University of Sao Paulo, Rua Arlindo Bettio, 1000 Sao Paulo (Brazil); de Avila, Marcio Turra; Borges, Jose Luiz B. [Brazilian Agricultural Research Corporation (Embrapa - Soja) (Brazil)
2010-11-15
The search for alternatives to fossil fuels is boosting interest in biodiesel production. Among the crops used to produce biodiesel, palm trees stand out due to their high productivity and positive energy balance. This work assesses life cycle emissions and the energy balance of biodiesel production from palm oil in Brazil. The results are compared through a meta-analysis to previous published studies: Wood and Corley (1991) [Wood BJ, Corley RH. The energy balance of oil palm cultivation. In: PORIM intl. palm oil conference - agriculture; 1991.], Malaysia; Yusoff and Hansen (2005) [Yusoff S, Hansen SB. Feasibility study of performing an life cycle assessment on crude palm oil production in Malaysia. International Journal of Life Cycle Assessment 2007;12:50-8], Malaysia; Angarita et al. (2009) [Angarita EE, Lora EE, Costa RE, Torres EA. The energy balance in the palm oil-derived methyl ester (PME) life cycle for the cases in Brazil and Colombia. Renewable Energy 2009;34:2905-13], Colombia; Pleanjai and Gheewala (2009) [Pleanjai S, Gheewala SH. Full chain energy analysis of biodiesel production from palm oil in Thailand. Applied Energy 2009;86:S209-14], Thailand; and Yee et al. (2009) [Yee KF, Tan KT, Abdullah AZ, Lee KT. Life cycle assessment of palm biodiesel: revealing facts and benefits for sustainability. Applied Energy 2009;86:S189-96], Malaysia. In our study, data for the agricultural phase, transport, and energy content of the products and co-products were obtained from previous assessments done in Brazil. The energy intensities and greenhouse gas emission factors were obtained from the Simapro 7.1.8. software and other authors. These factors were applied to the inputs and outputs listed in the selected studies to render them comparable. The energy balance for our study was 1:5.37. In comparison the range for the other studies is between 1:3.40 and 1:7.78. Life cycle emissions determined in our assessment resulted in 1437 kg CO{sub 2}e/ha, while our analysis
da Silva, A. C.; Chadimova, L.; Hladil, J.; Slavik, L.; Hilgen, F. J.; Dekkers, M. J.
2015-12-01
The uncertainties on the Devonian stage boundaries are currently in the order of several millions of years. When shown to reflect a detrital signal, which is influenced by climatic variations, Magnetic Susceptibility (MS) has been proven as a useful tool for identifying climatic cycles; which can subsequently be used to improve the time scale. Here, we focus on two sections from the Prague Synform (Czech Republic) cutting through the Lochkovian, Pragian and the lower part of the Emsian. Sedimentation is rhythmic, dominated by slightly clayey offshore limestones, being mostly calciturbidites and hemipelagites. We provide hysteresis analysis in order to get insight into the nature and the origin of the magnetic minerals driving the variation in the MS signal. The results point to a MS signal mostly carried by clay minerals. Subsequently, to improve estimation of the duration of the stages, we apply different spectral analysis techniques on this MS signal. From the Continuous Wavelet Transform (CWT), Evolutive Harmonic Analysis (EHA) and field observations, we subdivide the section into portions with a steady sedimentation rate (a first estimate of this rate is also delivered by these analyzes). Then, we apply Multitaper Method (MTM) and Multitaper harmonic Analysis (F-test) and extract the frequencies reaching 95% Confidence Level. These frequencies are then implemented into the Average Spectral Misfit procedures (ASM) which enables comparison with orbital targets. By combining these different techniques, 405 kyr cyclicty is identifed, a powerful duration paleochronometer. These new results indicate a duration of 7.7 ± 2 Myr for the Lochkovian stage and of 1.7 Myr ± 1.4 for the Pragian stage (compared to respectively 8.4 ± 6 Myr and 3.2 ± 5.4 Myr in the 2012 Geological Time Scale).
Factors enhancing Agrobacterium tumefaciens-mediated gene transfer in peanut (Arachis hypogaea L.)
Egnin, M.; Mora, A.; Prakash, C. S.; Mortley, D. G. (Principal Investigator)
1998-01-01
Parameters enhancing Agrobacterium-mediated transfer of foreign genes to peanut (Arachis hypogaea L.) cells were investigated. An intron-containing beta-glucuronidase uidA (gusA) gene under the transcriptional control of CaMV 35S promoter served as a reporter. Transformation frequency was evaluated by scoring the number of sectors expressing GUS activity on leaf and epicotyl explants. The 'Valencia Select' market type cv. New Mexico was more amenable to Agrobacterium transformation than the 'runner' market type cultivars tested (Florunner, Georgia Runner, Sunrunner, or South Runner). The disarmed Agrobacterium tumefaciens strain EHA101 was superior in facilitating the transfer of uidA gene to peanut cells compared to the disarmed strain C58. Rinsing of explants in half-strength Murashige-Skoog (MS) media prior to infection by Agrobacterium significantly increased the transformation efficiency. The use of cocultivation media containing high auxin [1.0 or 2.5 mg/l (4.53 micromolar or 11.31 micromolar) 2,4-D] and low cytokinin [0.25 or 0.5 mg/l (1.0 micromolar or 2.0 micromolar) BA] promoted higher transformation than either hormone-free or thidiazuron-containing medium. The polarity of the epicotyl during cocultivation was important; explants incubated in an inverted (vertically) manner followed by a vertically upright position resulted in improved transformation and shoot regeneration frequencies. Preculture of explants in MS basal medium or with 2.5 mg thidiazuron per l prior to infection drastically decreased the number of transformed zones. The optimized protocol was used to obtain transient transformation frequencies ranging from 12% to 36% for leaf explants, 15% to 42% for epicotyls. Initial evidence of transformation was obtained by polymerase chain reaction and subsequently confirmed by Southern analysis of regenerated plants.
Kimura, Mitsuhiro; Cutler, Sean; Isobe, Sachiko
2015-01-01
Agrobacterium-mediated transformation is a commonly used method for plant genetic engineering. However, the limitations of Agrobacterium host-plant interactions and the complexity of plant tissue culture often make the production of transgenic plants difficult. Transformation efficiency in many legume species, including soybean and the common bean, has been reported to be quite low. To improve the transformation procedure in legumes, we screened for chemicals that increase the transformation efficiency of Lotus japonicus, a model legume species. A Chemical library was screened and chemicals that increase in transient transformation efficiency of L. japonicus accession, Miyakojima MG-20 were identified. The transient transformation efficiency was quantified by reporter activity in which an intron-containing reporter gene produces the GUS protein only when the T-DNA is expressed in the plant nuclei. We identified a phenolic compound, chloroxynil, which increased the genetic transformation of L. japonicus by Agrobacterium tumefaciens strain EHA105. Characterization of the mode of chloroxynil action indicated that it enhanced Agrobacterium-mediated transformation through the activation of the Agrobacterium vir gene expression, similar to acetosyringone, a phenolic compound known to improve Agrobacterium-mediated transformation efficiency. Transient transformation efficiency of L. japonicus with 5 μM chloroxynil was 60- and 6- fold higher than that of the control and acetosyringone treatment, respectively. In addition, transgenic L. japonicus lines were successfully generated by 5 μM chloroxynil treatment.Furthermore, we show that chloroxynil improves L. japonicus transformation by Agrobacterium strain GV3101 and rice transformation. Our results demonstrate that chloroxynil significantly improves Agrobacterium tumefaciens-mediated transformation efficiency of various agriculturally important crops.
Vajhala, Chakravarthy S K; Sadumpati, Vijaya Kumar; Nunna, Hariprasad Rao; Puligundla, Sateesh Kumar; Vudem, Dashavantha Reddy; Khareedu, Venkateswara Rao
2013-01-01
Mannose-specific Allium sativum leaf agglutinin encoding gene (ASAL) and herbicide tolerance gene (BAR) were introduced into an elite cotton inbred line (NC-601) employing Agrobacterium-mediated genetic transformation. Cotton transformants were produced from the phosphinothricin (PPT)-resistant shoots obtained after co-cultivation of mature embryos with the Agrobacterium strain EHA105 harbouring recombinant binary vector pCAMBIA3300-ASAL-BAR. PCR and Southern blot analysis confirmed the presence and stable integration of ASAL and BAR genes in various transformants of cotton. Basta leaf-dip assay, northern blot, western blot and ELISA analyses disclosed variable expression of BAR and ASAL transgenes in different transformants. Transgenes, ASAL and BAR, were stably inherited and showed co-segregation in T1 generation in a Mendelian fashion for both PPT tolerance and insect resistance. In planta insect bioassays on T2 and T3 homozygous ASAL-transgenic lines revealed potent entomotoxic effects of ASAL on jassid and whitefly insects, as evidenced by significant decreases in the survival, development and fecundity of the insects when compared to the untransformed controls. Furthermore, the transgenic cotton lines conferred higher levels of resistance (1-2 score) with minimal plant damage against these major sucking pests when bioassays were carried out employing standard screening techniques. The developed transgenics could serve as a potential genetic resource in recombination breeding aimed at improving the pest resistance of cotton. This study represents the first report of its kind dealing with the development of transgenic cotton resistant to two major sap-sucking insects.
Martorelli, L; Albanese, A; Vilte, D; Cantet, R; Bentancor, A; Zolezzi, G; Chinen, I; Ibarra, C; Rivas, M; Mercado, E C; Cataldi, A
2017-09-01
Shiga toxin-producing Escherichia coli (STEC) are a group of bacteria responsible for food-associated diseases. Clinical features include a wide range of symptoms such as diarrhea, hemorrhagic colitis and the hemolytic uremic syndrome (HUS), a life-threatening condition. Our group has observed that animals naturally colonized with STEC strains of unknown serotype were not efficiently colonized with E. coli O157:H7 after experimental infection. In order to assess the basis of the interference, three STEC strains were isolated from STEC persistently-colonized healthy cattle from a dairy farm in Buenos Aires, Argentina. The three isolated strains are E. coli O22:H8 and carry the stx1 and stx2d genes. The activatable activity of Stx2d was demonstrated in vitro. The three strains carry the adhesins iha, ehaA and lpf O113 . E. coli O22:H8 formed stronger biofilms in abiotic surface than E. coli O157:H7 (eae+, stx2+) and displayed a more adherent phenotype in vitro towards HeLa cells. Furthermore, when both serotypes were cultured together O22:H8 could reduce O157:H7 adherence in vitro. When calves were intragastrically pre-challenged with 10 8 CFU of a mixture of the three STEC strains and two days later challenged with the same dose of the strain E. coli O157:H7 438/99, the shedding of the pathogen was significantly reduced. These results suggest that E. coli O22:H8, a serotype rarely associated with human illness, might compete with O157:H7 at the bovine recto-anal junction, making non-O157 carrying-calves less susceptible to O157:H7 colonization and shedding of the bacteria to the environment. Copyright © 2017 Elsevier B.V. All rights reserved.
In vitro anthelmintic effects of Spigelia anthelmia protein fractions against Haemonchus contortus.
Directory of Open Access Journals (Sweden)
Sandra Alves Araújo
Full Text Available Gastrointestinal nematodes are a significant concern for animal health and well-being, and anthelmintic treatment is mainly performed through the use of chemical products. However, bioactive compounds produced by plants have shown promise for development as novel anthelmintics. The aim of this study is to assess the anthelmintic activity of protein fractions from Spigelia anthelmia on the gastrointestinal nematode Haemonchus contortus. Plant parts were separated into leaves, stems and roots, washed with distilled water, freeze-dried and ground into a fine powder. Protein extraction was performed with sodium phosphate buffer (75 mM, pH 7.0. The extract was fractionated using ammonium sulfate (0-90% and extensively dialyzed. The resulting fractions were named LPF (leaf protein fraction, SPF (stem protein fraction and RPF (root protein fraction, and the protein contents and activities of the fractions were analyzed. H. contortus egg hatching (EHA, larval exsheathment inhibition (LEIA and larval migration inhibition (LMIA assays were performed. Proteomic analysis was conducted, and high-performance liquid chromatography (HPLC chromatographic profiles of the fractions were established to identify proteins and possible secondary metabolites. S. anthelmia fractions inhibited H. contortus egg hatching, with LPF having the most potent effects (EC50 0.17 mg mL-1. During LEIA, SPF presented greater efficiency than the other fractions (EC50 0.25 mg mL-1. According to LMIA, the fractions from roots, stems and leaves also reduced the number of larvae, with EC50 values of 0.11, 0.14 and 0.21 mg mL-1, respectively. Protein analysis indicated the presence of plant defense proteins in the S. anthelmia fractions, including protease, protease inhibitor, chitinase and others. Conversely, secondary metabolites were absent in the S. anthemia fractions. These results suggest that S. anthelmia proteins are promising for the control of the gastrointestinal nematode H
Object detection system based on multimodel saliency maps
Guo, Ya'nan; Luo, Chongfan; Ma, Yide
2017-03-01
EHA reaches to 215.287. We deem our method can be wielded to diverse applications in the future.
Amodiaquine polymeric membrane electrode.
Malongo, T Kimbeni; Blankert, B; Kambu, O; Amighi, K; Nsangu, J; Kauffmann, J-M
2006-04-11
The construction and electrochemical response characteristics of two types of poly(vinyl chloride) (PVC) membrane sensors for the determination of amodiaquine hydrochloride (ADQ.2HCl) are described. The sensing membrane comprised an ion-pair formed between the cationic drug and sodium tetraphenyl borate (NaTPB) or potassium tetrakis(4-chlorophenyl) borate (KTCPB) in a plasticized PVC matrix. Eight PVC membrane ion-selective electrodes were fabricated and studied. Several plasticizers were studied namely, dioctyl phthalate (DOP), 2-nitrophenyl octyl ether (NPOE), dioctyl phenylphosphonate (DOPP) and bis(2-ethylhexyl)adipate (EHA). The sensors display a fast, stable and near-Nernstian response over a relative wide ADQ concentration range (3.2 x 10(-6) to 2.0 x 10(-2) M), with slopes comprised between 28.5 and 31.4 mV dec(-1) in a pH range comprised between pH 3.7 and 5.5. The assay of amodiaquine hydrochloride in pharmaceutical dosage forms using one of the proposed sensors gave average recoveries of 104.3 and 99.9 with R.S.D. of 0.3 and 0.6% for tablets (Malaritab) and a reconstituted powder containing ADQ.2HCl, respectively. The sensor was also used for dissolution profile studies of two drug formulations. The sensor proved to have a good selectivity for ADQ.2HCl over some inorganic and organic compounds, however, berberine chloride interfered significantly. The results were validated by comparison with a spectrophotometric assay according to the USP pharmacopoeia.
Yao, Jia-Long; Tomes, Sumathi; Gleave, Andrew P
2013-05-01
Apple acetolactate synthase mutants were generated by site-specific mutagenesis and successfully used as selection marker in tobacco and apple transformation. T-DNA/Apple genome junctions were analysed using genome-walking PCR and sequencing. An Agrobacterium-mediated genetic transformation system was developed for apple (Malus × domestica), using mutants of apple acetolactate synthase (ALS) as a selectable marker. Four apple ALS mutants were generated by site-specific mutagenesis and subsequently cloned under the transcriptional control of the CaMV 35S promoter and ocs 3' terminator, in a pART27-derived plant transformation vector. Three of the four mutations were found to confer resistance to the herbicide Glean(®), containing the active agent chlorsulfuron, in tobacco (Nicotiana tabacum) transformation. In apple transformation, leaf explants infected with Agrobacterium tumefaciens EHA105 containing one of the three ALS mutants resulted in the production of shoots on medium containing 2-8 μg L(-1) Glean(®), whilst uninfected wild-type explants failed to regenerate shoots or survive on medium containing 1 and 3 μg L(-1) Glean(®), respectively. Glean(®)-resistant, regenerated shoots were further multiplied and rooted on medium containing 10 μg L(-1) Glean(®). The T-DNA and apple genome-DNA junctions from eight rooted transgenic apple plants were analysed using genome-walking PCR amplification and sequencing. This analysis confirmed T-DNA integration into the apple genome, identified the genome integration sites and revealed the extent of any vector backbone integration, T-DNA rearrangements and deletions of apple genome DNA at the sites of integration.
Directory of Open Access Journals (Sweden)
Yohana de Oliveira-Cauduro
2018-02-01
Full Text Available ABSTRACT This study aimed to evaluate the effect of factors that may affect the genetic transformation of cotiledonary explants of Eucalyptus saligna mediated by EHA105 strain of Agrobacterium tumefaciens. The vector pBI121 carrying gus gene under control of 35S CaMV promoter was used. The effect of the following factors was evaluated: explant pre-culture, use of different antibiotics and presence of acetosyringone (AS in co-culture media. An antioxidant solution was also used during excision, containing ascorbic acid (250mg.L-1, citric acid (25mg.L-1 and PVP-40 (1g.L-1. Pre-culture of the explants before the co-culture with bacteria was done over a 4-day period in MS culture medium supplemented with 4.4µM BAP and 2.7ìM NAA. After theco-culture period, three concentrations of kanamycin (12.5;25 and 50mg.L-1 combined with 300mg.L-1 Augmentin® in the culture medium were tested The influence of the antibiotic was also evaluated by keeping the explants in a medium containing 50mg.L-1 Km and 300mg.L-1 Augmentin® or 500mg.L-1 cefotaxime. It was concluded that Augmentin® stimulates organogenesis, that a Km concentration of 12.5mg.L-1 allows selection of explants transformed with gus gene and, finally, the addition of AS (50ìM to the liquid and solid co-culture media has a positive effect on gus gene expression. Moreover, the use of an antioxidant solution during cotyledon excision is dispensable and the pre-culture of the explants has no effect on bud regeneration or gus gene expression. A transformation efficiency of 1.5% was reached.
Ecosystem Health Assessment of Mining Cities Based on Landscape Pattern
Yu, W.; Liu, Y.; Lin, M.; Fang, F.; Xiao, R.
2017-09-01
Ecosystem health assessment (EHA) is one of the most important aspects in ecosystem management. Nowadays, ecological environment of mining cities is facing various problems. In this study, through ecosystem health theory and remote sensing images in 2005, 2009 and 2013, landscape pattern analysis and Vigor-Organization-Resilience (VOR) model were applied to set up an evaluation index system of ecosystem health of mining city to assess the healthy level of ecosystem in Panji District Huainan city. Results showed a temporal stable but high spatial heterogeneity landscape pattern during 2005-2013. According to the regional ecosystem health index, it experienced a rapid decline after a slight increase, and finally it maintained at an ordinary level. Among these areas, a significant distinction was presented in different towns. It indicates that the ecosystem health of Tianjijiedao town, the regional administrative centre, descended rapidly during the study period, and turned into the worst level in the study area. While the Hetuan Town, located in the northwestern suburb area of Panji District, stayed on a relatively better level than other towns. The impacts of coal mining collapse area, land reclamation on the landscape pattern and ecosystem health status of mining cities were also discussed. As a result of underground coal mining, land subsidence has become an inevitable problem in the study area. In addition, the coal mining subsidence area has brought about the destruction of the farmland, construction land and water bodies, which causing the change of the regional landscape pattern and making the evaluation of ecosystem health in mining area more difficult. Therefore, this study provided an ecosystem health approach for relevant departments to make scientific decisions.
Plant bioreactors for the antigenic hook-associated flgK protein expression
Directory of Open Access Journals (Sweden)
Luciana Rossi
2014-01-01
Full Text Available Plants engineered with genes encoding for the antigenic proteins of various microorganisms have shown to correctly express the proteins that elicit the production of antibodies in mammalian hosts. In livestock, plant-based vaccines could represent an innovative strategy for oral vaccination, especially to prevent infection by enteric pathogens. The aim of this study was to evaluate tobacco plants as a seedspecific expression system for the production of the flgK flagellar hook-associated protein from a wild type Salmonella typhimurium strain, as a model of an edible vaccine. The flgK gene is the principal component of bacterial flagella and is recognised as virulence factor by the innate immune system. It was isolated from the Salmonella typhimurium strain by PCR. The encoding sequence of flgK was transferred into a pBI binary vector, under control of soybean basic 7S globulin promoter for the seed-specific. Plant transformation was carried out using recombinant EHA 105 Agrobacterium tumefaciens. A transgenic population was obtained made up of independently kanamycin-resistant transgenic plants, which had a similar morphological appearance to the wild-type plants. Molecular analyses of seeds confirmed the integration of the gene and the average expression level of flgK was estimated to be about 0.6 mg per gram of seeds, corresponding to 0.33% of the total amount of soluble protein in tobacco seeds. This study showed that the foreign flgK gene could be stably incorporated into the tobacco plant genome by transcription through the nuclear apparatus of the plant, and that these genes are inherited by the next generation.
Jessenin, Sergei, 1895-1925
2006-01-01
Sisu: "Juba õhtu on käes..." ; "Seal, kus koit valab kapsaste vahel..." ; "Tulvavesi suitsev..." ; "Tegin oja kaldal vene..." ; "Laia taevaliua sinal..." ; "Kallis kodu! Näen kui unes..." ; "Olen karjus; minu valdus..." ; Venemaa ; Joobumus ; Hobused ; Laul koerast ; "Milleks punakuldseis põõsais nuuksed..." ; "Teispool jõge lõkkeread..." ; "Mind väsitand on kodunurk..." ; "See on mu kodu, mõtlik-hell..." ; Sinendus ; "Õhtul, kui kõik jooned nõrgemad..." ; "Homme varakult üles mind aja..." ; "Isamaja, kuhu jäid..." ; "Paljad põllud, metsaveered..." ; "Su juus on roheline..." ; "Laulud, laulud, kuhu te viite..." ; "Õnn, sina rumal! Mu aknad..." ; "Valged teed kinni tuiskab..." ; "Taas kiindumust ma vajan uut..." ; "Tiigipinnale kuldlehti liibub..." ; "Tuuled, tuuled, oo lund tooge, tuuled..." ; "Olen viimane külapoeet ma..." ; "Pole tarvis palvet, kurtmist, nuttu..." ; "Jah! Nüüd kindel on küll, et ei iial..." ; "Samasugune lihtne kui muud..." ; "Mingi troika on värava taga..." ; Kiri emale ; "Kõik me vähehaaval kaome sinna..." ; "Shagane, minu hea Shagane..." ; "Elurõõmus maailm, sinine ja lai..." ; "Koju ma ei leia teed..." ; "Sinav mai. Eha punerdav joom..." ; "Magab stepp. Koirohu tinast värskust..." ; "Meretäis sädinat õues..." ; "Elu pettus on, mis kestab päevast päeva..." ; "Mängi, lõõtspill, julgelt, mängi, lõõtspill, valju..." ; "Pole näinud ma kaunimat sinust..." ; "Laula nüüd mõnda laulukest, mida..." ; "Selle maailma kiiresti läbin..." ; "Sinistkirja pluus ja sinisilmadki..." ; "Tukub heledas kuuvalges..." ; "Küll on tuisk, tont võtaks, taevas ära kaob..." ; "Kes ma olen? Ainult unistaja..." ; "Sõber, hüvasti, mul ees on minek...". Eluloolisi andmeid autori kohta lk. 821
Rustagi, Anjana; Jain, Shalu; Kumar, Deepak; Shekhar, Shashi; Jain, Mukesh; Bhat, Vishnu; Sarin, Neera Bhalla
2015-01-01
Bananas and plantains (Musa spp. L.) are important subsistence crops and premium export commodity in several countries, and susceptible to a wide range of environmental and biotic stress conditions. Here, we report efficient, rapid, and reproducible Agrobacterium-mediated transformation and regeneration of an Indian niche cultivar of banana [M. acuminata cv. Matti (AA)]. Apical meristem-derived highly proliferative multiple shoot clump (MSC) explants were transformed with the Agrobacterium strain EHA105 harboring a binary vector pCAMBIA-1301 carrying hptII and uidA. Sequential agro-infiltration (10 min, 400 mmHg), infection (additional 35 min, Agrobacterium density A 600 = 0.8) and co-cultivation (18 h) regimen in 100 µM acetosyringone containing liquid medium were critical factors yielding high transformation efficiency (~81 %) corroborated by transient GUS expression assay. Stable transgenic events were recovered following two cycles of meristem initiation and selection on hygromycin containing medium. Histochemical GUS assay in several tissues of transgenic plants and molecular analyses confirmed stable integration and expression of transgene. The protocol described here allowed recovery of well-established putative transgenic plantlets in as little as 5 months. The transgenic banana plants could be readily acclimatized under greenhouse conditions, and were phenotypically similar to the wild-type untransformed control plants (WT). Transgenic plants overexpressing Salinity-Induced Pathogenesis-Related class 10 protein gene from Arachis hypogaea (AhSIPR10) in banana cv. Matti (AA) showed better photosynthetic efficiency and less membrane damage (P < 0.05) in the presence of NaCl and mannitol in comparison to WT plants suggesting the role of AhSIPR10 in better tolerance of salt stress and drought conditions.
Energy Technology Data Exchange (ETDEWEB)
Kondaiah, M. [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522510, Andhra Pradesh (India); Sravana Kumar, D. [Dr. V.S. Krishna Govt. Degree College, Visakhapatnam, Andhra Pradesh (India); Sreekanth, K. [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522510, Andhra Pradesh (India); Krishna Rao, D., E-mail: krdhanekula@yahoo.co.in [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522510, Andhra Pradesh (India)
2011-12-15
Highlights: > Positive values of V{sub m}{sup E}, indicate dispersion forces between acrylic esters and DMF. > V{sub m}{sup E} values compared with Redlich-Kister polynomial. > Partial molar volumes data conclude that weak interactions exist in the systems. > Measured velocity values compared with theoretical values obtained by polynomials. - Abstract: Ultrasonic velocities, u, densities, {rho}, of binary mixtures of N,N-dimethyl formamide (DMF) with methyl acrylate (MA), ethyl acrylate (EA), butyl acrylate (BA), and 2-ethyl hexyl acrylate (EHA), including pure liquids, over the entire composition range have been measured at T = 308.15 K. Using the experimental results, the excess molar volume, V{sub m}{sup E}, partial molar volumes, V-bar {sub m,1}, V-bar{sub m,2}, and excess partial molar volumes, V-bar{sub m,1}{sup E}, V-bar{sub m,2}{sup E} have been calculated. Molecular interactions in the systems have been studied in the light of variation of excess values of calculated properties. The excess properties have been fitted to Redlich-Kister type polynomial and the corresponding standard deviations have been calculated. The positive values of V{sub m}{sup E} indicate the presence of dispersion forces between the DMF and acrylic ester molecules. Further theoretical values of sound velocity in the mixtures have been evaluated using various theories and have been compared with experimental sound velocities to verify the applicability of such theories to the systems studied. Theoretical ultrasonic velocity data have been used to study molecular interactions in the binary systems investigated.
Kauffman, J. B.; Bhomia, R. K.
2014-12-01
Mangroves provide a number of ecosystem services including habitats for many species of fish and shellfish, storm protection, influences on water quality, wood, aesthetics, and a source of nutrients and energy for adjacent marine ecosystems. C stocks of mangroves are among the highest of any forest type on Earth. We have measured the ecosystem carbon stocks in mangroves across the world and found them to range from 250 to >2000 Mg C/ha which is a CO2 equivalence of 917 to 7340 Mg/ha. Because the numerous values of mangroves are well known, it is ironic that rates of deforestation largely relating to land use/land cover change are among the highest of any forest type on earth exceeding that of tropical rain forests. Dominant causes of deforestation include conversion to aquaculture (shrimp), agricultural conversion, and coastal development. The carbon emissions arising from conversion of mangroves to other uses is exceptionally high. This is because vulnerability of the soil carbon stocks to losses with conversion. Emissions from conversion of mangrove to shrimp ponds range from about 800 to over 3000 Mg CO2e/ha. This places the carbon footprint of shrimp arising from such ponds as among the highest of any food product available. Of great interest is the potential value of mangroves in carbon marketing strategies and other financial incentives that are derived from the conservation of standing forests. This is because of the combination of high carbon stocks in intact mangroves, the high greenhouse gas emissions arising from their conversion, and the conservation of other valuable ecosystem services provided by intact mangroves.
Mhatre, Minal; Srinivas, Lingam; Ganapathi, Thumballi R
2011-12-01
Pineapple (Ananas comosus L. Merr., cv. "Queen") leaf bases were transformed with Agrobacterium tumefaciens strain EHA 105 harboring the pSF and pEFESF plasmids with soybean ferritin cDNA. Four to eight percent of the co-cultivated leaf bases produced multiple shoots 6 weeks after transfer to Murashige and Skoog's medium supplemented with α-naphthalene acetic acid 1.8 mg/l, indole-3-butyric acid 2.0 mg/l, kinetin 2.0 mg/l, cefotaxime 400 mg/l, and kanamycin 50 mg/l. Putatively transformed shoots (1-2 cm) were selected and multiplied on medium of the same composition and elongated shoots (5 cm) were rooted on liquid rooting medium supplemented with cefotaxime 400 mg/l and kanamycin 100 mg/l. The rooted plants were analyzed through PCR, genomic Southern analysis, and reverse transcription PCR. The results clearly confirmed the integration and expression of soybean ferritin gene in the transformed plants. Atomic absorption spectroscopic analysis carried out with six independently transformed lines of pSF and pEFE-SF revealed a maximum of 5.03-fold increase in iron and 2.44-fold increase in zinc accumulation in the leaves of pSF-transformed plants. In pEFE-SF-transformed plants, a 3.65-fold increase in iron and 2.05-fold increase in zinc levels was observed. Few of the transgenic plants were hardened in the greenhouse and are being grown to maturity to determine the enhanced iron and zinc accumulation in the fruits. To the best of our knowledge this is the first report on the transformation of pineapple with soybean ferritin for enhanced accumulation of iron and zinc content in the transgenic plants.
Genetic transformation of Eucalyptus camaldulensis by agrobalistic method
Directory of Open Access Journals (Sweden)
Evânia Galvão Mendonça
2013-06-01
Full Text Available Eucalyptus stands in the setting of worldwide forestry due to its adaptability, rapid growth, production of high-quality and low cost of wood pulp fibers. The eucalyptus convetional breeding is impaired mainlly by the long life cycle making the genetic transformation systems an important tool for this purpose. However, this system requires in vitro eficient protocols for plant induction, regeneration and seletion, that allow to obtain transgenic plants from the transformed cell groups. The aim of this work was to evaluate the callus formation and to optimize the leaves and callus genetic transformation protocol by using the Agrobacterium tumefaciens system. Concerning callus formation, two different culture media were evaluated: MS medium supplemented with auxin, cytokinin (M1 and the MS medium with reduced nitrogen concentration and supplemented with auxin, cytokinin coconut water (M2. To establish the leave genetic transformation, those were exposed to agrobiolistics technique (gene gun, to tissue injury, and A. tumesfasciens EHA 105 contening the vetor pCambia 3301 (35S::GUS::NOS, for gene transference and to establish the callus transformation thoses were exposed only to A. tumefasciens. For both experiments, the influence of different infection periods was evaluated. The M2 medium provided the best values for callus sizea and fresh and dry weight. The leaves genetic transformation using the agrobiolistics technique was effective, the gus gene transient expression could be observed. No significant differences were obtained in the infection periods (4, 6 and 8 minutes. The callus genetic transformation with A. tumefaciens also promotend the gus gene transient expression on the callus co-cultiveted for 15 e 30 minutes. The transformed callus was transfered to a regeneration and selection medium and transformed plants were obtained.
Directory of Open Access Journals (Sweden)
Shanna Sichwart
2015-01-01
Full Text Available A new optimized system for the surface display and secretion of recombinant proteins is described, termed MATE (maximized autotransporter-mediated expression. It is based on an artificial gene consisting of the coding region for the signal peptide of CtxB, a multiple cloning site for passenger gene insertion, flanked by coding sequences for linear epitopes for monoclonal antibodies and OmpT, and factor Xa protease cleavage sites followed by a codon-optimized DNA sequence of the linker and the β-barrel of the type V autotransporter EhaA from Escherichia coli under control of an IPTG-inducible T5 promoter. The MATE system enabled the continuous secretion of recombinant passenger mCherry via OmpT-mediated cleavage, using native OmpT protease activity in E. coli when grown at 37 °C. It is the first example to show that native OmpT activity is sufficient to facilitate the secretion of a correctly folded target protein in preparative amounts obtaining 240 μg of purified mCherry from 800 mL of crude culture supernatant. Because the release of mCherry was achieved by a simple transfer of the encoding plasmid from an OmpT-negative to an OmpT-positive strain, it bears the option to use surface display for screening purposes and secretion for production of the selected variant. A single plasmid could therefore be used for continuous secretion in OmpT-positive strains or surface display in OmpT-negative strains. In conclusion, the MATE system appears to be a versatile tool for the surface display and for the secretion of target proteins in E. coli.
Special Education Services and Response to Intervention: What, Why, and How?
Directory of Open Access Journals (Sweden)
Sharla N. Fasko
2006-09-01
Full Text Available Recently there has been an ongoing, at times acrimonious, discussion about the newest incarnation of the federal law that mandates special services for children with disabilities. At the heart of the controversy is a relatively new evaluation model referred to as Response to Intervention (RTI. Advocates and stakeholders have been very vocal in their opinions, leaving those down on the frontlines puzzled and confused. Teachers in particular are feeling frustration over yet another, seemingly arbitrary change in the red tape of special education, about which no one has consulted them or even really bothered to explain.Historically, teachers have felt, not unreasonably, a bit victimized by special education law. In 1975, they were told to step aside, that they were not skilled enough to teach children with special needs. Teachers were given a clear message that their role was to keep alert for disabled children and send them on to the experts. Over time, that message has transformed into something quite different; now they hear that they are evading their responsibility by pushing children onto the special education rolls. In addition, procedures for referrals have modified almost yearly; just when they understand the process, it changes.The purpose of this paper is to examine the circumstances that led up to the conception of RTI, and why many people believe it is a significant but necessary change to special education law. In order to understand the rationale behind RTI, it must be examined in the context of the federal laws which necessitated its creation, beginning with Public Law 94-142 (also known as the Education for Handicapped Act, or EHA, passed in 1975, and its subsequent reauthorizations, the most recent of which is the Individuals with Disabilities Education Improvement Act of 2004, or IDEIA. For purposes of brevity in this paper, the original act and its descendants will be collectively referred to as IDEIA, unless an issue specific
Directory of Open Access Journals (Sweden)
Marcelo P Chartier
2010-07-01
Full Text Available Los modelos matemáticos son herramientas útiles para la predicción de las pérdidas de suelo por erosión hídrica. El desarrollo reciente del modelo WEPP y su utilización para evaluar los riesgos de erosión en pastizales naturales ha significado un avance interesante en el campo de la erosión y la conservación de suelos de estos ecosistemas. En este trabajo examinamos la eficiencia del modelo WEPP para predecir los procesos hidrológicos y de erosión del suelo en los pastizales naturales semiáridos del noreste de la provincia de Chubut. Se identificaron tres comunidades de plantas ubicadas a lo largo de un gradiente de degradación del suelo: estepa herbácea con arbustos aislados (EH, estepa herbáceo-arbustiva (EHA y estepa arbustiva degradada (EA. En cada una de estas comunidades se aplicó una lluvia simulada (100 mm h-1 durante 30 min sobre parcelas de 1 m² (0,6 x 1,67 m y se colectó el escurrimiento y los sedimentos totales. A partir de los datos de la condición superficial de cada parcela se estimó el escurrimiento y la producción de sedimentos mediante el modelo WEPP. En este trabajo se observó una baja eficiencia del modelo WEPP para predecir el escurrimiento (Eficiencia, E = 0,14 y la erosión del suelo (E = -0,93. La predicción del escurrimiento y pérdida de suelo del modelo WEPP mostró mayor sensibilidad a cambios en los parámetros de lluvia y pendiente del terreno y una sensibilidad moderada a cambios en la cobertura, textura, erodabilidad del suelo y conductividad hidráulica efectiva. El escurrimiento y la producción de sedimentos estimados por WEPP fueron significativamente diferentes en las distintas comunidades de plantas (p Mathematical models are useful tools to predict soil loss by water erosion. The recent development of the WEPP model and its use in assessing the risks of erosion in rangelands has led to significant advances in the field of erosion and soil conservation of these ecosystems. In this
Directory of Open Access Journals (Sweden)
Rocío eColello
2016-02-01
Full Text Available Pigs are important reservoirs of Shiga toxin-producing Escherichia coli (STEC. The entrance of these strains into the food chain implies a risk to consumers because of the severity of hemolytic uremic syndrome. This study reports the prevalence and characterization of Shiga toxin-producing Escherichia coli (STEC throughout the pork production chain. From 764 samples, 31 (4.05% were stx positive by PCR screening. At farms, 2.86% of samples were stx positive; at slaughter, 4.08% of carcasses were stx positive and at boning rooms, 6% of samples were stx positive. These percentages decreased in pork meat ready for sale at sales markets (4.59%. From positive samples, 50 isolates could be characterized. At farms 37.5% of the isolates carried stx1/stx2 genes, 37.5% possessed stx2e and 25%, carried only stx2. At slaughter we detected 50% of isolates positive for stx2, 33% for stx2e and 16% for stx1/stx2. At boning rooms 59% of the isolates carried stx1/stx2, 14% stx2e and 5% stx1/stx2/stx2e. At retail markets 66% of isolates were positive for stx2, 17% stx2e and 17% stx1/stx2. For the other virulence factors, ehxA and saa were not detected and eae gene was detected in 12% of the isolates. Concerning putative adhesins, agn43 was detected in 72%, ehaA in 26%, aida in 8% and iha in 6% of isolates. The strains were typed into 14 E. coli O groups (O1, O2, O8, O15, O20, O35, O69, O78, O91, O121, O138, O142, O157, O180 and ten H groups (H9, H10, H16, H21, H26, H29, H30, H32, H45, H46. This study reports the prevalence and characterization of STEC strains through the chain pork suggesting the vertical transmission. STEC contamination originates in the farms and is transferred from pigs to carcasses in the slaughter process and increase in meat pork at boning rooms and sales markets. These results highlight the need to implement an integrated STEC control system based on good management practices on the farm and critical control point systems in the food chain.
Stern, Jennifer C.; Foustoukos, Dionysis I.; Sonke, Jeroen E.; Salters, Vincent J. M.
2014-01-01
The mobility of metals in soils and subsurface aquifers is strongly affected by sorption and complexation with dissolved organic matter, oxyhydroxides, clay minerals, and inorganic ligands. Humic substances (HS) are organic macromolecules with functional groups that have a strong affinity for binding metals, such as actinides. Thorium, often studied as an analog for tetravalent actinides, has also been shown to strongly associate with dissolved and colloidal HS in natural waters. The effects of HS on the mobilization dynamics of actinides are of particular interest in risk assessment of nuclear waste repositories. Here, we present conditional equilibrium binding constants (Kc, MHA) of thorium, hafnium, and zirconium-humic acid complexes from ligand competition experiments using capillary electrophoresis coupled with ICP-MS (CE- ICP-MS). Equilibrium dialysis ligand exchange (EDLE) experiments using size exclusion via a 1000 Damembrane were also performed to validate the CE-ICP-MS analysis. Experiments were performed at pH 3.5-7 with solutions containing one tetravalent metal (Th, Hf, or Zr), Elliot soil humic acid (EHA) or Pahokee peat humic acid (PHA), and EDTA. CE-ICP-MS and EDLE experiments yielded nearly identical binding constants for the metal- humic acid complexes, indicating that both methods are appropriate for examining metal speciation at conditions lower than neutral pH. We find that tetravalent metals form strong complexes with humic acids, with Kc, MHA several orders of magnitude above REE-humic complexes. Experiments were conducted at a range of dissolved HA concentrations to examine the effect of [HA]/[Th] molar ratio on Kc, MHA. At low metal loading conditions (i.e. elevated [HA]/[Th] ratios) the ThHA binding constant reached values that were not affected by the relative abundance of humic acid and thorium. The importance of [HA]/[Th] molar ratios on constraining the equilibrium of MHA complexation is apparent when our estimated Kc, MHA values
Sisseminekuks : [luuletused] / Anna Haava ; [Impressioonid]: Viiu Härm
Haava, Anna, pseud., 1864-1957
2004-01-01
Sisu: Sisseminekuks ; Kartus ; Ööbikule ; Käokene, kuldalindu ; Mis sa tahad, kevade? ; Ei tule uni ; Hoia ennast; Tuksuv süda ; Sina oled kelm ; Hinge hellal' igatsusel' ; Kõik kallile ; Soov ; Unes nägin ; Võin ; Sinu silmad ; Sinu silmist pilk ; Kallis, sul on kuldne süda ; Sa kõige armsam mulle ; Oh võiksin ; Lill ; Nõmmelill ; Meie Mihkel ; Koidulale ; Ehitage rahukojad ; Emakeel ; Isamaja ; Väsinud ; Oh kuhu ma lähen? ; Ööbiku surm ; Ei saa mitte vaiki olla ; Ma olen näinud ; Südameta ; Sellepärast ; See oli ilusal õiekuul; Esimese lume ajal ; Mina vaat'sin muru pääle ; Ikka kurjalt sa mind vaatad ; Oh ma isegi ei tea ; Mis on luule paljalt sõnas? ; Oh oleksin ära surnud ; Lee ääres ; Sinu nimi ; Hoia vahest aken lahti ; Jumalaga jättes vaat'sid ; Ma laulan ; Ei oma õnne peita ; Küll oli ilus mu õieke ; Oh ära sa küsi ; Ei tule luule tuulest ; Köögis seisab ; Järv leegib eha paistel ; Sinu vanaema ; Nii ta on ; Tead küll, mu kuldkallis ; Ma lähen üle nõmme ; Lenda, lepatriinuke ; Vesi voolab, vesi kohab ; Üks ainus kord ; Oh kevade, oh õie-aeg ; Suur kontsert ; Kuupaistel ; Mets kohiseb ; Lind läks magama ; Kui sa tuled, too mull' lilli ; Sinilillekesed ; Ei ole sina minu ingel ; Ei mina õnne usu ; Viimast laulu ei saa laulda ; Kõige ilusam luule ; Üks on minul püham koda! ; Sa oled suurem kui su saatus ; Mu kodumaa, kus oled sa? ; Eest ära! ; Kui kandlekeeled katkevad ; Ma kõnnin koiduvalgel ; Mu mured kõik matsin ma maha ; Kui ma sulle armas olen ; Kas tahad tulla minuga? ; Sa vaata ette, süda! ; Truus sõpruses ma tahan ; Su silmade sügavuses ; Siis mine! ; See oli siis ; Mu süda usub ; Sind teretame, kuldapäike ; Mind jumalaga jätsid ; Sääl kord kasvab kaunis kodu ; Me oleme põhjamaa lapsed ; Hilised lilled ; Sa küsid, kus mu kodu ; külm ; Sina vaikiv, sügav öö ; Ju õitsvad kõik hellerheinad ; Öösünges kohab ; Kui saaks mullegi kord kodu ; On püha mulle mu kodumaa muld ; Oma hind vaid vaba
Directory of Open Access Journals (Sweden)
Wang Quan
2012-06-01
Full Text Available Abstract Background As a valuable medicinal plant, Madagascar periwinkle (Catharanthus roseus produces many terpenoid indole alkaloids (TIAs, such as vindoline, ajamlicine, serpentine, catharanthine, vinblastine and vincristine et al. Some of them are important components of drugs treating cancer and hypertension. However, the yields of these TIAs are low in wild-type plants, and the total chemical synthesis is impractical in large scale due to high-cost and their complicated structures. The recent development of metabolic engineering strategy offers a promising solution. In order to improve the production of TIAs in C. roseus, the establishment of an efficient genetic transformation method is required. Results To develop a genetic transformation method for C. roseus, Agrobacterium tumefaciens strain EHA105 was employed which harbors a binary vector pCAMBIA2301 containing a report β-glucuronidase (GUS gene and a selectable marker neomycin phosphotransferase II gene (NTPII. The influential factors were investigated systematically and the optimal transformation condition was achieved using hypocotyls as explants, including the sonication treatment of 10 min with 80 W, A. tumefaciens infection of 30 min and co-cultivation of 2 d in 1/2 MS medium containing 100 μM acetosyringone. With a series of selection in callus, shoot and root inducing kanamycin-containing resistance media, we successfully obtained stable transgenic regeneration plants. The expression of GUS gene was confirmed by histochemistry, polymerase chain reaction, and genomic southern blot analysis. To prove the efficiency of the established genetic transformation system, the rate-limiting gene in TIAs biosynthetic pathway, DAT, which encodes deacetylvindoline-4-O-acetyltransferase, was transferred into C. roseus using this established system and 9 independent transgenic plants were obtained. The results of metabolite analysis using high performance liquid chromatography (HPLC
Kauffman, J Boone; Heider, Chris; Norfolk, Jennifer; Payton, Frederick
2014-04-01
Mangroves are recognized to possess a variety of ecosystem services including high rates of carbon sequestration and storage. Deforestation and conversion of these ecosystems continue to be high and have been predicted to result in significant carbon emissions to the atmosphere. Yet few studies have quantified the carbon stocks or losses associated with conversion of these ecosystems. In this study we quantified the ecosystem carbon stocks of three common mangrove types of the Caribbean as well as those of abandoned shrimp ponds in areas formerly occupied by mangrove-a common land-use conversion of mangroves throughout the world. In the mangroves of the Montecristi Province in Northwest Dominican Republic we found C stocks ranged from 706 to 1131 Mg/ha. The medium-statured mangroves (3-10 m in height) had the highest C stocks while the tall (> 10 m) mangroves had the lowest ecosystem carbon storage. Carbon stocks of the low mangrove (shrub) type (carbon-rich soils as deep as 2 m. Carbon stocks of abandoned shrimp ponds were 95 Mg/ha or approximately 11% that of the mangroves. Using a stock-change approach, the potential emissions from the conversion of mangroves to shrimp ponds ranged from 2244 to 3799 Mg CO2e/ha (CO2 equivalents). This is among the largest measured C emissions from land use in the tropics. The 6260 ha of mangroves and converted mangroves in the Montecristi Province are estimated to contain 3,841,490 Mg of C. Mangroves represented 76% of this area but currently store 97% of the carbon in this coastal wetland (3,696,722 Mg C). Converted lands store only 4% of the total ecosystem C (144,778 Mg C) while they comprised 24% of the area. By these metrics the replacement of mangroves with shrimp and salt ponds has resulted in estimated emissions from this region totaling 3.8 million Mg CO2e or approximately 21% of the total C prior to conversion. Given the high C stocks of mangroves, the high emissions from their conversion, and the other important