Sequence analysis corresponding to the PPE and PE proteins in ...
Indian Academy of Sciences (India)
Unknown
AB repeats; Mycobacterium tuberculosis genome; PE-PPE domain; PPE, PE proteins; sequence analysis; surface antigens. J. Biosci. | Vol. ... bacterium tuberculosis genomes resulted in the identification of a previously uncharacterized 225 amino acid- ...... Vega Lopez F, Brooks L A, Dockrell H M, De Smet K A,. Thompson ...
Ahmed, Asma; Dolasia, Komal; Mukhopadhyay, Sangita
2018-04-18
Mycobacterium tuberculosis PPE18 is a member of the PPE family. Previous studies have shown that recombinant PPE18 (rPPE18) protein binds to TLR2 and triggers a signaling cascade which reduces levels of TNF-α and IL-12, and increases IL-10 in macrophages. Because TNF-α is a major mediator of the pathophysiology of sepsis and blocking inflammation is a possible line of therapy in such circumstances, we tested the efficacy of rPPE18 in reducing symptoms of sepsis in a mouse model of Escherichia coli- induced septic peritonitis. rPPE18 significantly decreased levels of serum TNF-α, IL-1β, IL-6, and IL-12 and reduced organ damage in mice injected i.p. with high doses of E. coli Peritoneal cells isolated from rPPE18-treated mice had characteristics of M2 macrophages which are protective in excessive inflammation. Additionally, rPPE18 inhibited disseminated intravascular coagulation, which can cause organ damage resulting in death. rPPE18 was able to reduce sepsis-induced mortality when given prophylactically or therapeutically. Additionally, in a mouse model of cecal ligation and puncture-induced sepsis, rPPE18 reduced TNF-α, alanine transaminase, and creatinine, attenuated organ damage, prevented depletion of monocytes and lymphocytes, and improved survival. Our studies show that rPPE18 has potent anti-inflammatory properties and can serve as a novel therapeutic to control sepsis. Copyright © 2018 by The American Association of Immunologists, Inc.
Development and psychometric evaluation of the Professional Practice Environment (PPE) scale.
Erickson, Jeanette Ives; Duffy, Mary E; Gibbons, M Patricia; Fitzmaurice, Joan; Ditomassi, Marianne; Jones, Dorothy
2004-01-01
To describe the Professional Practice Environment (PPE) scale, its conceptual development and psychometric evaluation, and its uses in measuring eight characteristics of the professional practice environment in an acute care setting. The 38-item PPE Scale was validated on a sample of 849 professional practice staff at the Massachusetts General Hospital in Boston. Psychometric analysis included: item analysis, principal components analysis (PCA) with varimax rotation and Kaiser normalization, and internal consistency reliability using Cronbach's alpha coefficient. Eight components were shown, confirming the original conceptually derived model's structure and accounting for 61% of explained variance. Cronbach's alpha coefficients for the eight PPE subscales ranged from .78 to .88. Findings showed the 38-item PPE Scale was reliable and valid for use in health outcomes research to examine the professional practice environment of staff working in acute care settings.
Mutations in ppe38 block PE_PGRS secretion and increase virulence of Mycobacterium tuberculosis.
Ates, Louis S; Dippenaar, Anzaan; Ummels, Roy; Piersma, Sander R; van der Woude, Aniek D; van der Kuij, Kim; Le Chevalier, Fabien; Mata-Espinosa, Dulce; Barrios-Payán, Jorge; Marquina-Castillo, Brenda; Guapillo, Carolina; Jiménez, Connie R; Pain, Arnab; Houben, Edith N G; Warren, Robin M; Brosch, Roland; Hernández-Pando, Rogelio; Bitter, Wilbert
2018-02-01
Mycobacterium tuberculosis requires a large number of secreted and exported proteins for its virulence, immune modulation and nutrient uptake. Most of these proteins are transported by the different type VII secretion systems 1,2 . The most recently evolved type VII secretion system, ESX-5, secretes dozens of substrates belonging to the PE and PPE families, which are named for conserved proline and glutamic acid residues close to the amino terminus 3,4 . However, the role of these proteins remains largely elusive 1 . Here, we show that mutations of ppe38 completely block the secretion of two large subsets of ESX-5 substrates, that is, PPE-MPTR and PE_PGRS, together comprising >80 proteins. Importantly, hypervirulent clinical M. tuberculosis strains of the Beijing lineage have such a mutation and a concomitant loss of secretion 5 . Restoration of PPE38-dependent secretion partially reverted the hypervirulence phenotype of a Beijing strain, and deletion of ppe38 in moderately virulent M. tuberculosis increased virulence. This indicates that these ESX-5 substrates have an important role in virulence attenuation. Phylogenetic analysis revealed that deletion of ppe38 occurred at the branching point of the 'modern' Beijing sublineage and is shared by Beijing outbreak strains worldwide, suggesting that this deletion may have contributed to their success and global distribution 6,7 .
Mutations in ppe38 block PE_PGRS secretion and increase virulence of Mycobacterium tuberculosis
Ates, Louis S.
2018-01-12
Mycobacterium tuberculosis requires a large number of secreted and exported proteins for its virulence, immune modulation and nutrient uptake. Most of these proteins are transported by the different type VII secretion systems1,2. The most recently evolved type VII secretion system, ESX-5, secretes dozens of substrates belonging to the PE and PPE families, which are named for conserved proline and glutamic acid residues close to the amino terminus3,4. However, the role of these proteins remains largely elusive1. Here, we show that mutations of ppe38 completely block the secretion of two large subsets of ESX-5 substrates, that is, PPE-MPTR and PE_PGRS, together comprising >80 proteins. Importantly, hypervirulent clinical M. tuberculosis strains of the Beijing lineage have such a mutation and a concomitant loss of secretion5. Restoration of PPE38-dependent secretion partially reverted the hypervirulence phenotype of a Beijing strain, and deletion of ppe38 in moderately virulent M. tuberculosis increased virulence. This indicates that these ESX-5 substrates have an important role in virulence attenuation. Phylogenetic analysis revealed that deletion of ppe38 occurred at the branching point of the ‘modern’ Beijing sublineage and is shared by Beijing outbreak strains worldwide, suggesting that this deletion may have contributed to their success and global distribution6,7.
Mutations in ppe38 block PE_PGRS secretion and increase virulence of Mycobacterium tuberculosis
Ates, Louis S.; Dippenaar, Anzaan; Ummels, Roy; Piersma, Sander R.; van der Woude, Aniek D.; van der Kuij, Kim; Le Chevalier, Fabien; Mata-Espinosa, Dulce; Barrios-Payá n, Jorge; Marquina-Castillo, Brenda; Guapillo, Carolina; Jimé nez, Connie R.; Pain, Arnab; Houben, Edith N. G.; Warren, Robin M.; Brosch, Roland; Herná ndez-Pando, Rogelio; Bitter, Wilbert
2018-01-01
Mycobacterium tuberculosis requires a large number of secreted and exported proteins for its virulence, immune modulation and nutrient uptake. Most of these proteins are transported by the different type VII secretion systems1,2. The most recently evolved type VII secretion system, ESX-5, secretes dozens of substrates belonging to the PE and PPE families, which are named for conserved proline and glutamic acid residues close to the amino terminus3,4. However, the role of these proteins remains largely elusive1. Here, we show that mutations of ppe38 completely block the secretion of two large subsets of ESX-5 substrates, that is, PPE-MPTR and PE_PGRS, together comprising >80 proteins. Importantly, hypervirulent clinical M. tuberculosis strains of the Beijing lineage have such a mutation and a concomitant loss of secretion5. Restoration of PPE38-dependent secretion partially reverted the hypervirulence phenotype of a Beijing strain, and deletion of ppe38 in moderately virulent M. tuberculosis increased virulence. This indicates that these ESX-5 substrates have an important role in virulence attenuation. Phylogenetic analysis revealed that deletion of ppe38 occurred at the branching point of the ‘modern’ Beijing sublineage and is shared by Beijing outbreak strains worldwide, suggesting that this deletion may have contributed to their success and global distribution6,7.
Phelan, Jody E.
2016-02-29
Background Approximately 10 % of the Mycobacterium tuberculosis genome is made up of two families of genes that are poorly characterized due to their high GC content and highly repetitive nature. The PE and PPE families are typified by their highly conserved N-terminal domains that incorporate proline-glutamate (PE) and proline-proline-glutamate (PPE) signature motifs. They are hypothesised to be important virulence factors involved with host-pathogen interactions, but their high genetic variability and complexity of analysis means they are typically disregarded in genome studies. Results To elucidate the structure of these genes, 518 genomes from a diverse international collection of clinical isolates were de novo assembled. A further 21 reference M. tuberculosis complex genomes and long read sequence data were used to validate the approach. SNP analysis revealed that variation in the majority of the 168 pe/ppe genes studied was consistent with lineage. Several recombination hotspots were identified, notably pe_pgrs3 and pe_pgrs17. Evidence of positive selection was revealed in 65 pe/ppe genes, including epitopes potentially binding to major histocompatibility complex molecules. Conclusions This, the first comprehensive study of the pe and ppe genes, provides important insight into M. tuberculosis diversity and has significant implications for vaccine development.
Wang, Chinhua
A novel purely thermal-wave interferometric technique and its applications to non-contact and non-destructive evaluation of Ti:sapphire laser crystals, high-precision measurement of thermal diffusivity of gases, and high- sensitivity gas (hydrogen) sensors have been successfully developed both theoretically and experimentally. A comprehensive theoretical and experimental analysis of the system noise and detectivity has been conducted to consolidate the basis of the technique. Unlike the conventional single-ended photopyroelectric(PPE) technique, different thermal-wave interference patterns can be obtained by adjusting two incident beams (relative intensity and phase shift) and two thermal-wave cavities on both sides of a pyroelectric detector. It is found that the large base-line signal and large optical noise, which are encountered in the single- ended PPE scheme, can be coherently and completely suppressed in the fully destructive interferometric measurement. Differential surface absorptance, differential and absolute bulk absorption coefficient of Ti:sapphire laser crystals have been separately measured using an extended PPE-interference (PPEI) theory. Unlike the single-ended PPE method, in which thermal contributions from several optical parameters are always coupled together, the destructive interferometric: method provides a unique method for extracting precise values of one of these coupled parameters, without the need of equally precise knowledge of the values of others. The comparison measurement of thermal diffusivity of air using the single-ended PPE method and the PPEI method shows that the PPEI method enhances the measuring precision by one significant figure when compared with the single-beam method. The conventionally used concept of ``thermal-wave reflection coefficient'' has been extended to a more general case that is sample- thickness dependent. A novel hydrogen gas sensor has been initialized and developed based on the PPEI technique. It is
Phelan, Jody
2016-01-01
Abstract Background Approximately 10Â % of the Mycobacterium tuberculosis genome is made up of two families of genes that are poorly characterized due to their high GC content and highly repetitive nature. The PE and PPE families are typified by their highly conserved N-terminal domains that incorporate proline-glutamate (PE) and proline-proline-glutamate (PPE) signature motifs. They are hypothesised to be important virulence factors involved with host-pathogen interactions, but their high genetic variability and complexity of analysis means they are typically disregarded in genome studies. Results To elucidate the structure of these genes, 518 genomes from a diverse international collection of clinical isolates were de novo assembled. A further 21 reference M. tuberculosis complex genomes and long read sequence data were used to validate the approach. SNP analysis revealed that variation in the majority of the 168 pe/ppe genes studied was consistent with lineage. Several recombination hotspots were identified, notably pe_pgrs3 and pe_pgrs17. Evidence of positive selection was revealed in 65 pe/ppe genes, including epitopes potentially binding to major histocompatibility complex molecules. Conclusions This, the first comprehensive study of the pe and ppe genes, provides important insight into M. tuberculosis diversity and has significant implications for vaccine development.
Naphthoquinone Derivative PPE8 Induces Endoplasmic Reticulum Stress in p53 Null H1299 Cells
Directory of Open Access Journals (Sweden)
Jin-Cherng Lien
2015-01-01
Full Text Available Endoplasmic reticulum (ER plays a key role in synthesizing secretory proteins and sensing signal function in eukaryotic cells. Responding to calcium disturbance, oxidation state change, or pharmacological agents, ER transmembrane protein, inositol-regulating enzyme 1 (IRE1, senses the stress and triggers downstream signals. Glucose-regulated protein 78 (GRP78 dissociates from IRE1 to assist protein folding and guard against cell death. In prolonged ER stress, IRE1 recruits and activates apoptosis signal-regulating kinase 1 (ASK1 as well as downstream JNK for cell death. Naphthoquinones are widespread natural phenolic compounds. Vitamin K3, a derivative of naphthoquinone, inhibits variant tumor cell growth via oxygen uptake and oxygen stress. We synthesized a novel naphthoquinone derivative PPE8 and evaluated capacity to induce ER stress in p53 null H1299 and p53 wild-type A549 cells. In H1299 cells, PPE8 induced ER enlargement, GRP78 expression, and transient IER1 activation. Activated IRE1 recruited ASK1 for downstream JNK phosphorylation. IRE1 knockdown by siRNA attenuated PPE8-induced JNK phosphorylation and cytotoxicity. Prolonged JNK phosphorylation may be involved in PPE8-induced cytotoxicity. Such results did not arise in A549 cells, but p53 knockdown by siRNA restored PPE8-induced GRP78 expression and JNK phosphorylation. We offer a novel compound to induce ER stress and cytotoxicity in p53-deficient cancer cells, presenting an opportunity for treatment.
Maria Madalina Buculescu (Costica); Bogdan Nicolae Velicescu
2014-01-01
This paper aims a comparative analysis between IFRS for SMEs and Romanian national accounting regulations concerning measurement of formal convergence level of definitions, treatment and policies of Property, Plant and Equipment (PPE) and highlighting main national fiscal rules related. With the purpose to not contribute only to the measurement of PPE formal level of harmonization, we intend to analyze some PPE related accounting practices used by Romanian certified accountants. To this effec...
Norris, Emma; Myers, Lynn
2013-11-01
Despite evident protective value of motorcycle personal protective equipment (PPE), no research has assessed considerations behind its uptake in UK riders. A cross-sectional online questionnaire design was employed, with riders (n=268) recruited from online motorcycle forums. Principal component analysis found four PPE behavioural outcomes. Theoretical factors of intentions, attitudes, injunctive and descriptive subjective norms, risk perceptions, anticipated regret, benefits and habit were also identified for further analysis. High motorcycle jacket, trousers and boots wear, middling high-visibility wear and low non-Personal Protective Equipment wear were found. Greater intentions, anticipated regret and perceived benefits were significantly associated with increased motorcycle jacket, trousers and boots wear, with habit presence and scooter use significantly associated with increased high-visibility wear. Lower intentions, anticipated regret and risk perceptions, being female, not holding a car licence and urban riding were significantly associated with increased non-PPE wear. A need for freedom of choice and mixed attitudes towards PPE use were evident in additional comments. PPE determinants in this sample provide a preliminary basis for future uptake interventions. Larger scale and qualitative research is needed to further investigate relevant constructs. Copyright © 2013 Elsevier Ltd. All rights reserved.
The Short-term Protective Effects of 'Non-PPE' Gloves Used by Greenhouse Workers.
Roff, Martin
2015-10-01
Task-based worker exposure assessments are used in regulatory product approval for pesticides. Some agricultural workers may be exposed to pesticide residues predominantly via transfer to the hands during plant tending or crop harvesting. They may use thin 'splash-resistant single-use' (SRSU) gloves or cotton gloves as good industry practice, for example, to protect a delicate crop from bruising, rather than specifically for chemical protection. These 'non-personal protective equipment (PPE)' gloves may or may not have been tested for chemical resistance, but can nevertheless give limited protection from chemicals. This paper reports experiments to assess the protection factors (PFs) of 'non-PPE' gloves against chemicals, to better inform the regulatory exposure assessments.One type of lightweight cotton and three types of 0.1 mm SRSU gloves 25cm long (latex, nitrile, and vinyl) that might be used as 'non-PPE' gloves and one type of 0.4 mm PPE nitrile gauntlet 33cm long were worn by 36 volunteers in greenhouses at four nurseries, handling plants sprayed with transferable but non-permeating strontium acetate in four consecutive 1-h sessions, including one session in which no gloves were worn. Dislodgeable foliar residues were measured by rinsing leaves in bags. Each subject carried out their task such as weeding or trimming, for their four sessions on their set of plants. Handwashes followed each session, and the washings were sampled and analysed for strontium. Unprotected hand contamination was taken to be the within-subject 'challenge' in the absence of gloves. It ranged from 166 to 4091 µg equivalent of strontium acetate on the hands and increased with increasing foliar residues. Geometric mean PFs were 60 (95% CI 38-87, n = 22) for PPE gauntlets, 32 (25-41, n = 65) for SRSU gloves and 5.3 (3.5-8, n = 21) for lightweight cotton. The PFs offered by the waterproof gloves (gauntlets and SRSU) increased with challenge, but for the absorbent cotton gloves it
Fair value or cost-based measurement for PPE and IP: evidence from accounting practice under IFRS
Fonseca, Maria
2007-01-01
Some standards permit a choice between different measurement bases. IAS 16 and IAS 40 allow entities to choose between fair value and cost-based measurement for property, plant and equipment (PPE) and investment property (IP), respectively. This study analyzes the accounting practice concerning measurement of PPE and IP after recognition, under IFRS. The sample was extracted from stock exchange listed European companies included in the S&P Europe 350 Index. Data was hand collec...
Tiigrihüppe Sihtasutus alustab koostööd firmaga / Signe Teder
Teder, Signe
2001-01-01
Tiigrihüppe Sihtasutus alustas koos Intel Corporationìga uut koolitusprogrammi koolitajatele. Kursuse sisu ja metoodika vastab haridusministeeriumi kinnitatud õpetajatele soovitatavatele IKT-alastele pädevustele ja "Tiigrihüpe Plus" arengukavale
Brouwer, D.H.; Marquart, H.; Hemmen, J.J. van
2001-01-01
Introduction of personal protective equipment (PPE) in the process of quantitative exposure and risk assessment should be addressed carefully. PPE which have been designed and manufactured according to CE-criteria and have proved to pass relevant test criteria, can be classified as 'proper
Phelan, Jody E.; Coll, Francesc; Bergval, Indra; Anthony, Richard M.; Warren, Rob; Sampson, Samantha L.; Gey van Pittius, Nicolaas C.; Glynn, Judith R.; Crampin, Amelia C.; Alves, Adriana; Bessa, Theolis Barbosa; Campino, Susana; Dheda, Keertan; Grandjean, Louis; Hasan, Rumina; Hasan, Zahra; Miranda, Anabela; Moore, David; Panaiotov, Stefan; Perdigao, Joao; Portugal, Isabel; Sheen, Patricia; de Oliveira Sousa, Erivelton; Streicher, Elizabeth M.; van Helden, Paul D.; Viveiros, Miguel; Hibberd, Martin L.; Pain, Arnab; McNerney, Ruth; Clark, Taane G.
2016-01-01
. tuberculosis complex genomes and long read sequence data were used to validate the approach. SNP analysis revealed that variation in the majority of the 168 pe/ppe genes studied was consistent with lineage. Several recombination hotspots were identified
The equation of state of n-pentane in the atomistic model TraPPE-EH
Valeev, B. U.; Pisarev, V. V.
2018-01-01
In this work, we study the vapor-liquid equilibrium in n-pentane. We use the TraPPE-EH (transferable potentials for phase equilibria-explicit hydrogen) forcefield, where each hydrogen and carbon atom is considered as independent center of force. The fluid behavior was investigated with different values of density and temperature by molecular dynamics method. The n-pentane evaporation curve was calculated in the temperature range of 290 to 390 K. The densities of the coexisting phases are also calculated. The compression curve at 370 K was calculated and isothermal bulk modulus was found. The simulated properties of n-pentane are in good agreement with data from a database of the National Institute of Standards and Technology, so the TraPPE-EH model can be recommended for simulations of hydrocarbons.
Prediction-error of Prediction Error (PPE)-based Reversible Data Hiding
Wu, Han-Zhou; Wang, Hong-Xia; Shi, Yun-Qing
2016-01-01
This paper presents a novel reversible data hiding (RDH) algorithm for gray-scaled images, in which the prediction-error of prediction error (PPE) of a pixel is used to carry the secret data. In the proposed method, the pixels to be embedded are firstly predicted with their neighboring pixels to obtain the corresponding prediction errors (PEs). Then, by exploiting the PEs of the neighboring pixels, the prediction of the PEs of the pixels can be determined. And, a sorting technique based on th...
Does the PPE choose the right way towards energy transition?
International Nuclear Information System (INIS)
Beutier, Didier
2016-01-01
In this article, the author states the PPE (the French multi-year energy planning) does not seem to be the best way to reach objectives related to the reduction of greenhouse gas emissions. He first discusses the planned evolutions for renewable, fossil and nuclear energies. He states that the development of wind energy should take some impacts into account: wind energy requires 5 times more concrete, 20 times more steel and 20 times more ground surface than a nuclear plant. He states that France cannot afford stopping a performing industrial tool (nuclear plants)
International Nuclear Information System (INIS)
Kemplin, M.G.
1988-01-01
Industrial hygiene managers working in the hazardous waste area face daily decisions concerning appropriate levels of personal protective equipment (PPE) for hazards expected on various waste site projects. Typical hazards include exposures to toxic dust, chemical vapors, toxic gases, splashes of corrosive or toxic substances, radioactive materials and high noise levels. Managers who are experienced in this area recognize that each item of PPE can represent potential hazards in its own right. For example, full-face respirators typically restrict peripheral vision and can impede proper communications. In high ambient temperature conditions, coated protective suits can represent significant heat stress concerns, etc. Accordingly, this paper reviews health and safety management decision-making in this regard
Phelan, Jody; Coll, Francesc; Bergval, Indra; Anthony, Richard; Warren, Rob; Sampson, Samantha; Pittius, Nicolaas Gey van; Glynn, Judith; Crampin, Amelia; Alves, Adriana; Bessa, Theolis; Campino, Susana; Dheda, Keertan; Grandjean, Louis; Hasan, Rumina; Hasan, Zahra; Miranda, Anabela; Moore, David; Panaiotov, Stefan; Perdigao, Joao; Portugal, Isabel; Sheen, Patricia; Sousa, Erivelton de Oliveira; Streicher, Elizabeth; Helden, Paul van; Viveiros, Miguel; Hibberd, Martin; Pain, Arnab; McNerney, Ruth; Clark, Taane
2016-01-01
Abstract Background Approximately 10Â % of the Mycobacterium tuberculosis genome is made up of two families of genes that are poorly characterized due to their high GC content and highly repetitive nature. The PE and PPE families are typified
Directory of Open Access Journals (Sweden)
Mohd eKhubaib
2016-05-01
Full Text Available PE/PPE genes, present in cluster with ESAT-6 like genes, are suspected to have a role in antigenic variation and virulence of Mycobacterium tuberculosis. Their roles in immune evasion and immune modulation of host are also well documented. We present evidence that PE32/PPE65 present within the RD8 region are co-operonic, co-transcribed and co-translated, and play role in modulating host immune responses. Experiments with macrophage cell lines revealed that this protein complex suppresses pro-inflammatory cytokines such as TNF-α and IL-6 whereas also inducing high expression of anti-inflammatory IL-10. Immunization of mice with these recombinant proteins dampens an effective Th1 response as evident from reduced frequency of IFN-g and IL-2 producing CD4+ and CD8+ T cells. IgG sub-typing from serum of immunized mice revealed high levels of IgG1 when compared with IgG2a and IgG2b. Further IgG1/IgG2a ratio clearly demonstrated that the protein complex manipulates the host immune response favourable to the pathogen. Our results demonstrate that the co-transcribed and co-translated PE32 and PPE65 antigens are involved specifically in modulating anti-mycobacterial host immune response by hampering Th1 response.
Consorti, Fabrizio; Mancuso, Rosaria; Piccolo, Annalisa; Consorti, Giacomo; Zurlo, Joseph
2013-08-22
Peer physical examination (PPE) is a method of training in medical and osteopathic curricula. The aim of this study was to compare the acceptability of PPE in two classes of medical and osteopathic students after their first experience, to obtain comparative information useful for an understanding of the different professional approaches. The leading hypothesis was that osteopathic students enter the curriculum with a more positive attitude to bodily contact.As a secondary aim, this study validated the new version of a questionnaire to assess the acceptability of PPE. A new version of a previously validated questionnaire and an instrument from the literature (the Examining Fellow Student [EFS] questionnaire) were used for a cross-sectional survey in a class of 129 3rd year medical students and in two parallel classes of 1st year osteopathic students (total of 112 students). The mean score of the new questionnaire was significantly higher for the osteopathic students than for the medical students (53.4 ± 6.3 vs. 43.4 ± 8.9; p student. The EFS mean score also showed a significant difference between the osteopathic and medical students (30.76 ± 2.9 vs. 27.85 ± 4.3; p accounting for 62.8% of the variance. Criterion validity was assessed by correlation with the EFS (Pearson's r coefficient = 0.61). Reliability was expressed in terms of Cronbach's alpha coefficient, which equals 0.86. These quantitative results are consistent with previous qualitative research on the process of embodiment both in medicine and osteopathy. The new questionnaire proved to be valid and reliable. The objective assessment of the acceptability of PPE is a way to determine differences in students' attitudes towards contact with the body and can be used for counselling students regarding career choice. This study can also highlight differences between students from different professions and serve as a basis for reflection for improved mutual interprofessional understanding and future
International Nuclear Information System (INIS)
2015-01-01
After a discussion on the whole project of energy multi-year programming (PPE), a first document more particularly discusses issues related to the management of energy demand, to the security of supply (for the electric power sector, the gas sector, the gas/power sector), and to the development of infrastructures and flexibility for the power system. The issue of energy supply is then addressed. Then, the authors discuss some statements present in various appendices to the PPE: its legal framework with its articulation to other planning documents, its energy hypotheses (for buildings), its measures related to the preservation of consumer purchasing power and to that of company competitiveness, its definition of a maximum envelope of public funds dedicated to the achievement of PPE quantitative objectives, its assessment of needs of professional abilities in the field of energy and the adaptation of education and training to these needs, its strategic environmental assessment. Then, the committee discusses the content of the strategy of development of a clean mobility which has been elaborated as foreseen by the law on energy transition, and has been attached to the PPE project. A second document addresses some of these issues in the specific case of Corsica. It more particularly states recommendations on the PPE general framework, on objectives related to energy demand, on objectives related to security of supply, on energy supply, on energy infrastructures, on the elaboration and consultation process, on economic assessment, on social assessment, on environmental assessment, and on the follow-up of the Corsica PPE. Some propositions are finally made by the committee at the attention of writers of the Corsica PPE
Directory of Open Access Journals (Sweden)
Min Keun Kim
2017-06-01
Full Text Available RcsA is a positive activator of extracellular polysaccharide (EPS synthesis in the Enterobacteriaceae. The rcsA gene of the soft rot pathogen Pantoea sp. strain PPE7 in Pleurotus eryngii was cloned by PCR amplification, and its role in EPS synthesis and virulence was investigated. The RcsA protein contains 3 highly conserved domains, and the C-terminal end of the open reading frame shared significant amino acid homology to the helix-turn-helix DNA binding motif of bacterial activator proteins. The inactivation of rcsA by insertional mutagenesis created mutants that had decreased production of EPS compared to the wild-type strain and abolished the virulence of Pantoea sp. strain PPE7 in P. eryngii. The Pantoea sp. strain PPE7 rcsA gene was shown to strongly affect the formation of the disease symptoms of a mushroom pathogen and to act as the virulence factor to cause soft rot disease in P. eryngii.
Czech Academy of Sciences Publication Activity Database
Jadhav, R.; Türk, S.; Kühnlenz, F.; Cimrová, Věra; Rathgeber, S.; Egbe, D. A. M.; Hoppe, H.
2009-01-01
Roč. 206, č. 12 (2009), s. 2695-2699 ISSN 1862-6300 R&D Projects: GA MŠk(CZ) 1M06031 Institutional research plan: CEZ:AV0Z40500505 Keywords : PPE-PPV copolymers * solar cells Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.228, year: 2009
Koff, Tiiu, 1955-
2005-01-01
14. juunil 2005. a. kaitses Mihkel Kangur Tallinna Ülikoolis väitekirja teemal "Häiringute ja taimkatte mosaiiksuse kajastumine järvesetete õietolmu ja söeosakeste profiilidel" ("Disturbances and vegetation patchiness reflected in pollen and charcoal profiles from lacustrine sediments")
Czech Academy of Sciences Publication Activity Database
Tinti, F.; Sabir, F. K.; Gazzano, M.; Righi, S.; Ulbricht, C.; Usluer, Ö.; Pokorná, Veronika; Cimrová, Věra; Yohannes, T.; Egbe, D. A. M.; Camaioni, N.
2013-01-01
Roč. 3, č. 19 (2013), s. 6972-6980 ISSN 2046-2069 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : anthracene-containing PPE-PPV copolymer * macromolecular parameters * structural and transport properties Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.708, year: 2013
Directory of Open Access Journals (Sweden)
Abayomi Samuel Oyekale
2018-02-01
Full Text Available The inability of farmers to comply with essential precautions in the course of spraying agrochemicals remains a policy dilemma, especially in developing countries. The objectives of this paper were to assess compliance of cocoa farmers with agrochemical safety measures, analyse the factors explaining involvement of cocoa farmers in the practice of reusing agrochemical containers and wearing of personal protective equipment (PPE. Data were collected with structured questionnaires from 667 cocoa farmers from the Centre and South West regions in Cameroon. Data analyses were carried out with Probit regression and Negative Binomial regression models. The results showed that average cocoa farm sizes were 3.55 ha and 2.82 ha in South West and Centre regions, respectively, and 89.80% and 42.64% complied with manufacturers’ instructions in the use of insecticides. Eating or drinking while spraying insecticides and fungicides was reported by 4.20% and 5.10% of all farmers in the two regions, respectively. However, 37.78% and 57.57% of all farmers wore hand gloves and safety boots while spraying insecticides in the South West and Centre regions of Cameroon, respectively. In addition, 7.80% of all the farmers would wash agrochemical containers and use them at home, while 42.43% would wash and use them on their farms. Probit regression results showed that probability of reusing agrochemical containers was significantly influenced (p < 0.05 by region of residence of cocoa farmers, gender, possession of formal education and farming as primary occupation. The Negative Binomial regression results showed that the log of number PPE worn was significantly influenced (p < 0.10 by region, marital status, attainment of formal education, good health, awareness of manufacturers’ instructions, land area and contact index. It was among others concluded that efforts to train farmers on the need to be familiar with manufacturers’ instructions and use PPE would enhance
Directory of Open Access Journals (Sweden)
Athena K. Ramos
2016-11-01
Full Text Available Hog production in the United States is a large industry that has seen dramatic changes over the last few decades. Concentrated animal feeding operations (CAFOs are growing in number throughout the country. This pilot study explores the perception of risk, receipt of work-related training, provision and usage of personal protective equipment (PPE, and prevention preferences of Latino immigrant hog CAFO workers in Missouri. Forty workers (M age = 36.08 years, SD = 10.04; 92.5% male; 70.0% Mexican were interviewed. Results indicate that most workers did not perceive their job as dangerous. Limited English proficient workers were significantly less likely to report receiving any work-related training. Although most workers had access to employer provided PPE, usage was inconsistent. As the demographic composition of the farmworker population in the Midwest becomes increasingly comprised of hired immigrant workers, it will be imperative to develop occupational safety and health educational and outreach efforts focused on the needs of these workers.
Ramos, Athena K; Fuentes, Axel; Trinidad, Natalia
2016-01-01
Hog production in the United States is a large industry that has seen dramatic changes over the last few decades. Concentrated animal feeding operations (CAFOs) are growing in number throughout the country. This pilot study explores the perception of risk, receipt of work-related training, provision and usage of personal protective equipment (PPE), and prevention preferences of Latino immigrant hog CAFO workers in Missouri. Forty workers (M age = 36.08 years, SD = 10.04; 92.5% male; 70.0% Mexican) were interviewed. Results indicate that most workers did not perceive their job as dangerous. Limited English proficient workers were significantly less likely to report receiving any work-related training. Although most workers had access to employer provided PPE, usage was inconsistent. As the demographic composition of the farmworker population in the Midwest becomes increasingly comprised of hired immigrant workers, it will be imperative to develop occupational safety and health educational and outreach efforts focused on the needs of these workers.
Chemical sensing underclothing system for testing PPE
International Nuclear Information System (INIS)
Slabotinsky, J.; Kralik, L.; Bradka, S.; Castulik, P.
2009-01-01
Personal protective equipment (PPE) when worn is subjected to pressure differentials across the garment due to ambient wind flow, by body movement and breathing creating the bellows effect, which may force hazardous chemicals vapor or aerosol through the closures, joints, outlet valves and/or clothing protective fabric. Thus the design, fit, size or improper donning of the protective garment will influence chemical-agent penetration. In order to determine penetration of chemical-protective garments by chemical vapor or aerosol, it is necessary to test the entire suit system, including seams, closures, outlet valves and areas of transition with other protective equipment, that is, at the ankles, waist, wrists, neck etc. In order to identify penetration of chemical vapor or aerosol through protective assembly, the Man-in-Simulant Test (MIST) with passive adsorptive devices (PADs) is used, when adsorbed challenging agent (simulant) is desorbed from the PAD and quantified. The current MIST method is failing in complexity of leak detection, due to limited number of passive collection points fixed on human body or a mannequin and very labor extensive work associated with allocation of 20-40 PADs and quantification of adsorbed agent. The Czech approach to detect and quantify penetration/permeation of chemical agent is based on chemical sensing underclothing enable to change the color when exposed with simulant or even with real CW agent. Color intensity and shape of stains on sensing fabric are processed with Laboratory Universal Computer Image Analysis (LUCIA) allowing determining the quantity and the allocation of the penetrating noxious agent(s). This method allows for example calculate individual doses of exposure, the breakthrough coefficient of protective garment as whole and uniquely precise allocation of penetration/permeation shortfalls. Presentation is providing detailed description of imaging system with nickname 'LUCY' in combination with testing mannequin
Directory of Open Access Journals (Sweden)
Corinne A. Basinger
2015-01-01
Full Text Available A substituted fullerene was incorporated into a PPE-conjugated polymer repeat unit. This subunit was then polymerized via Sonogashira coupling with other repeat units to create polymeric systems approaching 50 repeat units (based on GPC characterization. Bipyridine ligands were incorporated into some of these repeat units to provide sites for transition metal coordination. Photophysical characterization of the absorption and emission properties of these systems shows excited states located on both the fullerene and aromatic backbone of the polymers that exist in a thermally controlled equilibrium. Future work will explore other substituted polyaromatic systems using similar methodologies.
Silva, Paula Renata Alves da; Simões-Araújo, Jean Luiz; Vidal, Márcia Soares; Cruz, Leonardo Magalhães; Souza, Emanuel Maltempi de; Baldani, José Ivo
Paraburkholderia tropica (syn Burkholderia tropica) are nitrogen-fixing bacteria commonly found in sugarcane. The Paraburkholderia tropica strain Ppe8 is part of the sugarcane inoculant consortium that has a beneficial effect on yield. Here, we report a draft genome sequence of this strain elucidating the mechanisms involved in its interaction mainly with Poaceae. A genome size of approximately 8.75Mb containing 7844 protein coding genes distributed in 526 subsystems was de novo assembled with ABySS and annotated by RAST. Genes related to the nitrogen fixation process, the secretion systems (I, II, III, IV, and VI), and related to a variety of metabolic traits, such as metabolism of carbohydrates, amino acids, vitamins, and proteins, were detected, suggesting a broad metabolic capacity and possible adaptation to plant association. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
da Silva, Paula Renata Alves; Vidal, Marcia Soares; de Paula Soares, Cleiton; Polese, Valéria; Simões-Araújo, Jean Luís; Baldani, José Ivo
2016-11-01
Among the members of the genus Burkholderia, Burkholderia tropica has the ability to fix nitrogen and promote sugarcane plant growth as well as act as a biological control agent. There is little information about how this bacterium metabolizes carbohydrates as well as those carbon sources found in the sugarcane juice that accumulates in stems during plant growth. Reverse transcription quantitative PCR (RT-qPCR) can be used to evaluate changes in gene expression during bacterial growth on different carbon sources. Here we tested the expression of six reference genes, lpxC, gyrB, recA, rpoA, rpoB, and rpoD, when cells were grown with glucose, fructose, sucrose, mannitol, aconitic acid, and sugarcane juice as carbon sources. The lpxC, gyrB, and recA were selected as the most stable reference genes based on geNorm and NormFinder software analyses. Validation of these three reference genes during strain Ppe8 growth on the same carbon sources showed that genes involved in glycogen biosynthesis (glgA, glgB, glgC) and trehalose biosynthesis (treY and treZ) were highly expressed when Ppe8 was grown in aconitic acid relative to other carbon sources, while otsA expression (trehalose biosynthesis) was reduced with all carbon sources. In addition, the expression level of the ORF_6066 (gluconolactonase) gene was reduced on sugarcane juice. The results confirmed the stability of the three selected reference genes (lpxC, gyrB, and recA) during the RT-qPCR and also their robustness by evaluating the relative expression of genes involved in glycogen and trehalose biosynthesis when strain Ppe8 was grown on different carbon sources and sugarcane juice.
Kim, Ahreum; Hur, Yun-Gyoung; Gu, Sunwha; Cho, Sang-Nae
2017-11-01
The aim of this study was to evaluate the protective efficacy of MTBK_24820, a complete form of PPE39 protein derived from a predominant Beijing/K strain of Mycobacterium tuberculosis in South Korea. Mice were immunized with MTKB_24820, M. bovis Bacilli Calmette-Guérin (BCG), or adjuvant prior to a high-dosed Beijing/K strain aerosol infection. After 4 and 9 weeks, bacterial loads were determined and histopathologic and immunologic features in the lungs and spleens of the M. tuberculosis -infected mice were analyzed. Putative immunogenic T-cell epitopes were examined using synthetic overlapping peptides. Successful immunization of MTBK_24820 in mice was confirmed by increased IgG responses ( P tuberculosis Beijing/K-strain is frequently isolated from TB patients. Copyright © 2017 American Society for Microbiology.
Yu, Zhaoxiao; Zhang, Chenhui; Zhou, Mingliang; Li, Qiming; Li, Hui; Duan, Wei; Li, Xue; Feng, Yonghong; Xie, Jianping
2017-09-01
Tuberculosis (TB), caused by Mycobacterium tuberculosis, remains a formidable threat to global public health. The successful intracellular persistence of M. tuberculosis significantly contributes to the intractability of tuberculosis. Proline-glutamic acid (PE) and proline-proline-glutamic acid (PPE) are mycobacterial exclusive protein families that widely reported to be involved in the bacterial virulence, physiology and interaction with host. Rv2770c (PPE44), a predicted virulence factor, was up-regulated upon the infected guinea pig lungs. To investigate the role of Rv2770c, we heterologously expressed the PPE44 in the nonpathogenic fast-growing M. smegmatis strain. Subcellular location analysis demonstrated that Rv2770c is a cell wall associated protein, suggestive of a potential candidate involved in host-pathogen interaction. The Rv2770c can enhance M. smegmatis survival within macrophages and under stresses such as H 2 O 2 , SDS, diamide exposure, and low pH condition. M. smegmatis expressing Rv2770c is more virulent as testified by the increased death of macrophages and the increased expression of interlukin-6 (IL-6) and interlukin-12p40 (IL-12p40). Moreover, Rv2770c altered the secretion of IL-6 and IL-12p40 of macrophages via NF-κB, ERK1/2 and p38 MAPK axis. Taken together, this study implicated that Rv2770c was a virulent factor actively engaged in the interaction with host macrophage. Copyright © 2017. Published by Elsevier B.V.
Evaluation of chosen determinants of the positive practice environments (PPE at Polish nursing wards
Directory of Open Access Journals (Sweden)
Dorota Kilańska
2016-04-01
Full Text Available Background: At many Polish hospitals, insufficient attention is given to positive work environment. In many cases nurses, similarly to the representatives of other professional groups, are not provided with facilities or tools to perform their professional tasks in safe conditions. The aspects of recruitment and retention of employees are often ignored. The aim of this study has been to assess the chosen determinants of work environment of nurses in Poland using the concept of the Positive Practice Environments (PPE. Material and Methods: The survey was carried out from 2008 to 2011 among 1049 nursing students of 3 randomly selected public medical universities that provided nursing education at the graduate level of the Master of Science. All the people qualified for the study group were practising nurses or midwives. The Polish Nursing Association coordinated the project, obtained the tool, translated it and adjusted it to the Polish conditions. The areas covered in the survey were: a place of employment, selected physical and social elements influencing the work conditions, and biographical information. Results: Access to as many as 8 factors identified as attributes of friendly environments was found unsatisfactory by over 50% of the nurses. For the purpose of objective assessment, the results were compared with the results obtained in the group of nurses in England. Conclusions: The majority of the surveyed nurses were not satisfied with their work environments. Polish nurse managers should ensure that aspects of recognized attributes of friendly, positive practice environments for nurses are established to support nurses’ satisfaction as a pre-condition for patients’ safety. Med Pr 2016;67(1:11–19
Oyekale, Abayomi Samuel
2018-02-13
The inability of farmers to comply with essential precautions in the course of spraying agrochemicals remains a policy dilemma, especially in developing countries. The objectives of this paper were to assess compliance of cocoa farmers with agrochemical safety measures, analyse the factors explaining involvement of cocoa farmers in the practice of reusing agrochemical containers and wearing of personal protective equipment (PPE). Data were collected with structured questionnaires from 667 cocoa farmers from the Centre and South West regions in Cameroon. Data analyses were carried out with Probit regression and Negative Binomial regression models. The results showed that average cocoa farm sizes were 3.55 ha and 2.82 ha in South West and Centre regions, respectively, and 89.80% and 42.64% complied with manufacturers' instructions in the use of insecticides. Eating or drinking while spraying insecticides and fungicides was reported by 4.20% and 5.10% of all farmers in the two regions, respectively. However, 37.78% and 57.57% of all farmers wore hand gloves and safety boots while spraying insecticides in the South West and Centre regions of Cameroon, respectively. In addition, 7.80% of all the farmers would wash agrochemical containers and use them at home, while 42.43% would wash and use them on their farms. Probit regression results showed that probability of reusing agrochemical containers was significantly influenced ( p agrochemicals.
2018-01-01
The inability of farmers to comply with essential precautions in the course of spraying agrochemicals remains a policy dilemma, especially in developing countries. The objectives of this paper were to assess compliance of cocoa farmers with agrochemical safety measures, analyse the factors explaining involvement of cocoa farmers in the practice of reusing agrochemical containers and wearing of personal protective equipment (PPE). Data were collected with structured questionnaires from 667 cocoa farmers from the Centre and South West regions in Cameroon. Data analyses were carried out with Probit regression and Negative Binomial regression models. The results showed that average cocoa farm sizes were 3.55 ha and 2.82 ha in South West and Centre regions, respectively, and 89.80% and 42.64% complied with manufacturers’ instructions in the use of insecticides. Eating or drinking while spraying insecticides and fungicides was reported by 4.20% and 5.10% of all farmers in the two regions, respectively. However, 37.78% and 57.57% of all farmers wore hand gloves and safety boots while spraying insecticides in the South West and Centre regions of Cameroon, respectively. In addition, 7.80% of all the farmers would wash agrochemical containers and use them at home, while 42.43% would wash and use them on their farms. Probit regression results showed that probability of reusing agrochemical containers was significantly influenced (p agrochemicals. PMID:29438333
Kleber, C; Buschmann, C T
2013-06-01
Periportal edema (PPE) of the liver in multislice computed tomography (MS-CT) scans that develops immediately (primary PPE [pPPE]) or later (secondary PPE [sPPE]) is not uncommon in severe trauma patients. Although PPE may serve as a marker for blunt abdominal trauma (22-31 % of cases), distinct causes and clinical implications of PPE are unclear. We analyzed the incidence of pPPE and sPPE in 68 MS-CT scans in severe trauma patients (2007-2009). Exclusion criteria were severely burned patients and patients with preexistent liver diseases predisposing to PPE. We divided PPE+ patients into two subpopulations-either initial/primary PPE (pPPE+) or later/secondary PPE (sPPE+). Further patient data were collected and statistically analyzed. PPE+ was found in 27.9 % (n = 19). Females predominated (p = 0.01), and PPE+ patients presented with a significantly better pH at admission (p = 0.008). The total amount of volume resuscitation (1,983 ± 1,155 ml; p = 0.02) and crystalloids (1,117 ± 796 ml; p = 0.006) administered before MS-CT scans was significantly higher in PPE+, whereas the amount of administered colloids (797 ± 640 ml) showed no significant difference in both groups. PPE+ was not associated with further patient data, i.e., trauma mechanism, injury severity, prognosis-relevant factors, adverse clinical events, or mortality. pPPE+ in MS-CT may serve as a surrogate parameter for intravenous volume load and/or venous congestion, and sPPE+ may also indicate venous congestion and right heart failure after severe trauma. In severe trauma patients with pPPE+/sPPE+ in MS-CT scans, causes of PPE relating to intravenous fluid overload and/or venous congestion should be excluded or treated.
Directory of Open Access Journals (Sweden)
Marilia Cavalli de Oliveira
2016-12-01
Full Text Available Objetivo: verificar o efeito das duas primeiras fases do protocolo de cinesioterapia E.P.P na função dos MAP, na sintomatologia da IU e na qualidade de vida de mulheres incontinentes usuárias, da rede pública de saúde. Materiais e Métodos: estudo piloto quasi-experimental. Sete participantes foram avaliadas por meio de questionário onde responderam questões relativas a situação de perda urinária, uso de absorventes e número de trocas desses por dia, bem como ao questionário de qualidade de vida King’s Health Questionnaire. A avaliação funcional dos MAP foi realizada de acordo com o esquema PERFECT. A aplicação do protocolo E.P.P. consistiu em 10 sessões de 1 hora e 30 minutos cada, semanalmente. Resultados: Após as duas primeiras etapas do protocolo E.P.P., houve melhora significativa na força de contração (p=0,034, na manutenção da contração (p=0,039 e no número de contrações rápidas (p=0,043 dos MAP. Adicionalmente, as mulheres relataram não perder mais urina nas situações de subir escadas, ginástica, dança e durante a relação sexual. Conclusão: as duas primeiras fases da proposta E.P.P. demonstraram efeitos positivos na função muscular dos MAP, e uma tendência na melhora dos sintomas das mulheres incontinentes. Objective: to verify the effect of the first two phases of the P.P.E kinesiotherapy in the PFM function, in the symptoms of UI and in the quality-of-life in incontinent women who are users of the Public Health Network. Materials and Methods: a quasi-experimental pilot study. Seven participants were evaluated through a questionnaire containing questions concerning the situation of urine leakage, absorbent usage and number of exchanges of these per day, as well as King's Health Questionnaire to assess the quality of life. The functional evaluation of PFM was carried out according to the PERFECT scheme. The P.P.E. protocol was applied in 10 sessions, once a week, with duration of 1 hour and 30
Use of protective equipment by adolescents in inline skating, skateboarding, and snowboarding.
Kroncke, Erica L; Niedfeldt, Mark W; Young, Craig C
2008-01-01
Determine the frequency of personal protective equipment (PPE) use in adolescent inline skaters, skateboarders, and snowboarders; explore factors influencing PPE use; identify factors that would influence use; and examine the association of high-risk behaviors and PPE use. Cross-sectional survey. Central/southeast Wisconsin. Participants 13-18 years-old. None. Independent variables = age, gender, sport. None. Dependent variables = PPE use, factors influencing use, and frequency of other high-risk behaviors. The mean age of 333 participiants was 14.9 years. Adolescents wore considerably less PPE than recommended. Inline skaters wore the most; snowboarders the least. The most common reasons adolescents wore PPE were parents, peers, and rule/requirement. Younger adolescents cited parents more often than older adolescents as a factor for PPE use. Discomfort and lack of perceived need were the most common reasons for nonuse. Sustaining/witnessing an accident was the most common reason that would convince adolescents to wear PPE. Almost half of adolescents reported nothing would convince them to wear PPE. Younger adolescents wore more PPE than older adolescents. An association was seen between PPE use in all sports and bicycle helmets. An inverse relationship was found for tobacco and helmet use among skaters, as well as alcohol and helmet use in skateboarders. Adolescents underuse PPE. PPE reinforcement by parents/peers, encouraging bike helmets, manufacturing more comfortable gear, educating adolescents, and instituting PPE requirements in public areas may increase compliance. This could lead to decreased injuries. Physicians should discuss PPE with their patients/families. There may be an association between PPE use in extreme sports and decreased high-risk health behaviors.
Honda, Hitoshi; Iwata, Kentaro
2016-08-01
Personal protective equipment (PPE) protects healthcare workers (HCWs) from infection by highly virulent pathogens via exposure to body fluids and respiratory droplets. Given the recent outbreaks of contagious infectious diseases worldwide, including Ebola virus and Middle Eastern respiratory syndrome, there is urgent need for further research to determine optimal PPE use in high-risk settings. This review intends to provide a general understanding of PPE and to provide guidelines for appropriate use based on current evidence. Although previous studies have focused on the efficacy of PPE in preventing transmission of pathogens, recent studies have examined the dangers to HCWs during removal of PPE when risk of contamination is highest. Access to adequate PPE supplies is crucial to preventing transmission of pathogens, especially in resource-limited settings. Adherence to appropriate PPE use is a challenge due to inadequate education on its usage, technical difficulties, and tolerability of PPE in the workplace. Future projects aim at ameliorating this situation, including redesigning PPE which is crucial to improving the safety of HCWs. PPE remains the most important strategy for protecting HCW from potentially fatal pathogens. Further research into optimal PPE design and use to improve the safety of HCWs is urgently needed.
Núñez-Rojas, Edgar; Aguilar-Pineda, Jorge Alberto; Pérez de la Luz, Alexander; de Jesús González, Edith Nadir; Alejandre, José
2018-02-08
The transferable potential for a phase equilibria force field in its united-atom version, TraPPE_UA, is evaluated for 41 polar liquids that include alcohols, thiols, ethers, sulfides, aldehydes, ketones, and esters to determine its ability to reproduce experimental properties that were not included in the parametrization procedure. The intermolecular force field parameters for pure components were fit to reproduce experimental boiling temperature, vapor-liquid coexisting densities, and critical point (temperature, density, and pressure) using Monte Carlo simulations in different ensembles. The properties calculated in this work are liquid density, heat of vaporization, dielectric constant, surface tension, volumetric expansion coefficient, and isothermal compressibility. Molecular dynamics simulations were performed in the gas and liquid phases, and also at the liquid-vapor interface. We found that relative error between calculated and experimental data is 1.2% for density, 6% for heat of vaporization, and 6.2% for surface tension, in good agreement with the experimental data. The dielectric constant is systematically underestimated, and the relative error is 37%. Evaluating the performance of the force field to reproduce the volumetric expansion coefficient and isothermal compressibility requires more experimental data.
Institute of Scientific and Technical Information of China (English)
曹玉珊
2012-01-01
Working capital management is one of big three financial management activities along with longterm investment decision and long-term financing management. Current researches are mainly focus on operating activities to discuss management efficiency of operating working capital and few pay attention to strategic working capital management. It can be said that working capital management involves strategic management requirement. Based on such requirement, working capital management can be divided into three correlated subsidiary problems. The first is to use suitable ratios, such as the current ratio, acid-test ratio and liquidity ratio to judge whether the working capital policy is conservative or not; The second is to manage the channel of working capital financing, including short-term resource ( current liability), long-term source ( long-term liability plus owner' s equity) and savings from long-term investment; The third is to apply strategic performance assessment, which contains profit margin (ROS), return on asset (ROA) and return on equity (ROE) to assess the efficiency of working capital management. As a behavior of strategic management, the Private Placement of Equity (PPE) would affect working capital management deeply. On the other hand, the outbreak and spread of financial crisis in 2006 has a great influence on enviromnent for working capital management. As a result, Chinese corporations regard the private placement of equity (PPE) as the first choice to solve cash reflow problems. On account of theoretical relation and current background, this paper probes evidences based on data from China' s listed companies which used PPE for financing in 2007. Hypotheses relate to those three subsidiary problems of working capital management: Hl is about whether the working capital policy in firms which finance by PPE is conservative or not; H2 is about whether PPE will affect other sources of working capital or not and how it
NCBI nr-aa BLAST: CBRC-CJAC-01-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0074 ref|YP_177850.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283249.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||E70808 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55441.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73687.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177850.1 0.001 26% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0949 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0949 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 2e-07 25% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0908 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0908 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 7e-10 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1001 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 2e-08 27% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0381 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0381 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 3e-08 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1255 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1255 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 3e-19 27% ...
NCBI nr-aa BLAST: CBRC-GGAL-35-0335 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0335 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 5e-16 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0774 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0774 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 1e-12 25% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1306 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1306 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 4e-15 30% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0299 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0299 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 4e-18 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1056 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 4e-12 27% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0354 ref|YP_177830.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] ref|YP_001283075.1| PPE family protein [Mycobacterium tuberculosis H37Ra] pir||B70987 probable PPE protein - Mycobacterium tube...rculosis (strain H37RV) emb|CAE55416.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] gb|ABQ73513.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_177830.1 2e-11 28% ...
Rubenstein, Eric; Shendell, Derek; Eggert, Brain C; Marcella, Stephen W
2014-01-01
Students with special health care needs (SHCNs) and individualized education plans (IEPs) may be injured more often in vocational, career, and technical education (CTE) programs. No research to date considers personal protective equipment (PPE) use among students with SHCNs in school-based programs reporting injuries to agencies. Data from 1999 to 2011 on PPE use among injured students in CTE programs in public schools and private secondary schools for the disabled were analyzed; students with SHCNs were distinguished by IEP status within New Jersey Safe Schools surveilance data. Among students with IEPs using PPE, 36% of injuries occurred to body parts PPE was meant to protect. Likely injury types were cuts-lacerations and burns for students with IEPs using PPE and cuts-lacerations and sprains for students with IEPs not using PPE. Females with IEPs using PPE were injured less often than males across ages. Results suggested students with SHCNs with IEPs need further job-related training with increased emphasis on properly selecting and fitting PPE.
Rajabi, M; Rouzbehan, Y; Rezaei, J
2017-01-01
Dietary natural plant secondary metabolites (PSM) extracted from a pomegranate peel (PP) byproduct have the potential to improve milk yield and the milk fatty acid profile of dairy cows. This experiment was performed to assess the influence of different dietary levels of PP extract (PPE) on feedlot performance, ruminal status, nutrient utilization, and antioxidant status in fattening Moghani lambs. Thirty-two lambs (initial BW of 22 ± 1.2 kg) were used in a completely randomized design with a 72-d period and 4 treatments: PPE0 (no extract), PPE15 (15 mL PPE/kg of diet DM), PPE30 (30 mL PPE/kg of diet DM), and PPE45 (45 mL PPE/kg of diet DM). Feed intake, lamb growth, diet digestibility, microbial nitrogen (N) synthesis (MNS), N retention, rumen parameters, and blood metabolites were determined. The addition of PPE to the diet of lambs had no effect on DMI (linear [L], = 0.96; quadratic [Q], = 0.65). In vivo digestibility coefficients of DM, OM, CP, and Ash-free NDF were not affected (L, ≥ 0.28; Q, ≥ 0.26) by different levels of PPE, but it increased ADG (L, = 0.045; Q, = 0.19) and G:F (L, = 0.046; Q, = 0.20). Rumen pH, VFA concentrations, and acetate-to-propionate ratio were not affected (L, ≥ 0.14; Q, ≥ 0.23) by PPE supplementation. Dietary inclusion of PPE decreased the ruminal concentration of ammonia N (L, = 0.014; Q, = 0.67), total protozoa enumeration (L, concentrations of glucose, triglycerides, cholesterol, total protein, albumin, or albumin-to-globulin ratio. Blood urea N (L, = 0.021; Q, = 0.32) decreased with dietary addition of PPE, while total antioxidant capacity (TAC) in the rumen fluid (L, = 0.032; Q, = 0.64) and TAC in the blood (L, = 0.041; Q, = 0.51) increased. Overall, dietary inclusion of PPE, up to 45 mL/kg of diet DM, linearly improved animal growth, N retention, and antioxidant capacities of the blood and rumen fluid. The PPE is a safe natural additive for use in sheep diets that can help to reduce environmental pollution by reducing
NCBI nr-aa BLAST: CBRC-CJAC-01-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0074 ref|NP_336427.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] ref|YP_001287884.1| PPE family protein [Mycobacterium tuberculosis F11] gb|AAK46241.1| PPE family protein [Mycobacterium tube...rculosis CDC1551] gb|ABR06282.1| PPE family protein [Mycobacterium tuberculosis F11] NP_336427.1 0.001 26% ...
Porcine placenta mitigates protein-energy malnutrition-induced fatigue.
Han, Na-Ra; Kim, Kyu-Yeop; Kim, Myong-Jo; Kim, Min-Ho; Kim, Hyung-Min; Jeong, Hyun-Ja
2013-01-01
Fatigue can be caused by a deficiency of nutrition or immune function. The goal of this study was to identify the effects of porcine placenta extract (PPE) and its constituents, amino acids (glutamic acid, glycine, arginine, and proline), on protein-energy malnutrition (PEM)-induced fatigue. Mice were administered a PEM diet and came to immunodeficient status. Simultaneously, the mice were administered PPE or amino acids and a forced swimming test (FST) was performed. We analyzed the levels of fatigue-related factors in serum, splenocytes, and muscles. In the FST, PPE or amino acids significantly decreased immobility times compared with the PEM diet. PPE or amino acids also significantly decreased the serum levels of fatigue-related factors after the FST. Additionally, PPE significantly decreased the levels of fatigue-related muscle parameters after the FST. In this in vitro study, PPE increased the mRNA and protein expression of Ki-67 and promoted the proliferation of splenocytes. PPE or amino acids significantly increased the levels of intracellular calcium and the translocation into the nucleus of nuclear factor of activated T-cells cytoplasmic in stimulated splenocytes. PPE or amino acids significantly decreased the production of fatigue-related inflammatory cytokines in the stimulated splenocytes. Additionally, the translocated levels of nuclear factor-κB in the nucleus and the degradation of the inhibitory protein, IκBα, in the cytosol were inhibited by PPE or amino acids. These results demonstrate that PPE and its constituents regulate PEM-induced fatigue through improving levels of immunity and decreasing fatigue-related factors. PPE may be a potential agent for a recovery from fatigue. Copyright © 2013 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Kai Wang
2016-05-01
Full Text Available Propolis has abundant polyphenolic constituents and is used widely as a health/functional food. Here, we investigated the effects of polyphenol-rich propolis extracts (PPE on intestinal barrier function in human intestinal epithelial Caco-2 cells, as well as in rats. In Caco-2 cells, PPE increased transepithelial electrical resistance and decreased lucifer yellow flux. PPE-treated cells showed increased expression of the tight junction (TJ loci occludin and zona occludens (ZO-1. Confocal microscopy showed organized expressions in proteins related to TJ assembly, i.e., occludin and ZO-1, in response to PPE. Furthermore, PPE led to the activation of AMPK, ERK1/2, p38, and Akt. Using selective inhibitors, we found that the positive effects of PPE on barrier function were abolished in cells in which AMPK and ERK1/2 signaling were inhibited. Moreover, rats fed a diet supplemented with PPE (0.3% in the diet exhibited increased colonic epithelium ZO-1 expression. Overall, these data suggest that PPE strengthens intestinal barrier function by activating AMPK and ERK signaling and provide novel insights into the potential application of propolis for human gut health.
Zeng, Zhi; Lu, Liming; Rao, Zhanhong; Han, Lu; Shi, Jingrong; Ling, Li
2014-04-01
To investigate the current supply and use of personal protective equipment (PPE) among rural-to-urban migrant workers in small and medium enterprises (SMEs) in Zhongshan and Shenzhen, China and the influential factors for the use of PPE, and to provide a basis for better occupational health services and ensuring the health of migrant workers. Multi-stage sampling was used to select 856 migrant workers from 27 SMEs in Zhongshan and Shenzhen, and face-to-face questionnaire survey was conducted in these subjects. Statistical analysis was performed by one-way analysis of variance, chi-square test, and logistic regression. Of all migrant workers, 38.67%were supplied with free PPE by the factory, and this rate varied across industries (furniture industry: 45.81%; electronic industry: 31.46%) and SMEs (medium enterprises: 42.13%; small enterprises: 39.20%; micro enterprises: 22.16%); 22.43% insisted on the use of PPE. The logistic regression analysis showed that factors associated with the use of PPE included sex, age, awareness of occupational health knowledge, and the size of enterprise. The rates of supply and use of PPE among migrant workers are low. The larger the enterprise, the better the supply of PPE. Male gender, being elder, and high occupational health knowledge score were favorable factors for the use of PPE, while small enterprise size was the unfavorable factor for the use of PPE.
Lanzetti, Manuella; da Costa, Cristiane Aguiar; Nesi, Renata Tiscoski; Barroso, Marina Valente; Martins, Vanessa; Victoni, Tatiana; Lagente, Vincent; Pires, Karla Maria Pereira; e Silva, Patrícia Machado Rodrigues; Resende, Angela Castro; Porto, Luis Cristóvão; Benjamim, Cláudia Farias; Valença, Samuel Santos
2012-12-01
Our aim was to investigate the role of oxidative stress in elastase-induced pulmonary emphysema. C57BL/6 mice were subjected to pancreatic porcine elastase (PPE) instillation (0.05 or 0.5 U per mouse, i.t.) to induce pulmonary emphysema. Lungs were collected on days 7, 14, and 21 after PPE instillation. The control group was sham injected. Also, mice treated with 1% aminoguanidine (AMG) and inducible NO synthase (iNOS) knockout mice received 0.5 U PPE (i.t.), and lungs were analyzed 21 days after. We performed bronchoalveolar lavage, biochemical analyses of oxidative stress, and lung stereology and morphometry assays. Emphysema was observed histologically at 21 days after 0.5 U PPE treatment; tissues from these mice exhibited increased alveolar linear intercept and air-space volume density in comparison with the control group. TNF-α was elevated at 7 and 14 days after 0.5 U PPE treatment, concomitant with a reduction in the IL-10 levels at the same time points. Myeloperoxidase was elevated in all groups treated with 0.5 U PPE. Oxidative stress was observed during early stages of emphysema, with increased nitrite levels and malondialdehyde and superoxide dismutase activity at 7 days after 0.5 U PPE treatment. Glutathione peroxidase activity was increased in all groups treated with 0.5 U PPE. The emphysema was attenuated when iNOS was inhibited using 1% AMG and in iNOS knockout mice. Furthermore, proteolytic stimulation by PPE enhanced the expression of nitrotyrosine and iNOS, whereas the PPE+AMG group showed low expression of iNOS and nitrotyrosine. PPE stimulus also induced endothelial (e) NOS expression, whereas AMG reduced eNOS. Our results suggest that the oxidative and nitrosative stress pathways are triggered by nitric oxide production via iNOS expression in pulmonary emphysema. Copyright © 2012 Elsevier Inc. All rights reserved.
Promotion of alternative-sized personal protective equipment.
Flynn, Michael A; Keller, Brenna; DeLaney, Sheli C
2017-12-01
With more diversity in the workforce, companies are producing PPE such as hard hats, safety glasses, coveralls, foot protection, and safety harnesses for a larger range of body shapes and sizes. However, gray literature reports suggest that barriers exist to getting alternate sized PPE from the manufacturer to the workers who need it. The purpose of this study is to determine the extent to which alternative-sized PPE is marketed. A web-based review of seven major manufacturers of PPE was conducted to determine: (a) whether or not they offer alternative-sized products, (b) if these products are clearly labeled, and (c) if images used to display PPE are representative of a diverse workforce. Of the seven PPE manufacturers investigated, six had at least one product that was marketed as gender and/or size alternatives however, alternative sizes were more common for larger body types. Alternative-sized products rarely included size charts, and the models used to display PPE were overwhelmingly white males of average size. Despite the growing availability of alternative-sized PPE, it can be difficult to find these products, which suggests that they are rarely promoted or labeled as alternative-sized. Our study indicates that companies should expand their product lines and more aggressively market and promote these items. Guidance on how to properly fit their products would also be extremely helpful to the end-user. Manufacturers could improve the availability of alternative-sized PPE and increase their promotion of these products on their websites and in their catalogs. Individual companies and safety professionals may assist in this process by demonstrating demand for alternative-sized PPE. Published by Elsevier Ltd.
Whyle, Eleanor Beth; Olivier, Jill
2016-12-01
In low- and middle-income countries (LMICs), the private sector-including international donors, non-governmental organizations, for-profit providers and traditional healers-plays a significant role in health financing and delivery. The use of the private sector in furthering public health goals is increasingly common. By working with the private sector through public -: private engagement (PPE), states can harness private sector resources to further public health goals. PPE initiatives can take a variety of forms and understanding of these models is limited. This paper presents the results of a Campbell systematic literature review conducted to establish the types and the prevalence of PPE projects for health service delivery and financing in Southern Africa. PPE initiatives identified through the review were categorized according to a PPE typology. The review reveals that the full range of PPE models, eight distinct models, are utilized in the Southern African context. The distribution of the available evidence-including significant gaps in the literature-is discussed, and key considerations for researchers, implementers, and current and potential PPE partners are presented. It was found that the literature is disproportionately representative of PPE initiatives located in South Africa, and of those that involve for-profit partners and international donors. A significant gap in the literature identified through the study is the scarcity of information regarding the relationship between international donors and national governments. This information is key to strengthening these partnerships, improving partnership outcomes and capacitating recipient countries. The need for research that disaggregates PPE models and investigates PPE functioning in context is demonstrated. © The Author 2016. Published by Oxford University Press in association with The London School of Hygiene and Tropical Medicine. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Quality of care and investment in property, plant, and equipment in hospitals.
Levitt, S W
1994-02-01
This study explores the relationship between quality of care and investment in property, plant, and equipment (PPE) in hospitals. Hospitals' investment in PPE was derived from audited financial statements for the fiscal years 1984-1989. Peer Review Organization (PRO) Generic Quality Screen (GQS) reviews and confirmed failures between April 1989 and September 1990 were obtained from the Massachusetts PRO. Weighted least squares regression models used PRO GQS confirmed failure rates as the dependent variable, and investment in PPE as the key explanatory variable. Investment in PPE was standardized, summed by the hospital over the six years, and divided by the hospital's average number of beds in that period. The number of PRO reviewed cases with one or more GQS confirmed failures was divided by the total number of cases reviewed to create confirmed failure rates. Investment in PPE in Massachusetts hospitals is correlated with GQS confirmed failure rates. A financial variable, investment in PPE, predicts certain dimensions of quality of care in hospitals.
International Nuclear Information System (INIS)
Li, G.; Zhao, R.
2013-01-01
The pomegranate polyphenol extract (PPE) was a nutraceutical with good prospect in food and medicinal industry. But its poor oil solubility limits its application in hydrophilic system. In this study, by forming the complex with lecithin, the hydrophilic solubility of PPE could be significantly improved. The physicochemical properties of the complex were analyzed by ultraviolet-visible spectrometry (UV), infrared spectrometry (IR) and X-ray diffractometry (XRD). The result showed that PPE in the complex had been completely dispersed in the lecithin matrix, not forming a new compound. It was found that the DPPH radical scavenging activity and reducing power of the complex were inferior to that of PPE while the antioxidant activity of the complex in oil was superior to that of PPE. (author)
NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...
Nurses' Experiences in Safe Handling of Chemotherapeutic Agents: The Taiwan Case.
Chen, Hai-Chiao; Lu, Zxy-Yann Jane; Lee, Shu-Hui
2016-01-01
Nurses are the least compliant with the guidelines for use of personal protective equipment (PPE) among health professionals. While the literature regarding nurses not following the guidelines focuses on nonuse of PPE, the experiences of using PPE from nurses' perspectives have not been examined. The aim of this study was to explore the concerns of nurses regarding their decision to use or not to use PPE in the cultural context of Taiwan. An ethnographic design was used, and ethnographic interviews of 57 nurses working with chemotherapy for more than 2 years were conducted. The participating nurses were observed in 2 accredited medical centers with oncology care teams in Taiwan. The constant comparison method was applied for data analysis, and cultural themes were generated from all transcripts. Wearing PPE was identified as an obstacle to professional image and performance. Nurses transformed safety into efficiency and prioritized social roles over professional roles. Experienced nurses, as insiders, believed that they have gained clinical wisdom to avoid occupational exposure to chemotherapy toxicity. This study explored the characteristics of clinical wisdom regarding PPE use in the context of Taiwanese chemotherapy care. Perceived professional image, efficiency on the job, PPE cost, and hospital rules influenced the use or nonuse of PPE by oncology care nurses. Acceptable nurse-patient ratios and refraining from chemotherapy toxicity exposure for pregnant and breast-feeding women are advocated for policy making. The experiential expertise of nurses should be shared as credible evidence in developing guidelines.
Generalized 1D photopyroelectric technique for optical and thermal characterization of liquids
International Nuclear Information System (INIS)
Balderas-López, J A
2012-01-01
The analytical solution for the one-dimensional heat diffusion problem for a three-layer system, in the Beer–Lambert model for light absorption, is used for the implementation of a photopyroelectric (PPE) methodology for thermal and optical characterization of pigments in liquid solution, even for those ones potentially harmful to the pyroelectric sensor, taking the liquid sample's thickness as the only variable. Exponential decay of the PPE amplitude followed by a constant PPE phase for solutions at low pigment concentration, and exponential decay of the PPE amplitude but a linear decrease of the PPE phase for the concentrated ones are theoretically shown, allowing measurements of the optical absorption coefficient (at the wavelength used for the analysis) and the thermal diffusivity for the liquid sample, respectively. This PPE methodology was tested by measuring the thermal diffusivity of a concentrated solution of methylene blue in distilled water and the optical absorption coefficient, at two wavelengths (658 and 785 nm), of water solutions of copper sulfate at various concentrations. These optical parameters were used for measuring the molar absorption coefficient of this last pigment in water solution at these two wavelengths. This last optical property was also measured using a commercial spectrometer, finding very good agreement with the corresponding ones using this PPE technique. (paper)
Son, Su-Young; Lee, Joo-Young; Tochihara, Yutaka
2013-01-01
The purpose of the present study was to elucidate differences in actual work environments, mobility and satisfaction between firefighters wearing aluminized and non-aluminized personal protective equipment (PPE), and to suggest a proper standard test method for Japanese firefighters' PPE. A survey from two cities in Japan (City A: aluminized PPE; City B: non aluminized PPE) was undertaken. A total of 525 firefighters from City A and 757 from City B participated. Firefighters spent 22.5 min (City A) and 27.3 min (City B) on average firefighting with the full set of PPE in one incident, but the heat strain experienced among firefighters from City A was twice that of firefighters from City B (57.5% and 28.4%). Firefighters spent 65.9 min on one incident and 24.2 min for suppression of fire with the full set of PPE on average. The toughest task that caused physical strain in City A was 'stair climbing' and in City B was 'drawing up a hose filled with water'. The most restricted body region due to PPE was the knee for both groups. Evaluations revealed that the aluminized fire jacket had worse ventilation and mobility than the non-aluminized, while the non-aluminized one received with more unfavorable evaluations for water resistance and maintainability.
Risk by use of hearing protectors--expert programme supports SMEs in appropriate selection and use.
Liedtke, M
2005-01-01
Comprehensive protection by use of PPE against the hazards at work requires more than proper selection based on the protection level needed: The PPE user directive (Council Directive 89/656/EEC, Official Journal of the European Communities L 393, 30/12/1989 p.0018 - 0028) requires an assessment of personal protective equipment itself, which has to consider the risks which may be introduced by use of PPE or use of combinations of PPE. As an example risks which may be introduced by use of hearing protectors are described. Assistance in the assessment required by PPE user directive (Council Directive 89/656/EEC, Official Journal of the European Communities L 393, 30/12/1989 p. 0018 - 0028) and in selection and use of hearing protectors with regard to this assessment is presented.
Purple perilla extracts allay ER stress in lipid-laden macrophages.
Directory of Open Access Journals (Sweden)
Sin-Hye Park
Full Text Available There is a growing body of evidence that excess lipids, hypoxic stress and other inflammatory signals can stimulate endoplasmic reticulum (ER stress in metabolic diseases. However, the pathophysiological importance and the underlying mechanisms of this phenomenon remain unknown. The current study investigated that 50 ng/ml oxidized LDL promoted unfolded protein response (UPR and ER stress in J774A1 murine macrophages, which was blocked by extracts (PPE of purple Perilla frutescens, a plant of the mint family Lamiaceae. The ER stressor tunicamycin was employed as a positive control. Treating 1-10 µg/ml oxidized LDL for 24 h elicited lipotoxic apoptosis in macrophages with obvious nuclear condensation and DNA fragmentation, which was inhibited by PPE. Tunicamycin and oxidized LDL activated and induced the UPR components of activating transcription factor 6 and ER resident chaperone BiP/Grp78 in temporal manners and such effects were blocked by ≥5 µg/ml PPE. In addition, PPE suppressed the enhanced mRNA transcription and splicing of X-box binding protein 1 (XBP1 by tunicamycin and oxidized LDL. The protein induction and nuclear translocation of XBP1 were deterred in PPE-treated macrophages under ER stress. The induction of ATP-binding cassette transporter A1 (ABCA1, scavenger receptor-B1 (SR-B1 and intracellular adhesion molecule-1 (ICAM-1 was abolished by the ER stressor in activated macrophages. The protein induction of ABCA1 and ICAM1 but not SR-B1 was retrieved by adding 10 µg/ml PPE to cells. These results demonstrate that PPE inhibited lipotoxic apoptosis and demoted the induction and activation of UPR components in macrophages. PPE restored normal proteostasis in activated macrophages oxidized LDL. Therefore, PPE was a potent agent antagonizing macrophage ER stress due to lipotoxic signals associated with atherosclerosis.
Quality of care and investment in property, plant, and equipment in hospitals.
Levitt, S W
1994-01-01
OBJECTIVE. This study explores the relationship between quality of care and investment in property, plant, and equipment (PPE) in hospitals. DATA SOURCES. Hospitals' investment in PPE was derived from audited financial statements for the fiscal years 1984-1989. Peer Review Organization (PRO) Generic Quality Screen (GQS) reviews and confirmed failures between April 1989 and September 1990 were obtained from the Massachusetts PRO. STUDY DESIGN. Weighted least squares regression models used PRO GQS confirmed failure rates as the dependent variable, and investment in PPE as the key explanatory variable. DATA EXTRACTION. Investment in PPE was standardized, summed by the hospital over the six years, and divided by the hospital's average number of beds in that period. The number of PRO reviewed cases with one or more GQS confirmed failures was divided by the total number of cases reviewed to create confirmed failure rates. PRINCIPAL FINDINGS. Investment in PPE in Massachusetts hospitals is correlated with GQS confirmed failure rates. CONCLUSIONS. A financial variable, investment in PPE, predicts certain dimensions of quality of care in hospitals. PMID:8113054
Nett, Beth; Brosky, Joseph A; Velarde, Lynnuel; Pariser, David P; Boyce, David A
2010-02-01
Although it is common practice to administer pre-participation examinations (PPE) of athletes prior to training, there are no clearly established formats. Elements integral to the PPE fall within the scope of physical therapist practice, and are often categorized as a form of primary prevention for musculoskeletal disorders as defined in the Guide to Physical Therapist Practice. The purpose of this study is to describe the design and implementation of a PPE for a women's professional (gridiron) football team. The results and findings from this PPE provide one of the first musculoskeletal profiles and information about selected physical characteristics from members of a female professional football team. Players from the Kentucky Karma women's football team, a member of the National Women's Football League (NWFA), volunteered to participate in a PPE. Of twenty-five eligible team members, thirteen consented to participate. The PPE consisted of a health history questionnaire, a musculoskeletal screening, and a series of physical performance and agility tests. The players' average (± SD) age, height, weight, body mass index (BMI), and body fat percentage were 29.6 (± 5.6) yrs., 1.66 (± .05) m, 66.8 (± 12.6) kg, 24.1 (± 3.7), and 27.4 (± 6.6) %, respectively. Commonly reported injuries were similar to those reported in men's collegiate football. This is one of the first papers to report on a model PPE for a women's professional football team. Future research is needed to establish a standard PPE, recognize common injuries, and develop prevention strategies unique to women's professional football.
O'Brien, Catherine; Blanchard, Laurie A; Cadarette, Bruce S; Endrusick, Thomas L; Xu, Xiaojiang; Berglund, Larry G; Sawka, Michael N; Hoyt, Reed W
2011-10-01
Personal protective equipment (PPE) refers to clothing and equipment designed to protect individuals from chemical, biological, radiological, nuclear, and explosive hazards. The materials used to provide this protection may exacerbate thermal strain by limiting heat and water vapor transfer. Any new PPE must therefore be evaluated to ensure that it poses no greater thermal strain than the current standard for the same level of hazard protection. This review describes how such evaluations are typically conducted. Comprehensive evaluation of PPE begins with a biophysical assessment of materials using a guarded hot plate to determine the thermal characteristics (thermal resistance and water vapor permeability). These characteristics are then evaluated on a thermal manikin wearing the PPE, since thermal properties may change once the materials have been constructed into a garment. These data may be used in biomedical models to predict thermal strain under a variety of environmental and work conditions. When the biophysical data indicate that the evaporative resistance (ratio of permeability to insulation) is significantly better than the current standard, the PPE is evaluated through human testing in controlled laboratory conditions appropriate for the conditions under which the PPE would be used if fielded. Data from each phase of PPE evaluation are used in predictive models to determine user guidelines, such as maximal work time, work/rest cycles, and fluid intake requirements. By considering thermal stress early in the development process, health hazards related to temperature extremes can be mitigated while maintaining or improving the effectiveness of the PPE for protection from external hazards.
Torp, Steffen; Grøgaard, Jens B; Moen, Bente E; Bråtveit, Magne
2005-08-01
On the basis of the job demands-control-support model by Karasek and Theorell, we investigated how social and organizational factors influence workers' use of personal protective equipment (PPE). A cross-sectional study was performed among 1420 workers in 203 motor vehicle-repair garages. Multilevel modeling was performed to account for the hierarchical structure of the data. Social and management support correlated positively with PPE use at the worker level. Low demands measured at the garage level and having a health and safety management system at the garage also correlated with active use of PPE. An interaction effect between social support and garage-level demands was observed. In addition to health information and provision of PPE, focusing on social and organizational factors seems necessary to get more workers to comply with the instructions on PPE use.
Directory of Open Access Journals (Sweden)
G. Olowojoba
2013-07-01
Full Text Available 4 wt% multiwalled carbon nanotubes (MWCNTs were incorporated into a miscible blend of polyphenylenether/polystyrene (PPE/PS on a twin-screw extruder at a screw speed of 600 rpm. The masterbatch obtained was diluted at 400 and 600 rpm to obtain lower MWCNT loadings in PPE/PS. Electron microscopy & optical microscopy images show very good MWCNT dispersion even at high filler loadings of 4 wt%, but slightly larger agglomerate size fractions are observable at higher screw speeds. While MWCNT addition enhanced the thermal stability of PPE/PS, a small change in glass transition was observed on the composites at different filler concentrations compared to PPE/PS. The specific heat capacity at glass transition decreases considerably until 2 wt% MWCNT and levels down thereafter for both processing conditions pointing to enhanced filler-matrix interaction at lower loadings. Storage modulus of the nanocomposites was enhanced significantly on MWCNT incorporation with reinforcing effect dropping considerably as a function of temperature, especially at lower filler contents. The modulus and the tensile strength of PPE/PS were only marginally enhanced in spite of excellent MWCNT dispersion in the matrix. Electrical percolation occurs at 0.4 wt% MWCNT content, and the electrical conductivity of 0.5 wt% MWCNT reinforced PPE/PS was close to 12 orders in magnitude higher compared to PPE/PS.
Kim, Yeon-Kye; Koo, Byung-Soo; Gong, Dae-Jong; Lee, Young-Choon; Ko, Jeong-Heon; Kim, Cheorl-Ho
2003-08-01
Prunus persica L. BATSCH seed-water extract (PPE) has been used in the treatment of the degenerative disorders, such as hypermenorrhea and dysmenorrhea, in Taiwan, China, Japan and Korea. In this study, the effects of oral administration of PPE on the extracellular acetylcholine concentration in the hippocampus of rats were evaluated, and compared to that of tacrine (9-amino-1,2,3,4-tetrahydroacridine hydrochloride), a well-known and centrally acting acetylcholinesterase (AChE) inhibitor, which had been developed for the treatment of Alzheimer's disease. We measured the inhibition of brain AChE. PPE at 2.5g/kg and tacrine at 5mg/kg showed significant effects for more than 6h. At these doses, the maximum increases were observed at about 1.5h after administration of PPE, and at about 2h with tacrine, and were 454 and 412% of the pre-level, respectively. The results suggest that oral administration of PPE and tacrine increases acetylcholine concentration in the synaptic cleft of the hippocampus mostly through AChE inhibition, and that PPE has a potent and long-lasting effect on the central cholinergic system.
Criaco, G. (Giuseppe); Sieger, P. (Philipp); Wennberg, K. (Karl); Chirico, F. (Francesco); Minola, T. (Tommaso)
2017-01-01
textabstractWe investigate how perceived parents’ performance in entrepreneurship (PPE) affects the entrepreneurial career intentions of offspring. We argue that while perceived PPE enhances offspring’s perceived entrepreneurial desirability and feasibility because of exposure mechanisms, it inhibits the translation of both desirability and feasibility perceptions into entrepreneurial career intentions due to upward social comparison mechanisms. Thus, perceived PPE acts as a double-edged swor...
2017-01-23
the Improved Outer Tactical Vest (IOTV) or Encumbered (ENC) which includes the PPE and Rifleman Ensemble, both of which are defined in the Seated...Personal Protective Equipment (PPE), Advanced Combat Uniform (ACU), Improved Outer Tactical Vest (IOTV) that included Enhanced Small Arms Protective...Improved Outer Tactical Vest MS Milestone NSRDEC Natick Soldier Research Development and Engineering Center OOH Out-of-Hatch PPE Personal Protective
The influence of students' gender on equity in Peer Physical Examination: a qualitative study.
Vnuk, Anna K; Wearn, Andy; Rees, Charlotte E
2017-08-01
Peer Physical Examination (PPE) is an educational tool used globally for learning early clinical skills and anatomy. In quantitative research, there are differences in students' preferences and actual participation in PPE by gender. This novel study qualitatively explores the effect that gender has on medical students' experiences of learning physical examination through PPE. We employ an interpretative approach to uncover the PPE experiences of students from a European, graduate-entry medical school. Volunteers participated in either individual or group interviews. The data were transcribed, de-identified and analysed using thematic analysis. There was evidence of gender inequity in PPE, with students describing significant imbalances in participation. Male students adopted roles that generated significant personal discomfort and led to fewer experiences as examiners. Assumptions were made by tutors and students about gender roles: male students' ready acceptance of exposure to be examined and female students' need to be protected from particular examinations. In contrast with the first assumption, male students did feel coerced or obliged to be examined. Students described their experiences of taking action to break down the gender barrier. Importantly, students reported that tutors played a role in perpetuating inequities. These findings, whilst relating to one university, have implications for all settings where PPE is used. Educators should be vigilant about gender issues and the effect that they may have on students' participation in PPE to ensure that students are not disadvantaged in their learning.
Enhancement of RNA synthesis by promoter duplication in tombusviruses
International Nuclear Information System (INIS)
Panavas, T.; Panaviene, Z.; Pogany, J.; Nagy, P.D.
2003-01-01
Replication of tombusviruses, small plus-strand RNA viruses of plants, is regulated by cis-acting elements present in the viral RNA. The role of cis-acting elements can be studied in vitro by using a partially purified RNA-dependent RNA polymerase (RdRp) preparation obtained from tombusvirus-infected plants , Virology 276, 279- 288). Here, we demonstrate that the minus-strand RNA of tombusviruses contains, in addition to the 3'-terminal minimal plus-strand initiation promoter, a second cis-acting element, termed the promoter proximal enhancer (PPE). The PPE element enhanced RNA synthesis by almost threefold from the adjacent minimal promoter in the in vitro assay. The sequence of the PPE element is 70% similar to the minimal promoter, suggesting that sequence duplication of the minimal promoter may have been the mechanism leading to the generation of the PPE. Consistent with this proposal, replacement of the PPE element with the minimal promoter, which resulted in a perfectly duplicated promoter region, preserved its enhancer-like function. In contrast, mutagenesis of the PPE element or its replacement with an artificial G/C-rich sequence abolished its stimulative effect on initiation of RNA synthesis in vitro. In vivo experiments are also consistent with the role of the PPE element in enhancement of tombusvirus replication. Sequence comparison of several tombusviruses and related carmoviruses further supports the finding that duplication of minimal promoter sequences may have been an important mechanism during the evolution of cis-acting elements in tombusviruses and related RNA viruses
International Nuclear Information System (INIS)
Toklu, H.Z.; Sehirli, O.; Ozyurt, H.
2009-01-01
Radiation-induced enteritis is a well-recognized sequel of therapeutic irradiation. Therefore we examined the radioprotective properties of Punica granatum peel extract (PPE) on the oxidative damage in the ileum. Rats were exposed to a single whole-body X-ray irradiation of 800 cGy. Irradiated rats were pretreated orally with saline or PPE (50 mg/kg/day) for 10 days before irradiation and the following 10 days, while control rats received saline or PPE but no irradiation. Then plasma and ileum samples were obtained. Irradiation caused a decrease in glutathione and total antioxidant capacity, which was accompanied by increases in malondialdehyde levels, myeloperoxidase activity, collagen content of the tissue with a concomitant increase 8-hydroxy-2'-deoxyguanosine (an index of oxidative DNA damage). Similarly, pro-inflammatory cytokines (TNF-α, IL-1β and IL-6) and lactate dehydrogenase were elevated in irradiated groups as compared to control. PPE treatment reversed all these biochemical indices, as well as histopathological alterations induced by irradiation. Furthermore, flow cytometric measurements revealed that leukocyte apoptosis and cell death were increased in irradiated animals, while PPE reversed these effects. PPE supplementation reduced oxidative damage in the ileal tissues, probably by a mechanism that is associated with the decreased production of reactive oxygen metabolites and enhancement of antioxidant mechanisms. Adjuvant therapy of PPE may have a potential to support a successful radiotherapy by protecting against radiation-induced enteritis. (author)
Fogel, Itay; David, Osant; Balik, Chaya H; Eisenkraft, Arik; Poles, Lion; Shental, Omri; Kassirer, Michael; Brosh-Nissimov, Tal
2017-11-01
The recent Ebola virus disease outbreak emphasized the potential misuse of personal protective equipment (PPE) by health care workers (HCWs) during such an event. We aimed to compare self-perceived proficiency of PPE use and objective performance, and identify predictors of low compliance and PPE misuse. An observational study combined with subjective questionnaires were carried out during a bioterror simulation drill. Forty-two observers evaluated performance under PPE. Mistakes were recorded and graded using a structured observational format and were correlated with the subjective questionnaires and with demographic parameters. One hundred seventy-eight HCWs from community clinics and hospitals were included. The mean self-perceived proficiency was high (6.1 out of 7), mean level of comfort was moderate (4.0 out of 7), and mean objective performance was intermediate (9.5 out of 13). There was no correlation between comfort and objective performance scores. Self-perceived proficiency was in correlation with donning and continuous performance with PPE but not with doffing. Clinic personnel performed better than personnel in hospitals (40.3% vs 67.8% with 3 or more mistakes, respectively; P = .001). Demographic characteristics had no correlation with objective or self-perceived performance. Self-perceived proficiency is a poor predictor of appropriate PPE use. The results suggest poor awareness of the possibility of PPE misuse. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.
Rees, Charlotte E; Wearn, Andy M; Vnuk, Anna K; Sato, Toshio J
2009-03-01
Although studies have begun to shed light on medical students' attitudes towards peer physical examination (PPE), they have been conducted at single sites, and have generally not examined changes in medical students' attitudes over time. Employing both cross-sectional and longitudinal designs, the current study examines medical students' attitudes towards PPE at schools from different geographical and cultural regions and assess changes in their attitudes over their first year of medical study. Students at six schools (Peninsula, UK; Durham, UK; Auckland, New Zealand; Flinders, Australia; Sapporo, Japan and Li Ka Shing, Hong Kong) completed the Examining Fellow Students (EFS) questionnaire near the start of their academic year (T1), and students at four schools (Peninsula, Durham, Auckland and Flinders) completed the EFS for a second time, around the end of their academic year (T2). Univariate and multivariate analyses revealed a high level of acceptance for PPE of non-intimate body regions amongst medical students from all schools (greater than 83%, hips, at T1 and 94.5%, hips and upper body, at T2). At T1 and T2, students' willingness to engage in PPE was associated with their gender, ethnicity, religiosity and school. Typically, students least comfortable with PPE at T1 and T2 were female, non-white, religious and studying at Auckland. Although students' attitudes towards PPE were reasonably stable over their first year of study, and after exposure to PPE, we did find some statistically significant differences in attitudes between T1 and T2. Interestingly, attitude changes were consistently predicted by gender, even when controlling for school. While male students' attitudes towards PPE were relatively stable over time, females' attitudes were changeable. In this paper, we discuss our findings in light of existing research and theory, and discuss their implications for educational practice and further research.
A murine model of elastase- and cigarette smoke-induced emphysema
Directory of Open Access Journals (Sweden)
Rubia Rodrigues
Full Text Available ABSTRACT Objective: To describe a murine model of emphysema induced by a combination of exposure to cigarette smoke (CS and instillation of porcine pancreatic elastase (PPE. Methods: A total of 38 C57BL/6 mice were randomly divided into four groups: control (one intranasal instillation of 0.9% saline solution; PPE (two intranasal instillations of PPE; CS (CS exposure for 60 days; and CS + PPE (two intranasal instillations of PPE + CS exposure for 60 days. At the end of the experimental protocol, all animals were anesthetized and tracheostomized for calculation of respiratory mechanics parameters. Subsequently, all animals were euthanized and their lungs were removed for measurement of the mean linear intercept (Lm and determination of the numbers of cells that were immunoreactive to macrophage (MAC-2 antigen, matrix metalloproteinase (MMP-12, and glycosylated 91-kDa glycoprotein (gp91phox in the distal lung parenchyma and peribronchial region. Results: Although there were no differences among the four groups regarding the respiratory mechanics parameters assessed, there was an increase in the Lm in the CS + PPE group. The numbers of MAC-2-positive cells in the peribronchial region and distal lung parenchyma were higher in the CS + PPE group than in the other groups, as were the numbers of cells that were positive for MMP-12 and gp91phox, although only in the distal lung parenchyma. Conclusions: Our model of emphysema induced by a combination of PPE instillation and CS exposure results in a significant degree of parenchymal destruction in a shorter time frame than that employed in other models of CS-induced emphysema, reinforcing the importance of protease-antiprotease imbalance and oxidant-antioxidant imbalance in the pathogenesis of emphysema.
PVA-Glutaraldehyde as support for lectin immobilization and affinity chromatography
Directory of Open Access Journals (Sweden)
Moacyr Jesus Barreto de Melo Rêgo
2016-12-01
Full Text Available Immobilized lectins are a powerful biotechnological tool for separation and isolation of glycoconjugates. In the present study, polyvinyl alcohol (PVA and glutaraldehyde (GA were used as a support for Concanavalin A (Con A covalent immobilization and for entrapment of Parkia pendula seed gum (PpeG. Con A immobilization yielded approximately 30% and 0.6 M glucose solution was the minimum concentration able to elute fetuin from column. PVA-GA-PpeG column was efficiently recognized by pure P. pendula lectin (PpeL. These findings indicate that PVA-GA interpenetrated network showed to be an efficient support for lectin covalent immobilization and as affinity chromatography matrix after trapping of PpeG.
Directory of Open Access Journals (Sweden)
Lamiaa Ali Ahmed
2014-01-01
Full Text Available This study aimed to evaluate the renoprotective effect of Physalis peruviana L. extract (PPE on acute renal injury in rats. Adult male rats (n=36 were divided into six groups that were fed with basal diet throughout the experiment (33 days. The first group was normal group, the second and the third groups were administered orally with 100 and 150 mg PPE/kg body weight (BW respectively, the fourth group was injected intraperitoneally with 5 mg/kg BW cisplatin once on the 28th day to induced ARI, and the fifth and sixth groups were treated like the second and the third groups and were injected with cisplatin on the 28th day. Many bioactive compounds were found in PPE. PPE did not cause any changes in the second and third groups compared to normal control group. Administration of PPE prior to cisplatin injection caused significant reduction in relative kidney weight, serum creatinine, urea, blood urea nitrogen, and significant increments in body weight, feed intake, total protein, albumin, and total globulin compared to cisplatin group. Pretreatment with PPE improved kidney histology and diminished the level of thiobarbituric acid reactive substances and enhanced other antioxidant enzymes in kidney homogenate compared to cisplatin group.
Ahmed, Lamiaa Ali
2014-01-01
This study aimed to evaluate the renoprotective effect of Physalis peruviana L. extract (PPE) on acute renal injury in rats. Adult male rats (n = 36) were divided into six groups that were fed with basal diet throughout the experiment (33 days). The first group was normal group, the second and the third groups were administered orally with 100 and 150 mg PPE/kg body weight (BW) respectively, the fourth group was injected intraperitoneally with 5 mg/kg BW cisplatin once on the 28th day to induced ARI, and the fifth and sixth groups were treated like the second and the third groups and were injected with cisplatin on the 28th day. Many bioactive compounds were found in PPE. PPE did not cause any changes in the second and third groups compared to normal control group. Administration of PPE prior to cisplatin injection caused significant reduction in relative kidney weight, serum creatinine, urea, blood urea nitrogen, and significant increments in body weight, feed intake, total protein, albumin, and total globulin compared to cisplatin group. Pretreatment with PPE improved kidney histology and diminished the level of thiobarbituric acid reactive substances and enhanced other antioxidant enzymes in kidney homogenate compared to cisplatin group.
Marcelo Motta Veiga; Ronaldo Almeida; Francisco Duarte
2016-01-01
Human metabolism produces heat during labor activities. The human body works as a thermodynamic system maintaining a steady body temperature. The use of Personal Protective Equipment (PPE) jeopardizes the heat dissipation, making difficult to keep ain body temperature at a comfortable level. This study analyzed the interference of PPE in workers' thermal comfort. This study made measurements of heart rate and body temperature of workers using PPE during the process of spraying pesticides. Thi...
Energy Technology Data Exchange (ETDEWEB)
Foust, C.B.
1999-05-01
An incident involving chemical warfare agents requires a unique hazardous materials (HAZMAT) response. As with an HAZMAT event, federal regulations prescribe that responders must be protected from exposure to the chemical agents. But unlike other HAZMAT events, special considerations govern selection of personal protective equipment (PPE). PPE includes all clothing, respirators and monitoring devices used to respond to a chemical release. PPE can differ depending on whether responders are military or civilian personnel.
IAS 16 Property, Plant and Equipment - A Closer Look
Muthupandian, K S
2009-01-01
The International Accounting Standards Committee issued the the International Accounting Standard 16 Property, Plant and Equipment. The objective of IAS 16 is to prescribe the accounting treatment for Property, Plant and Equipment (PPE) so that users of the financial statements can discern information about an entity's investment in its PPE and the changes in such investment. The principal issues in accounting for PPE are the recognition of the assets, the determination of their carrying amou...
Tallinna linnaelu kajastumine raehärra Hans Rotgersi märkmetes / Tiina Kala
Kala, Tiina, 1967-
2008-01-01
Hans Rotgersi aktiivne tegutsemisperiood hõlmab 15. sajandi viimase ja 16. saj. esimese veerandi. Kõige ulatuslikuma kirjaliku pärandi on ta endast maha jätnud Niguliste kiriku eestseisjana. Niguliste kiriku olulistest daatumitest. Maksujõuliste tallinlaste surma kajastumisest Rotgersi ülestähendustes. Rotgersi käsikirjas säilinud astroloogiliste ja meditsiiniliste soovituste kogust. Hans Rotgersi testamendist.
Chromatin-associated regulation of sorbitol synthesis in flower buds of peach.
Lloret, Alba; Martínez-Fuentes, Amparo; Agustí, Manuel; Badenes, María Luisa; Ríos, Gabino
2017-11-01
PpeS6PDH gene is postulated to mediate sorbitol synthesis in flower buds of peach concomitantly with specific chromatin modifications. Perennial plants have evolved an adaptive mechanism involving protection of meristems within specialized structures named buds in order to survive low temperatures and water deprivation during winter. A seasonal period of dormancy further improves tolerance of buds to environmental stresses through specific mechanisms poorly known at the molecular level. We have shown that peach PpeS6PDH gene is down-regulated in flower buds after dormancy release, concomitantly with changes in the methylation level at specific lysine residues of histone H3 (H3K27 and H3K4) in the chromatin around the translation start site of the gene. PpeS6PDH encodes a NADPH-dependent sorbitol-6-phosphate dehydrogenase, the key enzyme for biosynthesis of sorbitol. Consistently, sorbitol accumulates in dormant buds showing higher PpeS6PDH expression. Moreover, PpeS6PDH gene expression is affected by cold and water deficit stress. Particularly, its expression is up-regulated by low temperature in buds and leaves, whereas desiccation treatment induces PpeS6PDH in buds and represses the gene in leaves. These data reveal the concurrent participation of chromatin modification mechanisms, transcriptional regulation of PpeS6PDH and sorbitol accumulation in flower buds of peach. In addition to its role as a major translocatable photosynthate in Rosaceae species, sorbitol is a widespread compatible solute and cryoprotectant, which suggests its participation in tolerance to environmental stresses in flower buds of peach.
Partial pulmonary embolization disrupts alveolarization in fetal sheep
Directory of Open Access Journals (Sweden)
Hooper Stuart B
2010-04-01
Full Text Available Abstract Background Although bronchopulmonary dysplasia is closely associated with an arrest of alveolar development and pulmonary capillary dysplasia, it is unknown whether these two features are causally related. To investigate the relationship between pulmonary capillaries and alveolar formation, we partially embolized the pulmonary capillary bed. Methods Partial pulmonary embolization (PPE was induced in chronically catheterized fetal sheep by injection of microspheres into the left pulmonary artery for 1 day (1d PPE; 115d gestational age; GA or 5 days (5d PPE; 110-115d GA. Control fetuses received vehicle injections. Lung morphology, secondary septal crests, elastin, collagen, myofibroblast, PECAM1 and HIF1α abundance and localization were determined histologically. VEGF-A, Flk-1, PDGF-A and PDGF-Rα mRNA levels were measured using real-time PCR. Results At 130d GA (term ~147d, in embolized regions of the lung the percentage of lung occupied by tissue was increased from 29 ± 1% in controls to 35 ± 1% in 1d PPE and 44 ± 1% in 5d PPE fetuses (p VEGF and Flk-1, although a small increase in PDGF-Rα expression at 116d GA, from 1.00 ± 0.12 in control fetuses to 1.61 ± 0.18 in 5d PPE fetuses may account for impaired differentiation of alveolar myofibroblasts and alveolar development. Conclusions PPE impairs alveolarization without adverse systemic effects and is a novel model for investigating the role of pulmonary capillaries and alveolar myofibroblasts in alveolar formation.
Morzelle, Maressa Caldeira; Salgado, Jocelem Mastrodi; Telles, Milena; Mourelle, Danilo; Bachiega, Patricia; Buck, Hudson Sousa
2016-01-01
Alzheimer’s disease is a chronic and degenerative condition that had no treatment until recently. The current therapeutic strategies reduce progression of the disease but are expensive and commonly cause side effects that are uncomfortable for treated patients. Functional foods to prevent and/or treat many conditions, including neurodegenerative diseases, represent a promising field of study currently gaining attention. To this end, here we demonstrate the effects of pomegranate (Punica granatum) peel extract (PPE) regarding spatial memory, biomarkers of neuroplasticity, oxidative stress and inflammation in a mouse model of neurodegeneration. Male C57Bl/6 mice were chronically infused for 35 days with amyloid-β peptide 1–42 (Aβ) or vehicle (control) using mini-osmotic pumps. Another group, also infused with Aβ, was treated with PPE (p.o.– βA+PPE, 800 mg/kg/day). Spatial memory was evaluated in the Barnes maze. Animals treated with PPE and in the control group exhibited a reduction in failure to find the escape box, a finding that was not observed in the Aβ group. The consumption of PPE reduced amyloid plaque density, increased the expression of neurotrophin BDNF and reduced the activity of acetylcholinesterase enzyme. A reduction in lipid peroxidation and in the concentration of the pro-inflammatory cytokine TNF-α was also observed in the PPE group. No hepatic lesions were observed in animals treated with PPE. In conclusion, administration of pomegranate peel extract has neuroprotective effects involving multiple mechanisms to prevent establishment and progression of the neurodegenerative process induced by infusion with amyloid-β peptide in mice. PMID:27829013
Comparison of forcefields for molecular dynamics simulations of hydrocarbon phase diagrams
Pisarev, V. V.; Zakharov, S. A.
2018-01-01
Molecular dynamics calculations of vapor-liquid equilibrium of methane-n-butane mixture are performed. Three force-field models are tested: the TraPPE-UA united-atom forcefield, LOPLS-AA all-atom forcefield and a fully flexible version of the TraPPE-EH all-atom forcefield. All those forcefields reproduce well the composition of liquid phase in the mixture as a function of pressure at the 300 K isotherm, while significant discrepancies from experimental data are observed in the saturated vapor compositions with OPLS-AA and TraPPE-UA forcefields. The best agreement with the experimental phase diagram is found with TraPPE-EH forcefield which accurately reproduces compositions of both liquid and vapor phase. This forcefield can be recommended for simulation of two-phase hydrocarbon systems.
Directory of Open Access Journals (Sweden)
Mónica NOGUERAS
2001-06-01
Full Text Available The importance of hands in the transmission of nosocomial infection has been world wide admitted. However, it is difficult to induce this behavior in health-care workers. The aim of the present work was to point out the importance of hand bacteria colonization, the influence of hand washing and of patient physical examination. One hundred health-care workers were randomly divided in two groups: Group A without hand washing previous to patient physical examination or handling (PPE; group B with hand washing previous to PPE. Direct fingerprint samples in Columbia agar before and after PPE were obtained. The colonies were counted and identified by conventional techniques, and antibiograms according to NCCLS were performed. Before PPE group A participants showed a high number of bacteria regarding group B participants (73.9 Vs 20.7; p A importância das mãos na transmissão de infecções hospitalares é aceita mundialmente. Todavia, é difícil introduzir este procedimento entre os trabalhadores da saúde. Este trabalho pretendeu evidenciar a colonização das mãos por bactérias e a influência da lavagem de mãos e o exame físico dos pacientes. 100 profisionais de saúde foram divididos, ao acaso em dois grupos: A - sem lavagem de mãos antes do exame físico ou manejo dos pacientes (PPE; B - com lavagem prévia das mãos antes do PPE. Foram obtidas amostras de impressões digitais em agar Columbia antes e depois do PPE. As colônias foram contadas e identificadas por técnicas convencionais e antibiogramas de acordo com NCCLS. Antes do PPE os participantes do grupo A apresentaram elevado número de bactérias em relação ao grupo B (73.9 vs. 20.7; p < 0.001; 44 dos 50 participantes eram portadores potenciais de bactérias patogênicas. Nenhum participante do grupo B era portador de bactéria potencialmente patogênica antes do PPE. Este grupo mostrou um aumento no número de bactérias depois do PPE (20.7 UFC antes vs. 115.9 UFC depois; p
Al Zadjali, Said; Morse, Stephen; Chenoweth, Jonathan; Deadman, Mike
2015-01-01
The level of uptake and use of personal protective equipment (PPE) by farm workers in Oman is low; the conditions under which pesticides are stored are frequently below acceptable international standards. Research was undertaken to explore the drivers working against safe storage of agrochemicals and effective personal protection usage by pesticide application personnel. Results from a survey of over 200 respondents, representing workers in, and owners of, farms either within or outside a local farmer's association (FA), suggest that FA membership raises standards of behaviour both in terms of safe pesticide storage and use of PPE. Age of respondents had no apparent effect on the likelihood of PPE (gloves and masks) use. PPE use was, however, highest among respondents with more advanced educational backgrounds. Positive responses for glove and mask use, when applying pesticides, were higher for owners and workers in FA farms compared to non-FA farms. Lowest reported use of PPE was among workers in non-FA farms. Analysis of responses appears to indicate that behaviour patterns of workers in FA farms mirror that of the farm owners. This was not the case in non-FA farms. The results suggest that conformity to social norms, in this case acceptable work-environment behaviour, is a powerful driver behind raised usage levels of PPE in farms in Oman. Copyright © 2014 Elsevier B.V. All rights reserved.
Denisov, É I; Morozova, T V; Adeninskaia, E E; Kur'erov, N N
2013-01-01
The effectiveness of personal protective equipment (PPE) of hearing, respiratory organs and hands is considered. It is shown that real effect of PPE is twice lower than declared by supplier; this presumes some derating system. The aspects of discomfort and additional risks are analyzed. The hygienic and physiologic evaluation of PPE is required along with elaboration of an official document (OSH standard or sanitary regulation) on selection, personal fit, organization of use and individual training of workers and their motivation.
Dunn, Angela C; Walker, Tiffany A; Redd, John; Sugerman, David; McFadden, Jevon; Singh, Tushar; Jasperse, Joseph; Kamara, Brima Osaio; Sesay, Tom; McAuley, James; Kilmarx, Peter H
2016-03-01
In the largest Ebola virus disease (EVD) outbreak in history, nosocomial transmission of EVD increased spread of the disease. We report on 2 instances in Sierra Leone where patients unknowingly infected with EVD were admitted to a general hospital ward (1 pediatric ward and 1 maternity ward), exposing health care workers, caregivers, and other patients to EVD. Both patients died on the general wards, and were later confirmed as being infected with EVD. We initiated contact tracing and assessed risk factors for secondary infections to guide containment recommendations. We reviewed medical records to establish the index patients' symptom onset. Health care workers, patients, and caregivers were interviewed to determine exposures and personal protective equipment (PPE) use. Contacts were monitored daily for EVD symptoms. Those who experienced EVD symptoms were isolated and tested. Eighty-two contacts were identified: 64 health care workers, 7 caregivers, 4 patients, 4 newborns, and 3 children of patients. Seven contacts became symptomatic and tested positive for EVD: 2 health care workers (1 nurse and 1 hospital cleaner), 2 caregivers, 2 newborns, and 1 patient. The infected nurse placed an intravenous catheter in the pediatric index patient with only short gloves PPE and the hospital cleaner cleaned the operating room of the maternity ward index patient wearing short gloves PPE. The maternity ward index patient's caregiver and newborn were exposed to her body fluids. The infected patient and her newborn shared the ward and latrine with the maternity ward index patient. Hospital staff members did not use adequate PPE. Caregivers were not offered PPE. Delayed recognition of EVD and inadequate PPE likely led to exposures and secondary infections. Earlier recognition of EVD and adequate PPE might have reduced direct contact with body fluids. Limiting nonhealth-care worker contact, improving access to PPE, and enhancing screening methods for pregnant women, children
Pesticide knowledge, practice and attitude and how it affects the ...
African Journals Online (AJOL)
2014-06-02
scale farmers in Uganda: a cross-sectional ... protective equipment (PPE (e.g. mask, boots, gloves, long sleeved shirt, overalls, hat)) ..... What do you wear doing pesticide spraying (PPE)?. Ordinary clothing. 229 (73) 105 (70).
NCBI nr-aa BLAST: CBRC-GGAL-35-0335 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0335 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 5e-16 28% ...
NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0021 ref|YP_001289313.1| PPE family protein [Mycobacterium tuberculosis... F11] gb|ABR07711.1| PPE family protein [Mycobacterium tuberculosis F11] YP_001289313.1 5e-27 36% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0908 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0908 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 7e-10 28% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0381 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0381 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 3e-08 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1306 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1306 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 4e-15 30% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1255 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1255 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 3e-19 27% ...
NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0021 ref|YP_001286255.1| PPE family protein [Mycobacterium tuberculosis... F11] gb|ABR04653.1| PPE family protein [Mycobacterium tuberculosis F11] YP_001286255.1 1e-30 41% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0299 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0299 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 4e-18 28% ...
NCBI nr-aa BLAST: CBRC-GACU-08-0028 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-08-0028 ref|NP_336316.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46130.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336316.1 0.021 33% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0354 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 2e-11 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1056 ref|ZP_00878894.1| COG5651: PPE-repeat proteins [Mycobacterium tuberculosis... C] gb|EAY60015.1| PPE family protein [Mycobacterium tuberculosis C] ZP_00878894.1 4e-12 27% ...
Criaco, G. (Giuseppe); Sieger, P. (Philipp); Wennberg, K. (Karl); Chirico, F. (Francesco); Minola, T. (Tommaso)
2017-01-01
textabstractWe investigate how perceived parents’ performance in entrepreneurship (PPE) affects the entrepreneurial career intentions of offspring. We argue that while perceived PPE enhances offspring’s perceived entrepreneurial desirability and feasibility because of exposure mechanisms, it
NCBI nr-aa BLAST: CBRC-CJAC-01-0354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0354 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-11 28% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1302 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1302 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 2e-08 26% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1522 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-07 25% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1092 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1092 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-05 27% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1176 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1176 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-05 29% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0299 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0299 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-19 29% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0065 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0065 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-07 25% ...
NCBI nr-aa BLAST: CBRC-GGAL-35-0026 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0026 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 6e-16 27% ...
Commentary Preparticipation physical evaluation: An opportunity for ...
African Journals Online (AJOL)
standardised procedures for carrying out PPE,7–9 its potential benefits are enormous. ... sports clubs and franchises throughout the world require that athletes ... counselling and anticipatory guidance.12 Over and above this, the PPE process ...
NCBI nr-aa BLAST: CBRC-GGAL-35-0335 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0335 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 1e-18 29% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1056 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1056 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 7e-15 27% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1306 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1306 ref|NP_336255.1| PPE family protein [Mycobacterium tuberculosis C...DC1551] gb|AAK46069.1| PPE family protein [Mycobacterium tuberculosis CDC1551] NP_336255.1 5e-15 29% ...
Bello, Dhimiter; Redlich, Carrie A; Stowe, Meredith H; Sparer, Judy; Woskie, Susan R; Streicher, Robert P; Hosgood, H Dean; Liu, Youcheng
2008-03-01
Skin exposure to isocyanates, in addition to respiratory exposures, may contribute to sensitization and asthma. Quantitative skin exposure data are scarce and quantitative methods limited. As part of the Survey of Painters and Repairers of Autobodies by Yale study, a method to sample and quantify human isocyanate skin exposure was developed (based on NIOSH 5525 method) and used to evaluate aliphatic isocyanate skin exposure in 81 auto body shop painters and body technicians. Wipe samples were collected from unprotected skin and from under PPE (gloves, clothing and respirator) using a polypropylene glycol-impregnated wipe. Hexamethylene diisocyanate (HDI), its polyisocyanates [HDI-derived polyisocyanates (pHDI)], isophorone diisocyanate (IPDI) and its polyisocyanates and IPDI-derived polyisocyanates (pIPDI) were quantified separately and also expressed as the total free isocyanate groups (total NCO). For unprotected skin areas, 49 samples were collected for spray painting, 13 for mixing, 27 for paint-related tasks (e.g. sanding and compounding) and 53 for non-paint-related tasks. Forty-three samples were also collected under PPE. The geometric mean (GM) [geometric standard deviation (GSD)] total NCO concentrations (ng NCO cm(-2)) for unprotected skin (hands, face and forearms) was 1.9 (10.9) and range 0.0-64.4. pHDI species were the major contributor to the total NCO content. Levels were very variable, with the highest concentrations measured for clear coating and paint mixing tasks. Isocyanate skin exposure was also commonly detected under PPE, with 92% of samples above the limit of detection. Levels were very variable with the overall GM (GSD) total NCO (ng NCO cm(-2)) under PPE 1.0 (5.2) and range (0.0-47.0) and similar under the different PPE (glove, respirator and clothing). The highest concentrations were detected for mixing and spraying tasks, 6.9 (5.3) and 1.0 (5.2), respectively. Levels under PPE were generally lower than unpaired samples obtained with no
Dowd, Karen; Taylor, Melanie; Toribio, Jenny-Ann L M L; Hooker, Claire; Dhand, Navneet K
2013-08-01
This study was conducted to determine the perceptions of zoonotic disease risk among Australian veterinarians, the infection control practices they use to protect themselves from zoonotic diseases, and the factors influencing their use of these protective practices. A questionnaire was designed and piloted prior to its administration to veterinarians at the annual Australian Veterinary Association Conference in May 2011. The questionnaire comprised 21 closed, semi-closed and open questions. Data from the questionnaire were analyzed using ordinal logistic regression analyses to determine significant factors for veterinarians' use of personal protective equipment (PPE). A total of 344 veterinarians completed the questionnaire of which 63.7% were women, 63.2% worked in small/companion animal practice, and 79.9% worked in private veterinary practice. Of the respondents, 44.9% reported contracting a zoonosis during their careers with 19.7% reporting a suspected case and 25.2% reporting a confirmed incidence. Around 40-60% of veterinarians perceived exposure to zoonosis likely or very likely in a variety of situations. With reference to current national industry guidelines, the reported use of PPE was less than "adequate" for most scenarios except for performing postmortems, surgery or dental procedures. No PPE was used by 60-70% of veterinarians for treating respiratory and neurological cases and by 40-50% when treating gastrointestinal and dermatological cases. Workplace conditions need improvement as 34.8% of workplaces did not have isolation units for infected animals, 21.1% did not have separate eating areas for staff, and 57.1% did not have complete PPE kits for use. Veterinarians were more likely to use PPE if they had undertaken postgraduate education, perceived that zoonosis exposure from animals and procedures was likely, consciously considered PPE use for every case they dealt with and believed that liability issues and risks encouraged use of PPE. In contrast
Fujiki, Saori; Ishizaki, Tatsuro; Nakayama, Takeo
2017-12-01
Residents of long-term care facilities are highly susceptible to norovirus gastroenteritis, and each facility is concerned about the need to implement norovirus infection control. Among control measures, personal protective equipment (PPE), such as disposable gloves and masks, plays a major role in reducing infectious spread. However, the preparation status of PPE in facilities before infection outbreaks has not been reported. The aim was to clarify the implementation status of preventive measures for norovirus gastroenteritis and the cost of preparing the necessary PPE in long-term care facilities. A questionnaire survey of facilities affiliated with the Kyoto Prefecture and Osaka Prefecture branches of the Japan Association of Geriatric Health Services Facilities was conducted. The survey items were the characteristics of the facility, whether preventive measures had been implemented for norovirus gastroenteritis from October through the following March in both 2009 and 2010, and the quantities and unit prices of PPE prepared for preventive measures. Twenty-six (11.2%) of 232 surveyed facilities (as of August 2011) answered the survey. Among them, 24 (92.3%) in 2009 and 25 (96.2%) in 2010 reported having implemented preventive measures for norovirus gastroenteritis, while 21 facilities (80.8%) in 2009 and 22 facilities (84.6%) in 2010 had prepared PPE. The median total cost for preparing the PPE needed for the preventive measures was US $2601 (range US $221-9192) in 2009 and US $3904 (range US $305-6427) in 2010. Although the results need careful interpretation because of the low response rate, most of the surveyed long-term care facilities had implemented preventive measures for norovirus gastroenteritis. However, the cost of preparing the PPE needed for the preventive measures varied among the facilities. © 2017 John Wiley & Sons, Ltd.
Impacts of patient characteristics on hospital care experience in 34,000 Swedish patients
Directory of Open Access Journals (Sweden)
Wolf Axel
2012-06-01
Full Text Available Abstract Background Standardized patient surveys are widely used for assessing quality of healthcare from the patient perspective. An important purpose of such surveys is to identify disparities in care among different patient groups. The purpose of this study was to 1. evaluate aspects of the validity of the adapted Swedish version of the Picker Patient Care Experience -15 (PPE-15 survey and 2. examine the explanatory value of various socio-demographic and health characteristics in predicting patients’ care experiences. Methods A retrospective cross-sectional study design was used. Patients discharged from internal medicine wards at regional and university hospitals in different parts of Sweden during 2010 were invited to participate in the regularly administered national care-experience survey for hospital care. The internal validity of the PPE-15 was assessed with Cronbach’s alpha and item-scale correlations. Pearson product–moment correlation coefficients were used to compare PPE-15 total scores with overall care satisfaction ratings and Spearman correlation coefficients were used to compare PPE-15 total scores with various patient characteristics. Multiple linear regression analysis was performed to examine the influence of various patient characteristics on PPE-15 scores. Results The response rate was 66% (n = 34 603. Cronbach’s alpha was 0.87. The correlation between the PPE-15 total score and overall care satisfaction was high (0.62, p Conclusions Our results supported the internal validity of the Swedish adapted version of the PPE-15. The explanatory value of the examined patient socio-demographic and health characteristics was low, suggesting the need for exploring other patient-related determinants of care experiences. Our findings also suggest a care paradox: patients in greatest need of hospital care are least satisfied with the quality of the care they receive.
Park, Sin-Hye; Paek, Ji Hun; Shin, Daekeun; Lee, Jae-Yong; Lim, Soon Sung; Kang, Young-Hee
2015-04-01
The cellular accumulation of cholesterol is critical in the development and progression of atherosclerosis. ATP-binding cassette (ABC) transporters play an essential role in mediating the efflux of excess cholesterol. In the current study, we investigated whether purple Perilla frutescens extracts (PPE) at a non-toxic concentration of 1-10 µg/ml stimulate the induction of the ABC transporters, ABCA1 and ABCG1, and cholesterol efflux from lipid-laden J774A.1 murine macrophages exposed to 50 ng/ml oxidized low-density lipoprotein (LDL). Purple perilla, an annual herb in the mint family and its constituents, have been reported to exhibit antioxidant and cytostatic activity, as well as to exert anti-allergic effects. Our results revealed that treatment with oxidized LDL for 24 h led to the accumulation of lipid droplets in the macrophages. PPE suppressed the oxidized LDL-induced foam cell formation by blocking the induction of scavenger receptor B1. However, PPE promoted the induction of the ABC transporters, ABCA1 and ABCG1, and subsequently accelerated cholesterol efflux from the lipid-loaded macrophages. The liver X receptor (LXR) agonist, TO-091317, and the peroxisome proliferator-activated receptor (PPAR) agonist, pioglitazone, increased ABCA1 expression and treatment with 10 µg/ml PPE further enhanced this effect. PPE did not induce LXRα and PPARγ expression per se, but enhanced their expression in the macrophages exposed to oxidized LDL. α-asarone was isolated from PPE and characterized as a major component enhancing the induction of ABCA1 and ABCG1 in macrophages exposed to oxidized LDL. α-asarone, but not β-asarone was effective in attenuating foam cell formation and enhancing cholesterol efflux, revealing an isomeric difference in their activity. The results from the present study demonstrate that PPE promotes cholesterol efflux from macrophages by activating the interaction of PPARγ-LXRα-ABC transporters.
Pooling knowledge and improving safety for contracted works at a large industrial park.
Agnello, Patrizia; Ansaldi, Silvia; Bragatto, Paolo
2015-01-01
At a large chemical park maintenance is contracted by the major companies operating the plants to many small firms. The cultural and psychological isolation of contractor workers was recognized a root cause of severe accidents in the recent years. That problem is common in chemical industry. The knowledge sharing has been assumed a good key to involve contractors and sub contractors in safety culture and contributing to injuries prevention. The selection of personal protective equipment PPE for the maintenance works has been taken as benchmark to demonstrate the adequateness of the proposed approach. To support plant operators, contractors and subcontractors in PPE discussion, a method has been developed. Its core is a knowledge-base, organized in an Ontology, as suitable for inferring decisions. By means of this tool all stakeholders have merged experience and information and find out the right PPE, to be provided, with adequate training and information package. PPE selection requires sound competencies about process and environmental hazards, including major accident, preventive and protective measures, maintenance activities. These pieces of knowledge previously fragmented among plant operators and contractors, have to be pooled, and used to find out the adequate PPE for a number of maintenance works. The PPE selection is per se important, but it is also a good chance to break the contractors' isolation and involve them in safety objectives. Thus by pooling experience and practical knowledge, the common understanding of safety issues has been strengthened.
NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0021 ref|YP_001281593.1| PPE family protein [Mycobacterium tuberculosis... H37Ra] gb|ABQ72031.1| PPE family protein [Mycobacterium tuberculosis H37Ra] YP_001281593.1 1e-30 41% ...
Directory of Open Access Journals (Sweden)
Omar S. O. Amer
2015-01-01
Full Text Available Coccidiosis is the most prevalent disease causing widespread economic loss, especially in poultry farms. Here, we investigated the effects of pomegranate peel extract (PPE on the outcome of coccidiosis caused by Eimeria papillata in mice. The data showed that mice infected with E. papillata and treated with PPE revealed a significant decrease in the output of oocysts in their faeces by day 5 p.i. Infection also induced inflammation and injury of the jejunum. This was evidenced (i as increases in reactive oxygen species, (ii, as increased neutrophils and decreased lymphocytes in blood (ii as increased mRNA levels of inducible nitric oxide synthase (iNOS, Bcl-2 gene, and of the cytokines interferon gamma (IFN-γ, tumour necrosis factor-α (TNF-α, and interleukin-1β (IL-1β, and (iv as downregulation of mucin gene MUC2 mRNA. All these infection-induced parameters were significantly altered during PPE treatment. In particular, PPE counteracted the E. papillata-induced loss of the total antioxidant capacity. Our data indicated that PPE treatment significantly attenuated inflammation and injury of the jejunum induced by E. papillata infections.
Lee, Joo-Young; Bakri, Ilham; Kim, Jung-Hyun; Son, Su-Young; Tochihara, Yutaka
2015-01-01
This study investigated the effects of firefighter personal protective equipment (PPE) on the determination of maximal oxygen uptake (VO2max) while using two different treadmill protocols: a progressive incline protocol (PIP) and a progressive speed protocol (PSP), with three clothing conditions (Light-light clothing; Boots-PPE with rubber boots; Shoes-PPE with running shoes). Bruce protocol with Light was performed for a reference test. Results showed there was no difference in VO2max between Bruce Light, PIP Light, and PSP Light. However, VO2max was reduced in Boots and Shoes with shortened maximal performance time (7 and 6 min reduced for PIP Boots and Shoes, respectively; 11 and 9 min reduced for PSP Boots and Shoes, respectively), whereas the increasing rate of VO2 in Boots and Shoes during submaximal exercise was greater compared with Light. Wearing firefighter boots compared with wearing running shoes also significantly affected submaximal VO2 but not VO2max. These results suggest that firefighters’ maximal performance determined from a typical VO2max test without wearing PPE may overestimate the actual performance capability of firefighters wearing PPE. PMID:23668854
Haas, Annika
2007-01-01
21. veebruaril 2007 tähistas Tiigrihüppe SA Tallinnas Olümpia hotelli konverentsikeskuses konverentsiga "Kogu tõde Tiigrihüppest" Tiigrihüppe programmi 10. aastapäeva. Kohal viibis ka programmi üks algatajaid Toomas Hendrik Ilves
About Personal Protective Equipment (PPE)
... some types of elastomeric respirator masks and protective eyewear such as goggles may be reused if the ... State & Local Officials Consumers Health Professionals Science & Research Industry Scroll back to top Popular Content Home Latest ...
2012-10-22
... countermeasures (i.e., drugs, vaccine), personal protective equipment (PPE), and other possible work practices. A federal interagency working group that included subject matter experts in biodefense, infectious diseases...), including more specificity regarding the use of personal protective equipment (PPE). In addition, a number...
Motives for property, plant and equipment revaluation according to positive accounting theory
Katarzyna Bareja; Magdalena Giedroyć
2016-01-01
The paper identifies motives for property, plant and equipment (PPE) revaluations according to the three main hypotheses proposed by Watts and Zimmerman. Attempt to lower debt-equity ratio is the main motive for PPE revaluation. The method of inductive inference was applied.
Muon Beam Studies in the H4 beam line and the Gamma Irradiation Facility (GIF++)
Margraf, Rachel; CERN. Geneva. ATS Department
2018-01-01
In this note, we present detailed simulation results for the trajectory of a muon beam, traversing beam zones PPE-134 and PPE-154, produced by a 150 GeV positive hadron beam incident on collimators 9 & 10 in the H4 beam line when these collimators are placed off-beam axis to stop all hadrons and electrons. Using G4Beamline, a GEANT-4 based Monte-Carlo program, the trajectory of the muon beam has been studied for several field strengths of the GOLIATH magnet, as well as for different polarities. The position of the beam at the Gamma Irradiation Facility (GIF++), located downstream the PPE-144 area, is also presented. In addition, two configurations of the two XTDV’s present in the line (XTDV.022.520 and XTDV.022.610) have been studied, with the purpose to simulate the pion contamination of the beam both in PPE134 and GIF++.
Lane, E L; Cheetham, S; Jenner, P
2008-01-01
The monoamine uptake inhibitor BTS 74 398 induces ipsilateral circling in 6-hydroxydopamine (6-OHDA) lesioned rats without induction of abnormal motor behaviours associated with L-dopa administration. We examined whether this was reflected in the expression of peptide mRNA in the direct and indirect striatal output pathways.6-OHDA lesioning of the nigrostriatal pathway increased striatal expression of PPE-A mRNA and decreased levels of PPT mRNA with PPE-B mRNA expression remaining unchanged. Acute L-dopa administration normalised PPE-A mRNA and elevated PPT mRNA while PPE-B mRNA expression remained unchanged. Acute administration of BTS 74 398 did not alter striatal peptide mRNA levels. Following chronic treatment with L-dopa, PPE-A mRNA expression in the lesioned striatum continued to be normalised and PPT mRNA was increased compared to the intact side. PPE-B mRNA expression was also markedly increased relative to the non-lesioned striatum. Chronic BTS 74 398 administration did not alter mRNA expression in the 6-OHDA lesioned striatum although small increases in PPT mRNA expression in the intact and sham lesioned striatum were observed. The failure of BTS 74 398 to induce changes in striatal neuropeptide mRNA correlated with its failure to induce abnormal motor behaviours or behavioural sensitisation but does not explain how it produces a reversal of motor deficits. An action in another area of the brain appears likely and may explain the subsequent failure of BTS 74 398 and related compounds to exert anti-parkinsonian actions in man.
chemical safety and chemical security overview
African Journals Online (AJOL)
IICBA01
Wafaa M. Abdou. Chemical Industries Division, National Research Centre, ... substances to attain an acceptably low risk of exposure. Security is: ... Sharing locations of chemicals can publicize targets for theft .... D. Personal Protective Equipments (PPE): ... E. Lighting & Noise Levels ... PPE. ➢ Autoclave or sterilize wastes.
Motives for property, plant and equipment revaluation according to positive accounting theory
Directory of Open Access Journals (Sweden)
Katarzyna Bareja
2016-07-01
Full Text Available The paper identifies motives for property, plant and equipment (PPE revaluations according to the three main hypotheses proposed by Watts and Zimmerman. Attempt to lower debt-equity ratio is the main motive for PPE revaluation. The method of inductive inference was applied.
PREPARTICIPATION SCREENING – THE SPORTS PHYSICAL THERAPY PERSPECTIVE
Blackburn, Turner A.; Boucher, Brenda
2013-01-01
Background and Purpose: The sports physical therapist (SPT) is uniquely qualified to participate in the provision of preparticipation physical examinations (PPE). The PPE is recommended prior to athletic participation and required by many jurisdictions. There is little research to support the process and components; however, a number of professional organizations have recommendations that direct the PPE process. Description of Topic and Related Evidence: This clinical commentary highlights the role of the sports physical therapist and current evidence related to the preparticipation physical examination process. Data sources were limited to include professional positions and peer reviewed publications from 1988 through January 2013. Relation to Clinical Practice: Preparticipation physicals should be useful, comprehensive, and cost effective for the athlete and the health care team. Additional research is indicated in many of the areas of the PPE. The SPT is a valuable member of the health care team and can be a primary facilitator of the PPE in concert with the physician, athletic trainer, athletic organization administrators, and others. Well‐designed and inclusive PPEs can be provided to meet the major objectives of identification of athletes at risk. Controversy continues over the extent of the cardiac screening component as well as other sport or athlete specific components. Level of Evidence: 5 PMID:23593556
Construction Site Workers’ Awareness on Using Safety Equipment: Case Study
Directory of Open Access Journals (Sweden)
Ulang N. Md
2014-01-01
Full Text Available Construction sector is an important sector and contributed significantly to national development. However, this sector poses higher risk to accident. This is due to fact that construction site can be considered as a dangerous zone to workers and to the public. Due to the variety of cases occurs on site, the contractor will usually have to pay the cost related to accidents in the form of higher insurance premium. Despite various measures, accidents still occur at construction sites. Personal Protective Equipment (PPE is one of the important means to protect the wearer from hazards in the workplace. Since this equipment is the last frontier of the wearer from worksite hazards, it is important to select it based on the job scope and the intended protection. Therefore, this study was formulated to find out the level of knowledge and awareness of construction workers on PPE usage. It was also important to know what make the workers would want or do not want to use the PPE. It was found in this study that the level of awareness and knowledge among workers on the proper use of PPE is moderate. Construction sites accident can be further be reduced with proper implementation of PPE voluntarily by all workers.
Patel, Anita; D'Alessandro, Maryann M; Ireland, Karen J; Burel, W Greg; Wencil, Elaine B; Rasmussen, Sonja A
Personal protective equipment (PPE) that protects healthcare workers from infection is a critical component of infection control strategies in healthcare settings. During a public health emergency response, protecting healthcare workers from infectious disease is essential, given that they provide clinical care to those who fall ill, have a high risk of exposure, and need to be assured of occupational safety. Like most goods in the United States, the PPE market supply is based on demand. The US PPE supply chain has minimal ability to rapidly surge production, resulting in challenges to meeting large unexpected increases in demand that might occur during a public health emergency. Additionally, a significant proportion of the supply chain is produced off-shore and might not be available to the US market during an emergency because of export restrictions or nationalization of manufacturing facilities. Efforts to increase supplies during previous public health emergencies have been challenging. During the 2009 H1N1 influenza pandemic and the 2014 Ebola virus epidemic, the commercial supply chain of pharmaceutical and healthcare products quickly became critical response components. This article reviews lessons learned from these responses from a PPE supply chain and systems perspective and examines ways to improve PPE readiness for future responses.
Venderbosch, R.W.; Meijer, H.E.H.; Lemstra, P.J.
1995-01-01
The application of poly(2,6-dimethyl-1,4-phenylene ether) (PPE) as a matrix material for continuous carbon fibre reinforced composites has been studied. Owing to the intractable nature of PPE, melt impregnation is not feasible and therefore a solution impregnation route was explored using epoxy
Directory of Open Access Journals (Sweden)
Gemima Lara Hernandez
2013-01-01
Full Text Available Among the photothermal methods, the photopyroelectric (PPE technique is a suitable method to determine thermal properties of different kinds of samples ranging from solids to liquids and gases. Polyvinylidene difluoride (PVDF is one of the most frequently used pyroelectric sensors in PPE technique but has the disadvantage that it can be easily deformed by the sample weight. This deformation could add a piezoelectric effect to the thermal parameters assessment; also PVDF has a narrow temperature operation range when compared with ceramic pyroelectric sensors. In order to minimize possible piezoelectric effects due to sensor deformation, a ceramic of lanthanum modified lead zirconate (PLZT was used as pyroelectric sensor in the PPE technique. Then, thermal diffusivity of some liquid samples was measured, by using the PPE configuration that denominated the thermal wave resonator cavity (TWRC, with a PLZT ceramic as pyroelectric detector. The performance obtained with the proposed ceramic in the TWRC configuration was compared with that obtained with PVDF by using the same configuration.
Directory of Open Access Journals (Sweden)
Rizka Ayu Zahara
2017-12-01
Full Text Available Abstrak: Alat Pelindung Diri (APD berfungsi untuk melindungi tubuh terhadap bahaya-bahaya kecelakaan kerja dan mengurangi tingkat keparahan dari kecelakaan kerja yang terjadi. Penelitian ini bertujuan untuk mengetahui korelasi antara pengetahuan dan perilaku petugas Instalasi Pemeliharaan Sarana dan Prasarana Rumah Sakit (IPSRS dengan kepatuhan terhadap penggunaan Alat Pelindung Diri (APD. Desain penelitian ini adalah Cross Sectional. Populasi adalah seluruh petugas IPSRS di RSUD Siti Aisyah Kota Lubuklinggau sebanyak 64 orang. Penelitian dilaksanakan pada bulan Agustus 2017. Analisis data menggunakan uji statistik chi-Square. Hasil penelitian menunjukkan adanya korelasi antara kepatuhan menggunakan Alat Pelindung Diri APD pengetahuan (p value = 0, 001, dan perilaku (p value = 0, 006. Pihak RSUD diharapkan dapat menerapkan Standar Prosedur Operasional (SPO yang lebih tegas, melakukan pelatihan tentang penggunaan APD, dan meningkatkan pengawasan terhadap kepatuhan petugas dalam menggunakan APD. Kata Kunci : Pengetahuan, Perilaku, Kepatuhan Alat Pelindung Diri (APD. ADHERENCE USING PERSONAL PROTECTIVE EQUIPMENT (PPE IN TERMS OF THE KNOWLEDGE AND BEHAVIOR OF OFFICER INSTALLATION MAINTENANCE FACILITIES AND INFRASTRUCTURE HOSPITAL (IPSRS Abstract: Personal Protective Equipment (PPE serves to protect the body against occupational injuries and reduce the severity of work accidents that occur. This study aims to determine the correlation between the knowledge and behavior of the officer of the Installation of Hospital Facilities and Infrastructure Maintenance (IPSRS with the adherence to the use of Personal Protective Equipment (PPE. The design of this study was Cross Sectional. The population is all IPSRS officers in RSUD Siti Aisyah Lubuklinggau City as many as 64 people. The study was conducted in August 2017. The data analysis used chi-square statistical test. The results showed that there was a correlation between adherence using Personal
Intelligent design som videnskab?
DEFF Research Database (Denmark)
Klausen, Søren Harnow
2007-01-01
Diskuterer hvorvidt intelligent design kan betegnes som videnskab; argumenterer for at dette grundet fraværet af klare demarkationskriterier næppe kan afvises.......Diskuterer hvorvidt intelligent design kan betegnes som videnskab; argumenterer for at dette grundet fraværet af klare demarkationskriterier næppe kan afvises....
Directory of Open Access Journals (Sweden)
R. V. Parish
2001-10-01
Full Text Available The asymmetrical tripodal tetraamine ligand N[(CH23NH2]2[(CH22NH2] (ppe was condensed with 2-acetylpyridine in the presence of nickel(II ion. In ethanolwater solution the reaction stops after the first stage of condensation, and a new nickel(II complex of an acyclic pentadentate (N5 mono Schiff base ligand was obtained. X-ray structure analysis of the resulting complex, [Ni(ppe-py(H2O](ClO42, indicates that condensation with 2-acetylpyridine is at the propylene chain of ppe. The geometry around the nickel ion is distorted octahedral in which the sixth co-ordination group is a solvent molecule.
Ostchega, Y; Harris, T B; Hirsch, R; Parsons, V L; Kington, R; Katzoff, M
2000-09-01
This report provides reliability and prevalence estimates by sex, age, and race/ethnicity of an observed physical performance examination (PPE) assessing mobility and balance. The Third National Health and Nutrition Examination Survey (NHANES III) 1988-1994. A cross-sectional nationally representative survey. All persons aged 60 and older (n = 5,403) who performed the PPE either in the mobile examination center (MEC) or in the home during NHANES III (conducted 1988-1994). The PPE included timed chair stand, full tandem stand, and timed 8-foot walk. Timed chair stand and 8-foot timed walk were reliable measurements (Intraclass Correlations > 0.5). Women were significantly slower (P physically limited than men.
Houwelingen, T.; Kistemaker, L.A.; Kant, S. de; Hartog, E.A. den
2010-01-01
The past decades show an increasing variety in the design and application of personal protective equipment, PPE. Even within the PPE aimed at CBRN protection the future user can choose from a bewildering amount of producers and models. To make his predicament even worse he also has to deal with a
Mi, Hongyu; Guan, Mingming; Liu, Jilin; Shan, Hongyan; Fei, Qiang; Huan, Yanfu; Feng, Guodong
2017-04-01
In this work, a turn on fluorescent sensor, based on Hg2 + coordination conjugated polymer, was developed to detect cysteine-containing compounds. The fluorescence of conjugated polymer (poly(2,5-bis (sodium 4-oxybutyrate) -1,4 - phenylethynylene-alt-1,4-phenyleneethynylene; PPE-OBS) would be quenched by Hg2 + because of the coordination-induced aggregation and electron transfers of PPE-OBS toward Hg2 +. When there were some cysteine-containing compounds in PPE-OBS-Hg2 + system, the fluorescence of PPE-OBS would be recovered. It indicated that the PPE-OBS-Hg2 + system could be used to detect cysteine-containing compounds. Under the optimized conditions, the experiment results showed that there were particularly linear range, high sensitivity and selectivity over other amino acids. The limit of detection (LOD) of cysteine (Cys), homocysteine (Hcy) and glutathione (GSH) were 0.725 μmol L- 1, 0.982 μmol L- 1 and 1.21 μmol L- 1 by using this sensor. In addition, Cys standard recovery in several green tea drink and honey samples was also demonstrated. The recovery of Cys was range from 96.3 to 105.0% and RSD was less than 3.25%. The satisfactory results demonstrated that the proposed method could be as a potential fluorescent method for determining cysteine-containing compounds in real samples.
Andrade-Rivas, Federico; Rother, Hanna-Andrea
2015-10-01
The high exposure risks of workers to herbicides in low- and middle-income countries is an important public health concern because of the potential resulting negative impacts on workers' health. This study investigated workers' personal protective equipment (PPE) compliance as a risk mitigation measure; particularly workers who apply herbicides for Working for Water (WfW) - a South African invasive alien vegetation control programme. The study aim was to understand workers' low PPE compliance by analysing their risk perceptions of herbicide use, working conditions and socio-cultural context. Research methods included ethnographic observations, informal interviews, visual media, questionnaires and a focus group. Study results indicated that low PPE compliance persists despite workers' awareness of herbicide exposure risks and as a result of the influence from workers' socio-cultural context (i.e. gender dynamics and social status), herbicide risk perceptions and working conditions (i.e. environmental and logistical). Interestingly, teams comprised of mostly women had the highest compliance rate. These findings highlighted that given the complexity of PPE compliance, especially in countries with several economic and social constraints, exposure reduction interventions should not rely solely on PPE use promotion. Instead, other control strategies requiring less worker input for effectiveness should be implemented, such as elimination and substitution of highly hazardous pesticides, and altering application methods. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.
[SOMATOTYPE, NUTRITIONAL STATUS AND BLOOD GLUCOSE LEVEL OF PHYSICAL EDUCATION STUDENTS].
Valdés-Badilla, Pablo; Salvador Soler, Noemí; Godoy-Cumillaf, Andrés; Carmona-López, María Ines; Fernández, Juan José; Durán-Agüero, Samuel
2015-09-01
classical studies have compared the glycemia with the nutritional status in both children and adults; however studies that consider also somatotype are unknown. associating the somatotype and nutritional status with the glycemic level of students of Pedagogy in Physical Education (PPE). the sample included 40 subjects, divided between 13 women and 27 men. It was determined in each subject BMI, somatotype and also a fasting blood glucose sample was obtained. the somatotype in male PPE students was mesomorphic (3-2-2) with a nutritional status of overweight (25 kg/m2) and balanced mesomorphic (4-4-2) with normal weight (22 kg/m2) in women PPE students. While average fasting blood glucose was 69 mg / dl. No association between somatotype and BMI with blood sugar levels of students of PPE, however, women of PEF showed significant positive correlations between mesomorphy and the ICC (0.577) and between glycemia and height (0.650). somatotype and BMI of the students of PPE are consistent with their age and sex, but no association between somatotype and glucose was observed. Moreover, the average blood glucose levels were somewhat lower compared to normative tables, a situation that could be related to physical activity, however, requires further study to confirm it. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Occupational safety beliefs among Latino residential roofing workers.
Arcury, Thomas A; Summers, Phillip; Carrillo, Lourdes; Grzywacz, Joseph G; Quandt, Sara A; Mills, Thomas H
2014-06-01
This analysis describes beliefs about work safety and personal protective equipment (PPE) among Latino roofing workers, it delineates their perceptions of work environment characteristics that affect work safety and PPE use, and it describes how they experience work injuries and the consequences of these injuries. In-depth interviews were completed with 10 current and former Latino residential roofers. Interview transcripts were subjected to systematic qualitative analysis. Participants' valued productivity over safety, and this had a negative influence on their safety behavior and reduced their PPE use. They understood that roofing was hazardous. They limited use of PPE when they felt it reduced productivity and when it was uncomfortable. Work environment characteristics that affected safety included company size, the physical demands of the job, lack of training, the need for work, general life stress, and distractions at work. An injury had to result in lost work time to be considered significant. Access to health care is limited by employers not providing Workers' compensation. Future research is needed to substantiate these descriptive results and to delineate factors that are associated with safety behavior and use of PPE. Interventions, based on a lay health educator model, are needed to improve safety in this population. Safety regulations need to be evaluated and their enforcement needs to be improved. © 2013 Wiley Periodicals, Inc.
Kuhu on Tiiger tänaseks jõudnud? / Enel Mägi
Mägi, Enel
2003-01-01
Autor teeb ülevaate Tiigrihüppe programmi raames saavutatust alates 1997. aastast ja edasist arengut takistavatest teguritest, mille tõttu Tiigrihüppe Pluss programm on hakanud venima. Diagrammid: õpilaste ja arvuti suhe maakonniti 2003. a. alguses; internetiühendused Eesti koolides 2003. a. alguses; arvutite paiknemine koolis 2002. a. lõpus
Venderbosch, R.W.; Meijer, H.E.H.; Lemstra, P.J.
1994-01-01
A new processing route for poly(2,6-dimethyl-1,4-phenylene ether) (PPE), an intractable polymer on account of its thermal and oxidative sensitivity, was explored. PPE can be dissolved at elevated temperatures in epoxy resin and these solutions can then be processed at temperatures as low as 175°C.
A comprehensive and cost-effective preparticipation exam implemented on the World Wide Web.
Peltz, J E; Haskell, W L; Matheson, G O
1999-12-01
Mandatory preparticipation examinations (PPE) are labor intensive, offer little routine health maintenance and are poor predictors of future injury or illness. Our objective was to develop a new PPE for the Stanford University varsity athletes that improved both quality of primary and preventive care and physician time efficiency. This PPE is based on the annual submission, by each athlete, of a comprehensive medical history questionnaire that is then summarized in a two-page report for the examining physician. The questionnaire was developed through a search of MEDLINE from 1966 to 1997, review of PPE from 11 other institutions, and discussion with two experts from each of seven main content areas: medical and musculoskeletal history, eating, menstrual and sleep disorders, stress and health risk behaviors. Content validity was assessed by 10 sports medicine physicians and four epidemiologists. It was then programmed for the World Wide Web (http:// www.stanford.edu/dept/sportsmed/). The questionnaire demonstrated a 97 +/- 2% sensitivity in detecting positive responses requiring physician attention. Sixteen physicians administered the 1997/98 PPE; using the summary reports, 15 found improvement in their ability to provide overall medical care including health issues beyond clearance; 13 noted a decrease in time needed for each athlete exam. Over 90% of athletes who used the web site found it "easy" or "moderately easy" to access and complete. Initial assessment of this new PPE format shows good athlete compliance, improved exam efficiency and a strong increase in subjective physician satisfaction with the quality of screening and medical care provided. The data indicate a need for improvement of routine health maintenance in this population. The database offers opportunities to study trends, risk factors, and results of interventions.
Directory of Open Access Journals (Sweden)
DL Levesque
2012-03-01
Full Text Available Background: There are inconsistencies about the effects of farmworker housing and workplace conditions and use of self-protective behavior practices and personal protective equipment (PPE. Objective: To investigate the association between workplace and housing conditions and farmworker use of pesticide safety practices and PPE. Methods: This study was conducted in 4 counties in North Carolina, USA, from July to October, 2010, during the agricultural growing season. Farmworkers working in agriculture aged 18 to 62 (n=187 were administered a structured questionnaire to collect self-reported measures on housing and workplace conditions. Use of pesticide safety and PPE were examined by asking questions about wearing gloves, wearing socks, and wearing a hat. Chi-square and multiple logistic regression analyses were used for statistical analyses. Results: Farmworkers reporting availability of enough hot and cold water for bathing and doing laundry were 13.6 times more likely to use pesticide safety practices (adjusted OR: 13.6, 95% CI: 1.4–135.4, whereas, those who reported that soap for handwashing was always or usually available while doing agricultural work were 7.8 times more likely to use pesticide safety practices (adjusted OR: 7.8, 95% CI: 3.3–18.5. Farmworkers that reported access to water to wash their hands with while performing agricultural work were more likely to use PPE (adjusted OR: 3.4, 95% CI: 1.3–9.2. Conclusions: Some migrant farmworker labor camps are not supplying acceptable housing conditions such as 1 handwashing sink per 6 people (n=10, 5.4%. Use of pesticide safety practices and PPE is greater when farmers provide decontamination supplies. Improvement of housing and workplace conditions are crucial to increase use of pesticide safety practices and PPE.
International Nuclear Information System (INIS)
Al Zadjali, Said; Morse, Stephen; Chenoweth, Jonathan; Deadman, Mike
2015-01-01
The level of uptake and use of personal protective equipment (PPE) by farm workers in Oman is low; the conditions under which pesticides are stored are frequently below acceptable international standards. Research was undertaken to explore the drivers working against safe storage of agrochemicals and effective personal protection usage by pesticide application personnel. Results from a survey of over 200 respondents, representing workers in, and owners of, farms either within or outside a local farmer's association (FA), suggest that FA membership raises standards of behaviour both in terms of safe pesticide storage and use of PPE. Age of respondents had no apparent effect on the likelihood of PPE (gloves and masks) use. PPE use was, however, highest among respondents with more advanced educational backgrounds. Positive responses for glove and mask use, when applying pesticides, were higher for owners and workers in FA farms compared to non-FA farms. Lowest reported use of PPE was among workers in non-FA farms. Analysis of responses appears to indicate that behaviour patterns of workers in FA farms mirror that of the farm owners. This was not the case in non-FA farms. The results suggest that conformity to social norms, in this case acceptable work-environment behaviour, is a powerful driver behind raised usage levels of PPE in farms in Oman. - Highlights: • Pesticide-related safety standards are frequently poor on many farms in Northern Oman. • Pesticides are frequently stored within the living accommodation of farm workers. • Safety standards generally increase with the education status of farm workers. • A local farmers’ association (FA) has the effect of raising safety standards on member’s farms. • FA farm workers are more likely to conform to the behaviour shown by owners of FA farms
Energy Technology Data Exchange (ETDEWEB)
Al Zadjali, Said [Ministry of Environment and Climate Affairs, PO Box 321, Muscat 100 (Oman); Centre for Environmental Strategy, Faculty of Engineering and Physical Sciences, University of Surrey, Guildford, Surrey GU2 7JH (United Kingdom); Morse, Stephen; Chenoweth, Jonathan [Centre for Environmental Strategy, Faculty of Engineering and Physical Sciences, University of Surrey, Guildford, Surrey GU2 7JH (United Kingdom); Deadman, Mike, E-mail: mikedead@squ.edu.om [Department of Crop Sciences, College of Agricultural and Marine Sciences, Sultan Qaboos University, PO Box 34, Al Khod 123 (Oman)
2015-01-01
The level of uptake and use of personal protective equipment (PPE) by farm workers in Oman is low; the conditions under which pesticides are stored are frequently below acceptable international standards. Research was undertaken to explore the drivers working against safe storage of agrochemicals and effective personal protection usage by pesticide application personnel. Results from a survey of over 200 respondents, representing workers in, and owners of, farms either within or outside a local farmer's association (FA), suggest that FA membership raises standards of behaviour both in terms of safe pesticide storage and use of PPE. Age of respondents had no apparent effect on the likelihood of PPE (gloves and masks) use. PPE use was, however, highest among respondents with more advanced educational backgrounds. Positive responses for glove and mask use, when applying pesticides, were higher for owners and workers in FA farms compared to non-FA farms. Lowest reported use of PPE was among workers in non-FA farms. Analysis of responses appears to indicate that behaviour patterns of workers in FA farms mirror that of the farm owners. This was not the case in non-FA farms. The results suggest that conformity to social norms, in this case acceptable work-environment behaviour, is a powerful driver behind raised usage levels of PPE in farms in Oman. - Highlights: • Pesticide-related safety standards are frequently poor on many farms in Northern Oman. • Pesticides are frequently stored within the living accommodation of farm workers. • Safety standards generally increase with the education status of farm workers. • A local farmers’ association (FA) has the effect of raising safety standards on member’s farms. • FA farm workers are more likely to conform to the behaviour shown by owners of FA farms.
International Nuclear Information System (INIS)
Hylko, J. M.; Thompson, A. L.; Walter, J. F.; Deecke, T. A.
2002-01-01
Selecting the appropriate personal protective equipment (PPE) is based on providing an adequate level of employee protection relative to the task-specific conditions and hazards. PPE is categorized into four ensembles, based on the degree of protection afforded; e.g., Levels A (most restrictive), B, C, and D (least restrictive). What is often overlooked in preparing an ensemble is that the PPE itself can create significant worker hazards; i.e., the greater the level of PPE, the greater the associated risks. Furthermore, there is confusion as to whether a more ''conservative approach'' should always be taken since Level B provides the same level of respiratory protection as Level A but less skin protection. This paper summarizes the Occupational Safety and Health Administration regulations addressing Level A versus Level B, and provides justification for selecting Level B over Level A without under-protecting the employee during a particular remediation scenario. The scenario consisted of an entry team performing (1) an initial entry into a room containing concentrated acids (e.g., hydrofluoric acid), bases, and radiological constituents; (2) sampling and characterizing container contents; and (3) retrieving characterized containers. The invasive nature of the hydrofluoric acid sampling and characterization scenario created a high potential for splash, immersion, and exposure to hazardous vapors, requiring additional skin protection. The hazards associated with this scenario and the chemical nature of hydrofluoric acid provided qualitative evidence to justify Level A. Once the hydrofluoric acid was removed from the room, PPE performance was evaluated against the remaining chemical inventory. If chemical breakthrough from direct contact was not expected to occur and instrument readings confirmed the absence of any hazardous vapors, additional skin protection afforded by wearing a vapor-tight, totally-encapsulated suit was not required. Therefore, PPE performance and
Paris polyphylla extract inhibits proliferation and promotes apoptosis ...
African Journals Online (AJOL)
Purpose: To investigate the effect of Paris polyphylla extract (PPE) on proliferation and apoptosis in A549 human lung cancer cells. Methods: Morphological changes were examined by microscopy in A549 cells after exposure to PPE. Trypan blue staining of living cells was used to aid the construction of the cell growth curve ...
Lipopeptide biosurfactants from Paenibacillus polymyxa inhibit single and mixed species biofilms.
Quinn, Gerry A; Maloy, Aaron P; McClean, Stephen; Carney, Brian; Slater, John W
2012-01-01
Although biofilms are recognised as important in microbial colonisation, solutions to their inhibition are predominantly based on planktonic assays. These solutions have limited efficacy against biofilms. Here, a series of biofilm-orientated tests were used to identify anti-biofilm compounds from marine micro-flora. This led to the isolation of a complex of anti-biofilm compounds from an extract of Paenibacillus polymyxa (PPE). A combination of rpHPLC and mass spectrometry identified the principle components of PPE as fusaricidin B (LI-FO4b) and polymyxin D1, with minor contributions from surfactins. This complex (PPE) reduced the biofilm biomass of Bacillus subtilis, Micrococcus luteus, Pseudomonas aeruginosa, Staphylococcus aureus and Streptococcus bovis. In contrast, ampicillin was only effective against S. aureus. PPE also inhibited a self-assembling marine biofilm (SAMB) in co-incubation assays by 99.3% ± 1.9 and disrupted established SAMB by 72.4% ± 4.4, while ampicillin showed no significant reduction. The effectiveness of this complex of lipopeptides against single and multispecies biofilms suggests a future role in biofilm prevention strategies.
IL-23 Is Essential for the Development of Elastase-Induced Pulmonary Inflammation and Emphysema.
Fujii, Utako; Miyahara, Nobuaki; Taniguchi, Akihiko; Waseda, Koichi; Morichika, Daisuke; Kurimoto, Etsuko; Koga, Hikari; Kataoka, Mikio; Gelfand, Erwin W; Cua, Daniel J; Yoshimura, Akihiko; Tanimoto, Mitsune; Kanehiro, Arihiko
2016-11-01
We recently reported that IL-17A plays a critical role in the development of porcine pancreatic elastase (PPE)-induced emphysema. The proliferation of T-helper type 17 (Th17) cells was induced by IL-23. To determine the contribution of IL-23 to the development of pulmonary emphysema, a mouse model of PPE-induced emphysema was used in which responses of IL-23p19-deficient (IL-23 -/- ) and wild-type (WT) mice were compared. Intratracheal instillation of PPE induced emphysematous changes in the lungs and was associated with increased levels of IL-23 in lung homogenates. Compared with WT mice, IL-23 -/- mice developed significantly lower static compliance values and markedly reduced emphysematous changes on histological analyses after PPE instillation. These changes were associated with lower levels of IL-17A and fewer Th17 cells in the lung. The neutrophilia seen in bronchoalveolar lavage fluid of WT mice was attenuated in IL-23 -/- mice, and the reduction was associated with decreased levels of keratinocyte-derived cytokine and macrophage inflammatory protein-2 in bronchoalveolar lavage fluid. Treatment with anti-IL-23p40 monoclonal antibody significantly attenuated PPE-induced emphysematous changes in the lungs of WT mice. These data identify the important contributions of IL-23 to the development of elastase-induced pulmonary inflammation and emphysema, mediated through an IL-23/IL-17 pathway. Targeting IL-23 in emphysema is a potential therapeutic strategy for delaying disease progression.
Use of Personal Protective Equipment among Building Construction Workers in Kampala, Uganda
Directory of Open Access Journals (Sweden)
Jonathan Izudi
2017-01-01
Full Text Available Background. 270 million workplace accidents occur annually. In Uganda, Kampala district has the highest workplace injury and fatality rates. However, information on personal protective equipment (PPE—hand gloves, hardhats, overalls, safety boots, earplugs, safety harness with lanyard, and face shields—utilization among building construction workers remains scarce. We assessed PPE utilization and determinants among building construction workers in Kampala, Uganda. Methods. This cross-sectional study involved 385 respondents. Data collected by structured questionnaire was double-entered in EpiData and analyzed in STATA at 5% significance level. Independent determinants of PPE use were established by a stepwise backward logistic regression analysis. Results. 305 (79.2% respondents were males, 290 (75.3% were 18–30 years, 285 (74.0% completed secondary education, and 197 (51.2% were temporary employees. 60 (15.6% respondents used PPE. Female sex (adjusted odds ratio (AOR = 6.64; 95% CI: 1.55–28.46; P=0.011, temporary (AOR = 0.05; 95% CI: 0.01–0.27; P<0.001 and casual (AOR = 0.01; 95% CI: 0.001–0.071; P<0.001 employment, and previous knowledge of safety measures (AOR = 100.72; 95% CI: 26.00–390.16; P<0.001 were associated with PPE use. Conclusion. PPE use was low in Kampala, Uganda. Building construction companies should implement measures of the Uganda Occupational Health and Safety Act.
Ip, Philip P C; Irving, Julie A; McCluggage, W Glenn; Clement, Philip B; Young, Robert H
2013-02-01
Papillary proliferation of the endometrium (PPE) without cytologic atypia is uncommon and has only been studied in detail by Lehman and Hart in 2001. On histologic examination, PPE ranges from simple papillae with fibrovascular cores, often involving the surface of endometrial polyps, to complex intracystic proliferations; some consider the latter to be analogous to nonatypical complex hyperplasia. To further characterize PPE, with emphasis on the risk of and features associated with concurrent or subsequent neoplasia, the clinicopathologic features of 59 cases without cytologic atypia were studied. The cases were classified into 2 groups according to the degree of architectural complexity and extent of proliferation. Group 1 consisted of those with localized simple papillae. Simple papillae were defined as those with short, predominantly nonbranching stalks; those with occasional secondary branches and/or detached papillae were also included in this group. Localized proliferations were those with 1 or 2 foci involving the surface or the subjacent glands of polyps or nonpolypoid endometrium. Group 2 consisted of those with complex papillae and/or those with diffuse and crowded intracystic papillae. Complex papillae were those with either short or long stalks, with frequent secondary and complex branches. Diffuse proliferation was defined as presence of 3 or more foci within a specimen or involvement of >50% of the endometrial polyp by simple or complex PPE. Any coexistent or subsequent hyperplasia of conventional type (World Health Organization classification) or adenocarcinoma was recorded. The age of patients ranged from 23 to 82 years (median, 53 y); 36 (61%) were postmenopausal. The majority presented with abnormal vaginal bleeding. Sixteen patients (27%) were receiving hormonal preparations including 5 who were treated with a progestogen for preexisting endometrial hyperplasia or low-grade endometrioid adenocarcinoma. The histologic diagnosis of PPE was made
Directory of Open Access Journals (Sweden)
Jana Hönke
2011-01-01
Full Text Available Review of the monograph: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 pp.Besprechung der Monographie: Katja Werthmann, Bitteres Gold: Bergbau, Land und Geld in Westafrika, Köln: Rüdiger Köppe Verlag, 2009, ISBN 978-3-89645-821-6, 260 Seiten.
Campbell, Aaron D; McIntosh, Scott E; Nyberg, Andy; Powell, Amy P; Schoene, Robert B; Hackett, Peter
2015-12-01
High-altitude athletes and adventurers face a number of environmental and medical risks. Clinicians often advise participants or guiding agencies before or during these experiences. Preparticipation evaluation (PPE) has the potential to reduce risk of high-altitude illnesses in athletes and adventurers. Specific conditions susceptible to high-altitude exacerbation also important to evaluate include cardiovascular and lung diseases. Recommendations by which to counsel individuals before participation in altitude sports and adventures are few and of limited focus. We reviewed the literature, collected expert opinion, and augmented principles of a traditional sport PPE to accommodate the high-altitude wilderness athlete/adventurer. We present our findings with specific recommendations on risk stratification during a PPE for the high-altitude athlete/adventurer. Copyright © 2015. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Naomi Vembriati
2015-10-01
Full Text Available One of the factors causing high rates of workplace accidents is the human factor, i.e., the view that the use of Personal Protective Equipment (PPE will cause the work discomfort and reduce the work speed so it will reduce the productivity. This attitude discourages employees to use PPE set by the company. This study was aimed to determine the effect of the provision of information and structured discussion on changes in employee attitudes towards the use of PPE. The design of experiment used in this research was multiple treatments and control with pretest, which involved two experimental groups and one control group. The first experimental group (EG1 was treated with the provision of information (academic detailing and structured discussion. The second experimental group (EG2 received structured discussion without any provision of information. The control group (CG was not given any treatment. The study involved 48 subjects, i.e. 16 people on EG1, 17 people on EG2, and 15 people in the CG. Statistical analysis using mixed ANOVA showed that there was a significant change in attitude towards the use of PPE (F=12.670; p0.05.
An analytic approach to 2D electronic PE spectra of molecular systems
International Nuclear Information System (INIS)
Szoecs, V.
2011-01-01
Graphical abstract: The three-pulse photon echo (3P-PE) spectra of finite molecular systems using direct calculation from electronic Hamiltonians allows peak classification from 3P-PE spectra dynamics. Display Omitted Highlights: → RWA approach to electronic photon echo. → A straightforward calculation of 2D electronic spectrograms in finite molecular systems. → Importance of population time dynamics in relation to inter-site coherent coupling. - Abstract: The three-pulse photon echo (3P-PE) spectra of finite molecular systems and simplified line broadening models is presented. The Fourier picture of a heterodyne detected three-pulse rephasing PE signal in the δ-pulse limit of the external field is derived in analytic form. The method includes contributions of one and two-excitonic states and allows direct calculation of Fourier PE spectrogram from corresponding Hamiltonian. As an illustration, the proposed treatment is applied to simple systems, e.g. 2-site two-level system (TLS) and n-site TLS model of photosynthetic unit. The importance of relation between Fourier picture of 3P-PE dynamics (corresponding to nonzero population time, T) and coherent inter-state coupling is emphasized.
Fletcher, Tom E; Gulzhan, Abuova; Ahmeti, Salih; Al-Abri, Seif S; Asik, Zahide; Atilla, Aynur; Beeching, Nick J; Bilek, Heval; Bozkurt, Ilkay; Christova, Iva; Duygu, Fazilet; Esen, Saban; Khanna, Arjun; Kader, Çiğdem; Mardani, Masoud; Mahmood, Faisal; Mamuchishvili, Nana; Pshenichnaya, Natalia; Sunbul, Mustafa; Yalcin, Tuğba Y; Leblebicioglu, Hakan
2017-01-01
Crimean Congo Hemorrhagic Fever (CCHF) is a life threatening acute viral infection that presents significant risk of nosocomial transmission to healthcare workers. Evaluation of CCHF infection prevention and control (IP&C) practices in healthcare facilities that routinely manage CCHF cases in Eurasia. A cross-sectional CCHF IP&C survey was designed and distributed to CCHF centers in 10 endemic Eurasian countries in 2016. Twenty-three responses were received from centers in Turkey, Pakistan, Russia, Georgia, Kosovo, Bulgaria, Oman, Iran, India and Kazakhstan. All units had dedicated isolation rooms for CCHF, with cohorting of confirmed cases in 15/23 centers and cohorting of suspect and confirmed cases in 9/23 centers. There was adequate personal protective equipment (PPE) in 22/23 facilities, with 21/23 facilities reporting routine use of PPE for CCHF patients. Adequate staffing levels to provide care reported in 14/23 locations. All centers reported having a high risk CCHFV nosocomial exposure in last five years, with 5 centers reporting more than 5 exposures. Education was provided annually in most centers (13/23), with additional training requested in PPE use (11/23), PPE donning/doffing (12/23), environmental disinfection (12/23) and waste management (14/23). Staff and patient safety must be improved and healthcare associated CCHF exposure and transmission eliminated. Improvements are recommended in isolation capacity in healthcare facilities, use of PPE and maintenance of adequate staffing levels. We recommend further audit of IP&C practice at individual units in endemic areas, as part of national quality assurance programs.
International Nuclear Information System (INIS)
2004-01-01
This Practical Radiation Technical Manual is one of a series that has been designed to provide guidance on radiological protection for employers, radiation protection officers, managers and other technically competent persons who have responsibility for ensuring the safety of employees working with ionizing radiation. The Manual may be used with the appropriate IAEA Practical Radiation Safety Manuals to provide training, instruction and information for all employees engaged in work with ionizing radiation. Personal protective equipment (PPE) includes clothing or other special equipment that is issued to individual workers to provide protection against actual or potential exposure to ionizing radiations. It is used to protect each worker against the prevailing risk of external or internal exposure in circumstances in which it is not reasonably practicable to provide complete protection by means of engineering controls or administrative methods. Adequate personal protection depends on PPE being correctly selected, fitted and maintained. Appropriate training for the users and arrangements to monitor usage are also necessary to ensure that PPE provides the intended degree of protection effectively. This Manual explains the principal types of PPE, including protective clothing and respiratory protective equipment (RPE). Examples of working procedures are also described to indicate how PPE should be used within a safe system of work. The Manual will be of most benefit if it forms part of a more comprehensive training programme or is supplemented by the advice of a qualified expert in radiation protection. Some of the RPE described in this Manual should be used under the guidance of a qualified expert
Haas, Mitchell; Aickin, Mikel; Vavrek, Darcy
2010-01-01
The purpose of this article was to present a preliminary model to identify the effects of expectancy of treatment success and the patient-provider encounter (PPE) on outcomes in an open-label randomized trial. Eighty participants with chronic cervicogenic headache (CGH) were randomized to 4 groups: 2 levels of treatment dose (8 or 16) and 2 levels of therapy from a chiropractor (spinal manipulation or light massage). Providers were instructed to have equal enthusiasm for all care. Structural equation modeling with standardized path coefficients (beta) was used in a path analysis to identify the effects of patient expectancy and the PPE on CGH pain. The model included monthly pain from baseline to 12 weeks. Expectancy and PPE were evaluated on Likert scales. The patient-provider encounter was measured as patient perception of chiropractor enthusiasm, confidence, and comfort with care. Baseline patient expectancy was balanced across groups. The PPE measures were balanced across groups and consistent over the 8-week treatment period. Treatment and baseline pain had the strongest effects on pain outcomes (|beta| = .46-.59). Expectations had little effect on pain (abs value(beta) value(beta)= .03-.27) and on subsequent confidence in treatment success (abs value(beta)= .09 and .12). Encouraging equipoise in the PPE and balancing expectancy across treatment groups may protect against some confounding related to the absence of blinding in a randomized controlled trial of pain. In this trial, their effects were found to be small relative to the effects of treatment and baseline values. Copyright 2010 National University of Health Sciences. Published by Mosby, Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Soojin Park
2016-01-01
Full Text Available Epidemiological and experimental evidence support health risks associated with the exposure to airborne particulate matter with a diameter of <10 μM (PM10. PM10 stimulates the production of reactive oxygen species (ROS and inflammatory mediators. Thus, we assumed that natural antioxidants might provide health benefits attenuating hazardous effects of PM10. In the present study, we examined the effects of pomegranate peel extract (PPE on THP-1 monocytic cells exposed to PM10. PM10 induced cytotoxicity and the production of ROS. It also increased the expression and secretion of inflammatory cytokines, such as tumor necrosis factor-α (TNF-α, interleukin-1β (IL-1β, and monocyte chemoattractant protein-1 (MCP-1, and cell adhesion molecules, such as intercellular adhesion molecule-1 (ICAM-1 and vascular cell adhesion molecule-1 (VCAM-1. PPE at 10–100 μg mL−1 attenuated the production of ROS and the expression of TNF-α, IL-1β, MCP-1, and ICAM-1, but not VCAM-1, in THP-1 cells stimulated by PM10 (100 μg mL−1. PPE also attenuated the adhesion of PM10-stimulated THP-1 cells to EA.hy926 endothelial cells. PPE constituents, punicalagin and ellagic acid, attenuated PM10-induced monocyte adhesion to endothelial cells, and punicalagin was less cytotoxic compared to ellagic acid. The present study suggests that PPE and punicalagin may be useful in alleviating inflammatory reactions due to particulate matter.
DEFF Research Database (Denmark)
Tonboe, Jens
2007-01-01
Kommissionens forslag bidrager næppe til bedre balance mellem familie- og arbejdsliv, men derimod nok til mere arbejde for børnefamilierne - helt i overensstemmelse med regeringens generelle politik på arbejdsmarkedet.......Kommissionens forslag bidrager næppe til bedre balance mellem familie- og arbejdsliv, men derimod nok til mere arbejde for børnefamilierne - helt i overensstemmelse med regeringens generelle politik på arbejdsmarkedet....
Hydrogen sulfide suicide: a new trend and threat to healthcare providers.
Ruder, John B; Ward, Jeanette G; Taylor, Scott; Giles, Karon; Higgins, Thomas; Haan, James M
2015-01-01
First popularized in Japan, hydrogen sulfide (H2S) gas suicide is an underreported form of suicide with known risk for secondary disaster. Mortality rate commonly exceeds 90% because of the gas's lethal, noncontained nature. Instances in the United States are increasing, up from 2 cases in 2008 to 18 in 2010. Because H2S poisonings remain rare, there exists a lack of knowledge regarding the residual effects of gas venting after victim extrication. Identifying instances of the efficacious use of personal protection equipment (PPE) is critical in the effort to alleviate risks faced by hospital and rescue personnel. The current case demonstrates the effective use of PPEs after prolonged H2S exposure. In 2011, a 20-year-old man threatened suicide using H2S gas inside a vehicle on a remote rural highway. First responders identified a "rotten egg smell" and subsequently experienced low poisoning symptoms. After prolonged Hazmat-assisted extrication (4 hours) the patient was unconscious and experiencing seizures. He was decontaminated on-scene (20 minutes) and transported to the closest hospital (22 minutes). Ambulance personnel who wore PPE and used the ambulance's reverse ventilation system (RVS)reported no adverse effects. The patient was transferred to the authors' burn facility by helicopter (38 minutes). Life-flight personnel, who did not wear PPE (no ventilatory system available), complained of watery eyes, headache, and dizziness. Hospital personnel, who did not use PPE (or RVS), complained of watery eyes or headache. Exposed personnel demonstrated no deficits or residual effects. In spite of spontaneous movement, the patient began to seize and died. This case is unique given the multiple primary and secondary H2S gas exposures involved. Exposed personnel without RVS and not using PPE demonstrated moderate H2S symptoms. PPE (self-contained breathing apparatuses) and RVS were shown to be effective during an H2S emergency; however, there are currently limited data
Free energy of mixing of acetone and methanol: a computer simulation investigation.
Idrissi, Abdenacer; Polok, Kamil; Barj, Mohammed; Marekha, Bogdan; Kiselev, Mikhail; Jedlovszky, Pál
2013-12-19
The change of the Helmholtz free energy, internal energy, and entropy accompanying the mixing of acetone and methanol is calculated in the entire composition range by the method of thermodynamic integration using three different potential model combinations of the two compounds. In the first system, both molecules are described by the OPLS, and in the second system, both molecules are described by the original TraPPE force field, whereas in the third system a modified version of the TraPPE potential is used for acetone in combination with the original TraPPE model of methanol. The results reveal that, in contrast with the acetone-water system, all of these three model combinations are able to reproduce the full miscibility of acetone and methanol, although the thermodynamic driving force of this mixing is very small. It is also seen, in accordance with the finding of former structural analyses, that the mixing of the two components is driven by the entropy term corresponding to the ideal mixing, which is large enough to overcompensate the effect of the energy increase and entropy loss due to the interaction of the unlike components in the mixtures. Among the three model combinations, the use of the original TraPPE model of methanol and modified TraPPE model of acetone turns out to be clearly the best in this respect, as it is able to reproduce the experimental free energy, internal energy, and entropy of mixing values within 0.15 kJ/mol, 0.2 kJ/mol, and 1 J/(mol K), respectively, in the entire composition range. The success of this model combination originates from the fact that the use of the modified TraPPE model of acetone instead of the original one in these mixtures improves the reproduction of the entropy of mixing, while it retains the ability of the original model of excellently reproducing the internal energy of mixing.
Murine inflammatory factor co-chromatographs with murine interleukin-2 activity
International Nuclear Information System (INIS)
Freitas, C.S.; Shinzato, T.O.; Maciel, C.M.M.; Rumjanek, V.M.
1986-01-01
In a study of the in vivo effects of semi-purified mouse interleukin-2 (IL-2), inflammatory activity indicated by edema and plasma protein extravasation (PPE) was detected in those fractions having IL-2 activity. The molecular weight of the inflammatory factor activity from conditioned medium was 30 to 48 kDal on the basis of gel filtration on Sephadex G75. The edema, characterized as maximum paw thickness, occurred at 4 h, whereas the PPE peak (measured with 125 I-albumin) occurred 1.5 to 3 h after injection. Both edema and PPE were inhibited by dexamethasone or indomethacin, suggesting the involvement of prostaglandins in the process. This inflammatory activity may be partly responsible for some of the in vivo activities ascribed to IL-2. (author) [pt
DEFF Research Database (Denmark)
Aydin, Dogu; Klit, Jakob; Jacobsen, Steffen
2015-01-01
the literature supports a positive effect of PPE on post-operative outcomes including anxiety, pain, length of hospital stay (LOS), patient satisfaction, post-operative complications, mobility, and expectations. METHODS: PubMed and Embase searches were performed on 1 October 2014. Randomised studies....... No convincing evidence in favour of PPE on outcomes regarding pain, LOS, patient satisfaction, post-operative complications, mobility and expectations was found. However, there was evidence for a reduction in preoperative anxiety. CONCLUSION: PPE has not been shown to affect post-operative outcomes - except...... for a significant reduction in preoperative anxiety. However, this conclusion may be flawed by the general heterogeneity of the pooled studies. Hence, there is a strong need for properly designed randomised and controlled studies that are sufficiently powered, performed in generalised optimised hospital settings...
Energy Technology Data Exchange (ETDEWEB)
King, David A. [Oak Ridge Inst. for Science and Education (ORISE), Oak Ridge, TN (United States)
2013-12-12
The U.S. Department of Energy (DOE) Oak Ridge Office of Environmental Management (OR-EM) requested that Oak Ridge Associated Universities (ORAU), working under the Oak Ridge Institute for Science and Education (ORISE) contract, provide technical and independent waste management planning support using American Recovery and Reinvestment Act (ARRA) funds. Specifically, DOE OR-EM requested that ORAU plan and implement a sampling and analysis campaign targeting potential removable radiological contamination that may be transferrable to future personal protective equipment (PPE) and contamination control materials—collectively referred to as PPE throughout the remainder of this report—used in certain URS|CH2M Oak Ridge, LLC (UCOR) Surveillance and Maintenance (S&M) Project facilities at the Oak Ridge National Laboratory (ORNL). Routine surveys in Bldgs. 3001, 3005, 3010, 3028, 3029, 3038, 3042, 3517, 4507, and 7500 continuously generate PPE. The waste is comprised of Tyvek coveralls, gloves, booties, Herculite, and other materials used to prevent worker exposure or the spread of contamination during routine maintenance and monitoring activities. This report describes the effort to collect and quantify removable activity that may be used by the ORNL S&M Project team to develop radiation instrumentation “screening criteria.” Material potentially containing removable activity was collected on smears, including both masselin large-area wipes (LAWs) and standard paper smears, and analyzed for site-related constituents (SRCs) in an analytical laboratory. The screening criteria, if approved, may be used to expedite waste disposition of relatively clean PPE. The ultimate objectives of this effort were to: 1) determine whether screening criteria can be developed for these facilities, and 2) provide process knowledge information for future site planners. The screening criteria, if calculated, must be formally approved by Federal Facility Agreement parties prior to use for
Robotic Sensitive-Site Assessment
2015-09-04
annotations. The SOA component is the backend infrastructure that receives and stores robot-generated and human-input data and serves these data to several...Architecture Server (heading level 2) The SOA server provides the backend infrastructure to receive data from robot situational awareness payloads, to archive...incapacitation or even death. The proper use of PPE is critical to avoiding exposure. However, wearing PPE limits mobility and field of vision, and
Quality of care and investment in property, plant, and equipment in hospitals.
Levitt, S W
1994-01-01
OBJECTIVE. This study explores the relationship between quality of care and investment in property, plant, and equipment (PPE) in hospitals. DATA SOURCES. Hospitals' investment in PPE was derived from audited financial statements for the fiscal years 1984-1989. Peer Review Organization (PRO) Generic Quality Screen (GQS) reviews and confirmed failures between April 1989 and September 1990 were obtained from the Massachusetts PRO. STUDY DESIGN. Weighted least squares regression models used PRO ...
Configuring and Exploring the Foundry Trade Space
2012-04-01
manufacturability implies the existence of a process plan and available resources, the MFE is closely related to the PPE and may internally embody...the PPE in its construction. For example, the MFE can answer queries as to a component’s manufacturability by attempting to generate a process plan...make it manufacturable. Conversely, the MFE could be built up from higher level heuristics and surrogate models, but these would ultimately need to
Nurses' Work Environment and Spirituality: A Descriptive Study
Directory of Open Access Journals (Sweden)
Zastrow Patricia
2009-01-01
Full Text Available Quality of care is a major health concern in the hospital setting. A work environment thatsupports professional nursing as well as the spirituality of nurses, or the meaning/purpose nurses find intheir work may contribute to quality of patient care. Yet, little is known about the nursing workenvironment and even less about the spirituality of nurses. Thus, the aims of this study were to measuremedical-surgical nurses’ perceived professional work environment score and perceived spiritual well-beingscore and determine if the two instruments are related. This cross-sectional survey consisted of aconvenience sample of 68 nurses who completed the Professional Practice Environment Scale (PPE andSpiritual Well-Being Scale (SWB on the hospital website during working hours. Several PPE subscalescores differed significantly among the various clinical units. As the nurse’s age, and years of clinicalexperience increased, specific PPE subscale scores also increased. The nurses’ mean SWB scores were allwithin the moderate range and did not differ significantly among the clinical units. The overall PPE andSWB scores were not significantly correlated. Nursing administrators can use the PPE scores from thisstudy to address the specific needs of individual clinical units. Older and more experienced nurses mayserve as resources for younger, less experienced nurses. Both instruments can be administered repeatedlyover time to monitor trends. Based on the SWB data, nurses in this study reported average levels ofspiritual well-being. However, there is a need to learn more about the specific spiritual needs of nurses.Spirituality of nurses as well as the nurse’s work environment are separate concepts that each merit furtherinvestigation and may add to the knowledge base for increased quality patient care.
Directory of Open Access Journals (Sweden)
Fabíola S Z Robertoni
Full Text Available To describe the progression of parenchymal remodeling and metalloproteinases gene expression in earlier stages of emphysema, mice received porcine pancreatic elastase (PPE instillation and Control groups received saline solution. After PPE instillation (1, 3, 6 hours, 3 and 21 days we measured the mean linear intercept, the volume proportion of types I and III collagen, elastin, fibrillin and the MMP-1, -8, -12 and -13 gene expression. We observed an initial decrease in type I (at the 3rd day and type III collagen (from the 6th hour until the 3rd day, in posterior time points in which we detected increased gene expression for MMP-8 and -13 in PPE groups. After 21 days, the type III collagen fibers increased and the type I collagen values returned to similar values compared to control groups. The MMP-12 gene expression was increased in earlier times (3 and 6 hours to which we detected a reduced proportion of elastin (3 days in PPE groups, reinforcing the already established importance of MMP-12 in the breakdown of ECM. Such findings will be useful to better elucidate the alterations in ECM components and the importance of not only metalloelastase but also collagenases in earlier emphysema stages, providing new clues to novel therapeutic targets.
Kim, Siyeon; Lee, Joo-Young
2016-04-01
The aim of this study was to investigate stable and valid measurement sites of skin temperatures as a non-invasive variable to predict deep-body temperature while wearing firefighters' personal protective equipment (PPE) during air temperature changes. Eight male firefighters participated in an experiment which consisted of 60-min exercise and 10-min recovery while wearing PPE without self-contained breathing apparatus (7.75 kg in total PPE mass). Air temperature was periodically fluctuated from 29.5 to 35.5 °C with an amplitude of 6 °C. Rectal temperature was chosen as a deep-body temperature, and 12 skin temperatures were recorded. The results showed that the forehead and chest were identified as the most valid sites to predict rectal temperature (R(2) = 0.826 and 0.824, respectively) in an environment with periodically fluctuated air temperatures. This study suggests that particular skin temperatures are valid as a non-invasive variable when predicting rectal temperature of an individual wearing PPE in changing ambient temperatures. Practitioner Summary: This study should offer assistance for developing a more reliable indirect indicating system of individual heat strain for firefighters in real time, which can be used practically as a precaution of firefighters' heat-related illness and utilised along with physiological monitoring.
Detection of capecitabine (Xeloda®) on the skin surface after oral administration
Huang, Mao-Dong; Fuss, Harald; Lademann, Jürgen; Florek, Stefan; Patzelt, Alexa; Meinke, Martina C.; Jung, Sora
2016-04-01
Palmoplantar erythrodysesthesia (PPE), or hand-foot syndrome, is a cutaneous toxicity under various chemotherapeutics contributing to the most frequent side effects in patients treated with capecitabine (Xeloda®). The pathomechanism of PPE has been unclear. Here, the topical detection of capecitabine in the skin after oral application was shown in 10 patients receiving 2500 mg/m2/day capecitabine. Sweat samples were taken prior to and one week after oral administration of capecitabine. Using high-resolution continuum source absorption spectrometry, the changes in concentrations of fluorine, which is an ingredient of capecitabine, were quantified and statistically analyzed. Here, we show an increase in fluorine concentrations from 40±10 ppb (2±0.5 pM) before capecitabine administration to 27.7±11.8 ppm (14.6±6.5 nM) after application, ptoxic effect as a possible pathomechanism of PPE.
Olson, Ryan; Grosshuesch, Ariel; Schmidt, Sara; Gray, Mary; Wipfli, Bradley
2009-10-01
The current project evaluated the effects of the collective behavior of multiple social models on the use of personal protective equipment (PPE). Prior to completing a simulated baggage-screening task, participants (N=64) watched a scripted training video that included three confederate trainees. Participants were randomly assigned to one of four manipulations, where different proportions of confederates were shown putting on over-ear sound mufflers before starting the task (0, 1, 2, or 3). White noise played at 70 decibels in the test room, and PPE use was observed unobtrusively through a lab window at five time intervals. The mean intervals of PPE use generally increased as the number of positive social models increased (0=0.63, 1=0.50, 2=1.25, 3=3.06), and differences between groups were significant [chi(2) (3, N=64)=14.92, preinforcement for compliance.
Khodarahmi, Iman; Shakeri, Mostafa; Sharp, M; Amini, Amir A
2010-01-01
Pressure gradient across a Gaussian-shaped 87% area stenosis phantom was estimated by solving the pressure Poisson equation (PPE) for a steady flow mimicking the blood flow through the human iliac artery. The velocity field needed to solve the pressure equation was obtained using particle image velocimetry (PIV). A steady flow rate of 46.9 ml/s was used, which corresponds to a Reynolds number of 188 and 595 at the inlet and stenosis throat, respectively (in the range of mean Reynolds number encountered in-vivo). In addition, computational fluid dynamics (CFD) simulation of the same flow was performed. Pressure drops across the stenosis predicted by PPE/PIV and CFD were compared with those measured by a pressure catheter transducer. RMS errors relative to the measurements were 17% and 10% for PPE/PIV and CFD, respectively.
Det politiske livs løsgående missiler
DEFF Research Database (Denmark)
Davidsen-Nielsen, Niels
2017-01-01
Eftertanken. Hvem ville De helst drikke et glas øl med, Donald Trump eller Mogens Glistrup? Selv ville jeg vælge Glistrup, selvom jeg næppe ville få indført et ord.......Eftertanken. Hvem ville De helst drikke et glas øl med, Donald Trump eller Mogens Glistrup? Selv ville jeg vælge Glistrup, selvom jeg næppe ville få indført et ord....
Ardian Setianto; Agung Juliarto
2014-01-01
The objective of this research is to analyze the implementation of IFRS and its relationship with the disclosure comparability of fixed assets or now called PPE (Property, Plant, and Equipment) in the financial statements. The variables used in this study is the application of IFRS which focused on disclosure comparability of PPE. This research is based on previous research conducted by Vergauwe and Gaeremynck (2013). The sample of this research was manufacturing company which ...
Produto Sustentável: Equipamento de Proteção Individual Fabricado com Plástico Verde
Boa Vista, Hamilton Aparecido; Universidade Nove de Julho - UNINOVE/GeAS, São Paulo; dos Santos, Mário Roberto; Universidade Nove de Julho - Uninove?PPGA, São Paulo; Shibao, Fábio Ytoshi; Universidade Nove de Julho - UNINOVE/GeAS, São Paulo
2015-01-01
This study analyzed the case of manufacturing of Personal Protective Equipment (PPE) using as raw material biopolymers produced from ethanol from sugar cane, known as green polypropylene, produced since 2008 by BRASKEM. This article studied the PPE for the employee’s head protection, named helmet by NR 6, which is used in situations of exposure to weather and work scenarios in places where there is risk of impact from falling or projecting objects, burns, electric shock, and solar radiation. ...
Directory of Open Access Journals (Sweden)
Yoga Firdaus
2017-01-01
Full Text Available Teknik penyederhanaan analisis digunakan untuk penentuan personal protective equipment (PPE dari bahaya busur api (arc-flash dengan berdasarkan IEEE std. 1584-2002 dan overcurrent protective device (OCPD. Tidak seperti persamaan penyederhanaan dalam IEEE 1584, teknik analisis ini berpotensi dapat diterapkan untuk semua jenis perangkat pelindung arus lebih pada setiap sistem kelistrikan yang berada dalam jangkauan persamaan empiris IEEE 1584. Saat sebuah metode tidak tepat menghitung tingkat energi insiden dan batas pelindung api (flash-protection pada bus, maka tidak dapat menentukan tingkat PPE yang dibutuhkan secara akurat dan batas jarak pelindung api (flash-protection yang maksimal untuk memungkinkan pekerja melindungi diri secara memadai terhadap bahaya busur api. Studi aktual mengenai penyederhanaan analisa busur api dilakukan pada Bandara Internasional Juanda. Pada hasil akhir dari analisa busur api dengan menggunakan metode kurva batasan energi didapatkan proses penentuan kategori PPE yang lebih singkat daripada standart IEEE 1584-2002.
Abu-Taha, M. I.; Abu-Teir, M. M.; Al-Jamal, A. J.; Eideh, H.
The aim of this work was to establish the feasibility of the combined photoacoustic (PA) and photopyroelectric (PPE) detection of the vapours emitted from essential oils and their corresponding uncrushed leaves or flowers. Gas traces of jasmine (Jessamine (Jasminum)), mint (Mentha arvensis L.) and Damask rose (Rosa damascena Miller) and their essential oils were tested using a combined cell fitted with both a photopyroelectric film (PVDF) and a microphone in conjunction with a pulsed wideband infrared source (PWBS) source. Infrared PA and PPE absorbances were obtained simultaneously at room temperatures with excellent reproducibility and high signal-to-noise ratios. Significant similarities found between the PA and PPE spectra of the trace gas emissions of plant parts, i.e., flowers or leaves and their related essential oils show the good correlation of their emissions and that both effects are initiated by the same absorbing molecules.
Disease Risk Perception and Safety Practices: A Survey of Australian Flying Fox Rehabilitators.
Directory of Open Access Journals (Sweden)
Cecilia A Sánchez
2016-02-01
Full Text Available Interactions with flying foxes pose disease transmission risks to volunteer rehabilitators (carers who treat injured, ill, and orphaned bats. In particular, Australian bat lyssavirus (ABLV can be transmitted directly from flying foxes to humans in Australia. Personal protective equipment (PPE and rabies vaccination can be used to protect against lyssavirus infection. During May and June 2014, active Australian flying fox carers participated in an online survey (SOAR: Survey Of Australian flying fox Rehabilitators designed to gather demographic data, assess perceptions of disease risk, and explore safety practices. Responses to open-ended questions were analysed thematically. A logistic regression was performed to assess whether rehabilitators' gender, use of PPE, threat perception, and years of experience predicted variation in their odds of being bitten or scratched. Eligible responses were received from 122 rehabilitators located predominantly on the eastern coast of Australia. Eighty-four percent of respondents were female. Years of experience ranged from <1 to 30 years (median 5 years. Respondents were highly educated. All rehabilitators were vaccinated against rabies and 94% received a rabies titre check at least every two years. Sixty-three percent of carers did not perceive viruses in flying foxes as a potential threat to their health, yet 74% of carers reported using PPE when handling flying foxes. Eighty-three percent of rehabilitators had received a flying fox bite or scratch at some point during their career. Carers provide an important community service by rescuing and rehabilitating flying foxes. While rehabilitators in this study have many excellent safety practices, including a 100% vaccination rate against rabies, there is room for improvement in PPE use. We recommend 1 the establishment of an Australia-wide set of guidelines for safety when caring for bats and 2 that the responsible government agencies in Australia support
Directory of Open Access Journals (Sweden)
Wen Chen
2016-07-01
Full Text Available Abstract Background In China, most of migrant workers work in the small and medium-sized enterprises (SMEs and are a vulnerable group for occupational health. Migrant workers are at increased risk of occupational health risks due to poor occupational health behaviours such as the low use of personal protective equipment (PPE. However, there is a lack of solid evidence regarding how to improve the use of PPE among migrant workers in SMEs. The current study will assess the effectiveness of a multi-pronged behavioural intervention designed to promote PPE utilization among migrant workers exposed to organic solvents in SMEs. Methods/Design This is a single blind, three-arm cluster randomized trial with 60 SMEs equally randomized to receive a top-down intervention (i.e. general health education and mHealth intervention provided by researchers or a comprehensive intervention (which includes both top-down intervention and peer education or a control condition (participants will not receive the intervention, but study measures will be obtained. Interventions will be conducted at the SMEs level for 6 months and all eligible migrant workers in these SMEs will be enrolled into the trial. The primary outcome is effective use of PPE during the last week. The secondary outcomes are occupational health knowledge and attitude and participation in occupational health check-up. Data will be collected and assessed at baseline; 3 months post baseline and the end of the intervention. Discussion This theory- and evidence based intervention will contribute to the limited evidence of behaviour change intervention in improving PPE utilization of migrant workers in SMEs, and provide timely evidence for the development of basic occupational health services in China and elsewhere with similar industrialization contexts. Trial registration ChiCTR-IOR-15006929 . Registered on 16 August 2015.
Hernández González, Jorge Enrique; García-Fernández, Rossana; Valiente, Pedro Alberto
2015-01-01
The Kunitz-type protease inhibitor ShPI-1 inhibits human neutrophil elastase (HNE, Ki = 2.35·10-8 M) but does not interact with the porcine pancreatic elastase (PPE); whereas its P1 site variant, ShPI-1/K13L, inhibits both HNE and PPE (Ki = 1.3·10-9 M, and Ki = 1.2·10-8 M, respectively). By employing a combination of molecular modeling tools, e.g., structural alignment, molecular dynamics simulations and Molecular Mechanics Generalized-Born/Poisson-Boltzmann Surface Area free energy calculations, we showed that D226 of HNE plays a critical role in the interaction of this enzyme with ShPI-1 through the formation of a strong salt bridge and hydrogen bonds with K13 at the inhibitor's P1 site, which compensate the unfavorable polar-desolvation penalty of the latter residue. Conversely, T226 of PPE is unable to establish strong interactions with K13, thereby precluding the insertion of K13 side-chain into the S1 subsite of this enzyme. An alternative conformation of K13 site-chain placed at the entrance of the S1 subsite of PPE, similar to that observed in the crystal structure of ShPI-1 in complex with chymotrypsin (PDB: 3T62), is also unfavorable due to the lack of stabilizing pair-wise interactions. In addition, our results suggest that the higher affinity of ShPI-1/K13L for both elastases mainly arises from the lower polar-desolvation penalty of L13 compared to that of K13, and not from stronger pair-wise interactions of the former residue with those of each enzyme. These results provide insights into the PPE and HNE inhibition and may contribute to the design of more potent and/or specific inhibitors toward one of these proteases.
Chung, Chi-Li; Hsiao, Shih-Hsin; Hsiao, George; Sheu, Joen-Rong; Chen, Wei-Lin; Chang, Shi-Chuan
2013-01-01
Objective To investigate the relationship among angiogenic cytokines, fibrinolytic activity and effusion size in parapneumonic effusion (PPE) and their clinical importance. Methods From January 2008 through December 2010, 26 uncomplicated (UPPE) and 38 complicated (CPPE) PPE were studied. Based on chest ultrasonography, there were non-loculated in 30, uni-loculated in 12, and multi-loculated effusions in 22 patients. The effusion size radiological scores, and effusion vascular endothelial growth factor (VEGF), interleukin (IL)-8, plasminogen activator inhibitor type-1 (PAI-1) and tissue type plasminogen activator (tPA) were measured on admission. Treatment outcome and pleural fibrosis, defined as radiological residual pleural thickening (RPT), were assessed at 6-month follow-up. Results The effusion size and effusion VEGF, IL-8 and PAI-1/tPA ratio were significantly higher in CPPE than in UPPE, and significantly higher in multi-loculated PPE than in non-locualted and uni-loculated PPE, respectively. VEGF (cutoff value 1975 pg/ml) and IL-8 (cutoff value 1937 pg/ml) seemed best to discriminate between UPPE and CPPE. VEGF, IL-8 and effusion size correlated positively with PAI-1/tPA ratio in both UPPE and CPPE. Moreover, the level of VEGF, but not IL-8, correlated positively with effusion size in all patients (r = 0.79, peffusion were prone to have medical treatment failure (n = 10; VEGF, odds ratio 1.01, p = 0.02; effusion size, odds ratio 1.26, p = 0.01). Additionally, ten patients with RPT had larger effusion size and higher levels of VEGF and PAI-1/tPA ratio than did those without. Conclusions In PPE, VEGF and IL-8 levels are valuable to identify CPPE, and higher VEGF level or larger effusion is associated with decreased fibrinolytic activity, development of pleural loculation and fibrosis, and higher risk of medical treatment failure. PMID:23308155
Crystallization of porcine pancreatic elastase and a preliminary neutron diffraction experiment
Energy Technology Data Exchange (ETDEWEB)
Kinoshita, Takayoshi [Department of Biological Science, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan); Tamada, Taro [Molecular Structural Biology Group, Quantum Beam Science Directorate, Japan Atomic Energy Agency, 2-4 Shirakata-Shirane, Tokai, Ibaraki 319-1195 (Japan); Imai, Keisuke [Lead Discovery Research Laboratories, Astellas Pharma Inc., 21 Miyukigaoka, Tsukuba-shi, Ibaraki 305-8585 (Japan); Kurihara, Kazuo; Ohhara, Takashi [Molecular Structural Biology Group, Quantum Beam Science Directorate, Japan Atomic Energy Agency, 2-4 Shirakata-Shirane, Tokai, Ibaraki 319-1195 (Japan); Tada, Toshiji [Department of Biological Science, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan); Kuroki, Ryota, E-mail: kuroki.ryota@jaea.go.jp [Molecular Structural Biology Group, Quantum Beam Science Directorate, Japan Atomic Energy Agency, 2-4 Shirakata-Shirane, Tokai, Ibaraki 319-1195 (Japan); Department of Biological Science, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan)
2007-04-01
To investigate the structural characteristics of a covalent inhibitor bound to porcine pancreatic elastase (PPE), including H atoms and hydration by water, a crystal of porcine pancreatic elastase with its inhibitor was grown to a size of 1.6 mm{sup 3} for neutron diffraction study. The crystal diffracted to 2.3 Å resolution with sufficient quality for further structure determination owing to the similar atomic scattering properties of deuterium and carbon. Porcine pancreatic elastase (PPE) resembles the attractive drug target leukocyte elastase, which has been implicated in a number of inflammatory disorders. In order to investigate the structural characteristics of a covalent inhibitor bound to PPE, including H atoms and the hydration by water, a single crystal of PPE for neutron diffraction study was grown in D{sub 2}O containing 0.2 M sodium sulfate (pD 5.0) using the sitting-drop vapour-diffusion method. The crystal was grown to a size of 1.6 mm{sup 3} by repeated macroseeding. Neutron diffraction data were collected at room temperature using a BIX-3 diffractometer at the JRR-3 research reactor of the Japan Atomic Energy Agency (JAEA). The data set was integrated and scaled to 2.3 Å resolution in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 51.2, b = 57.8, c = 75.6 Å.
Jyske banker til kaffe hos Lizette
DEFF Research Database (Denmark)
Ørholst, Henrik
2018-01-01
En fusion mellem Sydbank, Jyske Bank og Spar Nord vil kunne skabe et stærkt alternativ til Danske Bank og Nordea, men det er næppe realistisk. Her kunne bankerne lære noget af LO og FTF.......En fusion mellem Sydbank, Jyske Bank og Spar Nord vil kunne skabe et stærkt alternativ til Danske Bank og Nordea, men det er næppe realistisk. Her kunne bankerne lære noget af LO og FTF....
Directory of Open Access Journals (Sweden)
Ewan MacFarlane
2013-09-01
Conclusions: Although international and national efforts to reduce pesticide exposure through regulatory means should continue, it is difficult in the agricultural sector to implement engineering or system controls. It is clear that use of PPE does reduce dermal pesticide exposure but compliance among the majority of occupationally exposed pesticide end users appears to be poor. More research is needed on higher-order controls to reduce pesticide exposure and to understand the reasons for poor compliance with PPE and identify effective training methods.
Nair, M Sneha; Saxena, Alok; Kaur, Charanjit
2018-02-01
The influence of chitosan (1% w/v) and alginate (2% w/v) coatings in combination with pomegranate peel extract (PPE; 1% w/v) on quality of guavas (cv Allahabad safeda) were studied. Restricted changes were recorded in respiration rate, ripening index, and instrumental colour values in case of the coated samples as compared to the control for 20days at 10°C. Samples coated with chitosan enriched with PPE (CHE) proved to be the most effective treatment in maintaining the overall fruit quality. Ascorbic acid, total phenolics, total flavonoids contents and antioxidant activity were recorded with restricted losses of 29%, 8%, 12%, 12% (DPPH) and 9% (FRAP), respectively for CHE samples at the end of storage. A higher degree of correlation (r>0.918) was established between various phytochemicals and AOA. PPE enriched coatings was proved efficient in maintaining the quality of guavas during 20days of low temperature storage. Copyright © 2017 Elsevier Ltd. All rights reserved.
Nuclear energy for a low-carbon France
International Nuclear Information System (INIS)
Faudon, Valerie; Jouette, Isabelle; Le Ngoc, Boris
2015-01-01
This publication states the opinion of the SFEN (the French Society of Nuclear Energy) about the implementation of the French Multi-year Energy Programming (PPE). The authors first outline that the PPE must firstly aim at reducing greenhouse gas emissions. As a second point, they outline that the PPE must remain flexible in order to be able to face uncertainties related to supply (growth of renewable energies) and demand (economic recovery, pace of energetic installation renewal), and to guard against energy-related events (oil shocks, Russian-Ukrainian crisis, and so on) through a right planning of the energy mix diversification with taking the improvement of economic and technological performance of renewable energies into account. As a third point, they outline that nuclear energy is the base of a low-carbon France. They finally discuss perspectives to strengthen this base by a sustained investment in the nuclear fleet, in the fuel recycling sector, and in research for the development of a new generation of reactors
Serious Injury and Fatality Investigations Involving Pneumatic Nail Guns, 1985-2012
Lowe, Brian D.; Albers, James T.; Hudock, Stephen D.; Krieg, Edward F.
2016-01-01
Background This paper examines serious and fatal pneumatic nail gun (PNG) injury investigations for workplace, tool design, and human factors relevant to causation and resulting OS&H authorities’ responses in terms of citations and penalties. Methods The U.S. OSHA database of Fatality and Catastrophe Investigation Summaries (F&CIS) were reviewed (1985 - 2012) to identify n=258 PNG accidents. Results 79.8% of investigations, and 100% of fatalities, occurred in the Construction industry. Between 53-71% of injuries appear preventable had a safer sequential trigger tool been used. Citations and monetary penalties were related to injury severity, body part injured, disabling of safety devices, and insufficient personal protective equipment (PPE). Conclusions Differences may exist between Construction and other industries in investigators interpretations of PNG injury causation and resulting citations/penalties. Violations of PPE standards were penalized most severely, yet the preventive effect of PPE would likely have been less than that of a safer sequential trigger. PMID:26725335
Keer, Sam; McLean, Dave; Glass, Bill; Douwes, Jeroen
2018-03-12
To assess the association between the use of personal protective equipment (PPE) and good workplace hygiene and symptoms of neurotoxicity in solvent-exposed vehicle spray painters. Exposure control measures including PPE-use and workplace hygiene practices and symptoms of neurotoxicity were assessed in 267 vehicle repair spray painters. Symptoms were assessed using an adapted version of the EUROQUEST Questionnaire. Frequent respirator and glove use was inversely and significantly associated with symptoms of neurotoxicity in a dose-dependent manner (P 80%. Poor hygiene workplace practices, such as solvent exposure to multiple body parts (OR 3.4, P = 0.11 for reporting ≥10 symptoms), were associated with an increased risk of symptoms. When using a general workplace hygiene score derived from a combination of PPE-use and (good) workplace practice factors an inverse and significant dose-response trend was observed for reporting ≥5 (P hygiene are associated with a strongly reduced risk of symptoms of neurotoxicity in solvent-exposed vehicle spray painters.
Promoting fluoroscopic personal radiation protection equipment: unfamiliarity, facts and fears
International Nuclear Information System (INIS)
Balter, Stephen
2017-01-01
An incomplete understanding of risk can cause inappropriate fear. Personal protective equipment (PPE) offered for the prevention of brain cancer in interventional fluoroscopists (IR-PPE). Similar items are offered for cell-phone use (RF-PPE). Publications on fluoroscopy staff brain cancer and similar papers on cell-phone induced brain cancer were reviewed. An internet safety product search was performed, which resulted in many tens of thousands of hits. Vendor claims for either ionizing radiation or radio frequency products seldom addressed the magnitude of the risk. Individuals and institutions can buy a wide variety of safety goods. Any purchase of radioprotective equipment reduces the funds available to mitigate other safety risks. The estimated cost of averting an actuarial fatal brain cancer appears to be in the order of magnitude $10 000 000-$100 000 000. Unwarranted radiation fears should not drive the radiation protection system to the point of decreasing overall safety. (authors)
Active airborne contamination control using electrophoresis
International Nuclear Information System (INIS)
Veatch, B.D.
1994-01-01
In spite of our best efforts, radioactive airborne contamination continues to be a formidable problem at many of the Department of Energy (DOE) weapons complex sites. For workers that must enter areas with high levels of airborne contamination, personnel protective equipment (PPE) can become highly restrictive, greatly diminishing productivity. Rather than require even more restrictive PPE for personnel in some situations, the Rocky Flats Plant (RFP) is actively researching and developing methods to aggressively combat airborne contamination hazards using electrophoretic technology. With appropriate equipment, airborne particulates can be effectively removed and collected for disposal in one simple process. The equipment needed to implement electrophoresis is relatively inexpensive, highly reliable, and very compact. Once airborne contamination levels are reduced, less PPE is required and a significant cost savings may be realized through decreased waste and maximized productivity. Preliminary ''cold,'' or non-radioactive, testing results at the RFP have shown the technology to be effective on a reasonable scale, with several potential benefits and an abundance of applications
Polyphosphoester nanoparticles as biodegradable platform for delivery of multiple drugs and siRNA
Directory of Open Access Journals (Sweden)
Elzeny H
2017-02-01
Full Text Available Hadeel Elzeny,1,* Fuwu Zhang,2,* Esraa N Ali,1 Heba A Fathi,1 Shiyi Zhang,3 Richen Li,2 Mohamed A El-Mokhtar,4 Mostafa A Hamad,5 Karen L Wooley,2,6 Mahmoud Elsabahy1,6–8 1Assiut International Center of Nanomedicine, Al-Rajhy Liver Hospital, Assiut University, Assiut, Egypt; 2Departments of Chemistry, Chemical Engineering and Materials Science and Engineering, Texas A&M University, College Station, TX, USA; 3School of Biomedical Engineering, Shanghai Jiao Tong University, Shanghai, People’s Republic of China; 4Department of Microbiology and Immunology, Faculty of Medicine, 5Department of Surgery, Faculty of Medicine, Assiut University, Assiut, Egypt; 6Laboratory for Synthetic-Biologic Interactions, Department of Chemistry, Texas A&M University, College Station, TX, USA; 7Department of Pharmaceutics, Faculty of Pharmacy, Assiut University, Assiut, 8Misr University for Science and Technology, 6th of October City, Egypt *These authors contributed equally to this work Abstract: Delivery of multiple therapeutics and/or diagnostic agents to diseased tissues is challenging and necessitates the development of multifunctional platforms. Among the various strategies for design of multifunctional nanocarriers, biodegradable polyphosphoester (PPE polymers have been recently synthesized via a rapid and simple synthetic strategy. In addition, the chemical structure of the polymer could be tuned to form nanoparticles with varying surface chemistries and charges, which have shown exceptional safety and biocompatibility as compared to several commercial agents. The purpose of this study was to exploit a mixture of PPE nanoparticles of cationic and neutral surface charges for multiple delivery of anticancer drugs (ie, sorafenib and paclitaxel and nucleic acids (ie, siRNA. Cationic PPE polymers could efficiently complex siRNA, and the stability of the nanoparticles could be maintained in physiological solutions and upon freeze-drying and were able to deliver si
Functional Proton MRI in Emphysematous Rats.
Bianchi, Andrea; Tibiletti, Marta; Kjørstad, Åsmund; Birk, Gerald; Schad, Lothar R; Stierstorfer, Birgit; Stiller, Detlef; Rasche, Volker
2015-12-01
To demonstrate the feasibility of proton magnetic resonance imaging (MRI) ventilation-related maps in rodents for the evaluation of lung function in the presence of pancreatic porcine elastase (PPE)-induced emphysema. Twelve rats were equally divided into 3 groups: group 1 (no administration of PPE); group 2 (PPE selectively only in the left lung); and group 3 (PPE administered in both lungs). Magnetic resonance imaging (MRI) and computed tomographic (CT) data were acquired at baseline, at 2 weeks and 4 weeks after administration, after which the animals were euthanized. The MRI protocol comprised a golden angle 2-dimensional ultrashort echo time MRI sequence [echo time, 0.343 millisecond (ms); repetition time, 120 ms; 12 slides with thickness, 1 mm; acquisition time, 30 minutes], from which inspiration and expiration images were reconstructed after the extraction of a self-gating signal. Inspiration images were registered to images at expiration, and expansion maps were created by calculating the specific difference in signal intensity. The lungs were segmented, and the mean specific expansion (MSE) calculated as an established surrogate for fractional ventilation. Computed tomographic data provided lung density (peak of the Hounsfield unit histogram, HU_P), whereas histology provided the mean linear intercept for each lung. Two weeks after administration, the control group had a mean MSE in both lungs corresponding to 96% of the baseline. Group 2 had 85% of the baseline, and group 3 had 57%. Considering the PPE-treated lungs alone, a significant reduction in MSE of 27% at 2 weeks and 40% at 4 weeks was found with respect to nontreated lungs. Significant correlations between HU_P and MSE were found at all time points (baseline: r = 0.606, P = 0.0017; 2 weeks: r = 0.837, P ≤ 0.0001; 4 weeks: r = 0.765, P Mean linear intercept values significantly correlated both with MRI MSE (r = -0.770, P The calculated ventilation-related maps showed a reduction of function in
Characterization of an anti-listerial enterocin from wheat silage based Enterococcus faecium.
Bal, Emel Banu Buyukunal; Isevi, Taner; Bal, Mehmet Ali
2012-10-01
Two Enterococcus faecium and one E. faecalis strains isolated and identified from wheat silage were characterized based on plasmid content, hemolytic activity, antibiotic resistance patterns, bacteriocin production potential, and presence of enterocin structural genes (entA, entB, entP, entL50B). Among the isolates, only the E. faecium U7 strain exhibited bacteriocin activity against Listeria monocytogenes ATCC 7644, and vancomycin resistant Enterococcus spp. (VRE). A combination of three structural genes (entA, entB, and entP) was detected in E. faecium U7. A relationship between the presence of enterocin structural genes, and bacteriocin activity was detected in E. faecium U7; therefore partially purified enterocin (PPE) was further investigated from the isolate. Several bands of different molecular weights were expressed from PPE extracts following tricine SDS-PAGE analysis. However, the only band showing bacteriocin activity was in an approximate 4-kDa region. PPE treatment with proteinase K, lysozyme, and α -amylase caused complete loss of bacteriocin activity. PPE heat treatment at various temperatures resulted in a notable reduction in bacteriocin expression. Enterocin U7 was relatively heat stable, and presumably exhibits a glucoprotein nature with distinct inhibitory properties. Specific bacterial inhibitory activity of enterocin U7, and the producer strain absence of β -hemolysis and vancomycin susceptibility features deserves further investigation to evaluate its potential application in silage inoculation and food preservation. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Light-emitting liquid-crystal displays constructed from AIE luminogens
Zhao, Dongyu; Qin, Anjun; Tang, Ben Zhong; Leung, Chris Wai Tung
2014-10-01
Liquid crystal displays (LCDs) are widely used for diverse purposes in many aspects in daily life from handle personal devices to professional applications and large-panel LCD televisions. Since LCD is a passive emission display device, it usually shows narrow viewing angle and reduced brightness. Nowadays, LCDs with light-emitting properties is suggested as a less energy consuming displays. To date, fluorescent materials with dichroic properties and strong fluorescence emission are required. However, many molecular emitters, which are highly efficient in solution, will suffer from heavy aggregation-caused quenching (ACQ) effect in the aggregate state, which has greatly limited their applications. In order to overcome these weaknesses, we have designed and synthesized a novel luminescent liquid crystalline compound consisting of a tetraphenylethene (TPE) core, TPE-PPE, as a luminogen with mesogenic moieties. As a result, the TPE-PPE exhibits both the aggregate-induced emission (AIE) and thermotropic liquid crystalline characteristics. By dissolving 1 weight% (wt%) of TPE-PPE into the nematic LC host PA0182, a linearly polarized emission was obtained on the unidirectional orientated LC cell. The photoluminescence polarization ratio of the LC cell has reached to 4.16 between the directions perpendicular and parallel to the rubbing direction. Utilizing the emissive anisotropic TPE-PPE, we have fabricated the photoluminescent liquid crystal display (PL-LCD). This approach has simplified the device design, lowered the energy consumption and increased brightness of the LCD.
Directory of Open Access Journals (Sweden)
C. D. Adair
1997-01-01
Full Text Available Objectives: To evaluate the utility of intrapartum amnioinfusion (AI in reducing the infectious morbidity of patients with meconium-stained fluid (MSF. Previous studies have shown increased intraamniotic infection (IAI and postpartum endometritis (PPE rates in patients with MSF. Intraamniotic infection has been reduced with the prophylactic administration of ampicillin–sulbactam in MSF. Intraamniotic infection and PPE have been reduced with the use of AI in patients with clear fluid. No investigators have specifically examined the efficacy of AI in reducing meconium-stained, amniotic-fluid-associated infectious morbidity.
Ratnayake, Ruwan; Ho, Lara S; Ansumana, Rashid; Brown, Hannah; Borchert, Matthias; Miller, Laura; Kratz, Thomas; McMahon, Shannon A; Sahr, Foday
2016-01-01
Accomplishing infection prevention and control (IPC) in health facilities in Sub-Saharan Africa is challenging. Owing to poor IPC, healthcare workers (HCWs) were frequently infected during Sierra Leone's Ebola epidemic. In late 2014, IPC was rapidly and nationally scaled up. We carried out workshops in sampled facilities to further improve adherence to IPC. We investigated HCW experiences and observed practice gaps, before and after the workshops. We conducted an uncontrolled, before and after, mixed-methods study in eight health facilities in Bo and Kenema Districts during December 2014 and January 2015. Quantitative methods administered to HCWs at baseline and follow-up included a survey on attitudes and self-efficacy towards IPC, and structured observations of behaviours. The intervention involved a workshop for HCWs to develop improvement plans for their facility. We analysed the changes between rounds in survey responses and behaviours. We used interviews to explore attitudes and self-efficacy throughout the study period. HCWs described IPC as 'life-saving' and personal protective equipment (PPE) as uncomfortable for providers and frightening for patients. At baseline, self-efficacy was high (median=4/strongly agree). Responses reflecting unfavourable attitudes were low for glove use (median=1/strongly disagree, IQR, 1-2) and PPE use with ill family members (median=1, IQR, 1-2), and mixed for PPE use with ill HCWs (median=2/disagree, IQR, 1-4). Observations demonstrated consistent glove reuse and poor HCW handwashing. The maintenance of distance (RR 1.09, 95% CI 1.02 to 1.16) and patient handwashing (RR 1.19, 95% CI 1.3 to 1.25) improved to >90%. We found favourable attitudes towards IPC and gaps in practice. Risk perceptions of HCWs and tendencies to ration PPE where chronic supply chain issues normally lead to PPE stock-outs may affect practice. As Sierra Leone's Ebola Recovery Strategy aims to make all facilities IPC compliant, socio
Directory of Open Access Journals (Sweden)
Angelina Constans Aubert
2008-03-01
Full Text Available El objetivo de este trabajo ha sido obtener información sobre el nivel de utilización de los equipos de protección individual (EPI frente al riego biológico entre el personal que desarrolla su actividad profesional en centros sanitarios. Para ello se preparó un cuestionario, que previamente validado se aplicó a un colectivo de distintos centros sanitarios de Cataluña durante los años 2003/2004. La información obtenida en este estudio revela que la utilización de los EPI frente al riesgo biológico, entre el personal que desarrolla su actividad en centros sanitarios es elevada, aunque también evidencia que todavía es necesario corregir algunos de los procedimientos de trabajo que se siguen en dichos centros y que es necesario mejorar algunos puntos de la gestión; también es una asignatura pendiente una mejor formación e información de los trabajadores para una correcta utilización de los EPI. Finalmente, en el apartado correspondiente, se presenta una revisión exhaustiva de las Normas Técnicas relacionadas con los EPI, ropa de protección y calzado frente a microorganismos.The aim of this paper is to get information about the use of the PPE in front of biological risk in health care workers. A questionnaire has been prepared and, previous validation, has been applied to a set of hospitals in Catalonia area during 2003-2004. Information obtained indicates that the use of PPE in front of biological risk is high, but it is necessary to change some working procedures and to improve the management of PPE. It should also be improved information and worker's training for the correct use of PPE. Finally, a review of technical regulations related to PPE, protection clothes and shoes in front of microorganisms is presented.
Tsujimoto, Naoki; Saraya, Takeshi; Light, Richard W; Tsukahara, Yayoi; Koide, Takashi; Kurai, Daisuke; Ishii, Haruyuki; Kimura, Hirokazu; Goto, Hajime; Takizawa, Hajime
2015-01-01
Pleural separation, the "split pleura" sign, has been reported in patients with empyema. However, the diagnostic yield of the split pleura sign for complicated parapneumonic effusion (CPPE)/empyema and its utility for differentiating CPPE/empyema from parapneumonic effusion (PPE) remains unclear. This differentiation is important because CPPE/empyema patients need thoracic drainage. In this regard, the aim of this study was to develop a simple method to distinguish CPPE/empyema from PPE using computed tomography (CT) focusing on the split pleura sign, fluid attenuation values (HU: Hounsfield units), and amount of fluid collection measured on thoracic CT prior to diagnostic thoracentesis. A total of 83 consecutive patients who underwent chest CT and were diagnosed with CPPE (n=18)/empyema (n=18) or PPE (n=47) based on the diagnostic thoracentesis were retrospectively analyzed. On univariate analysis, the split pleura sign (odds ratio (OR), 12.1; ppleural effusion (≥30 mm) (OR, 6.13; ppleural fluid were significantly higher in the CPPE/empyema group than in the PPE group. On multivariate analysis, only the split pleura sign (hazard ratio (HR), 6.70; 95% confidence interval (CI), 1.91-23.5; p=0.003) and total amount of pleural effusion (≥30 mm) on thoracic CT (HR, 7.48; 95%CI, 1.76-31.8; p=0.006) were risk factors for empyema. Sensitivity, specificity, positive predictive value, and negative predictive value of the presence of both split pleura sign and total amount of pleural effusion (≥30 mm) on thoracic CT for CPPE/empyema were 79.4%, 80.9%, 75%, and 84.4%, respectively, with an area under the curve of 0.801 on receiver operating characteristic curve analysis. This study showed a high diagnostic yield of the split pleura sign and total amount of pleural fluid (≥30 mm) on thoracic CT that is useful and simple for discriminating between CPPE/empyema and PPE prior to diagnostic thoracentesis.
Directory of Open Access Journals (Sweden)
Chi-Li Chung
Full Text Available OBJECTIVE: To investigate the relationship among angiogenic cytokines, fibrinolytic activity and effusion size in parapneumonic effusion (PPE and their clinical importance. METHODS: From January 2008 through December 2010, 26 uncomplicated (UPPE and 38 complicated (CPPE PPE were studied. Based on chest ultrasonography, there were non-loculated in 30, uni-loculated in 12, and multi-loculated effusions in 22 patients. The effusion size radiological scores, and effusion vascular endothelial growth factor (VEGF, interleukin (IL-8, plasminogen activator inhibitor type-1 (PAI-1 and tissue type plasminogen activator (tPA were measured on admission. Treatment outcome and pleural fibrosis, defined as radiological residual pleural thickening (RPT, were assessed at 6-month follow-up. RESULTS: The effusion size and effusion VEGF, IL-8 and PAI-1/tPA ratio were significantly higher in CPPE than in UPPE, and significantly higher in multi-loculated PPE than in non-locualted and uni-loculated PPE, respectively. VEGF (cutoff value 1975 pg/ml and IL-8 (cutoff value 1937 pg/ml seemed best to discriminate between UPPE and CPPE. VEGF, IL-8 and effusion size correlated positively with PAI-1/tPA ratio in both UPPE and CPPE. Moreover, the level of VEGF, but not IL-8, correlated positively with effusion size in all patients (r = 0.79, p<0.001 and in UPPE (r = 0.64, p<0.001 and CPPE (r = 0.71, p<0.001 groups. The patients with higher VEGF or greater effusion were prone to have medical treatment failure (n = 10; VEGF, odds ratio 1.01, p = 0.02; effusion size, odds ratio 1.26, p = 0.01. Additionally, ten patients with RPT had larger effusion size and higher levels of VEGF and PAI-1/tPA ratio than did those without. CONCLUSIONS: In PPE, VEGF and IL-8 levels are valuable to identify CPPE, and higher VEGF level or larger effusion is associated with decreased fibrinolytic activity, development of pleural loculation and fibrosis, and higher risk of medical treatment failure.
Young, Justin Mark J; Campbell, Aaron D; Raastad, Kate K
2015-12-01
Wilderness sports and adventures continue to increase in popularity. Counseling is an essential element of the preparticipation evaluation (PPE) for athletes in traditional sports. This approach can be applied to and augmented for the wilderness athlete and adventurer. The authors reviewed the literature on counseling during PPEs and gathered expert opinion from medical professionals who perform such PPEs for wilderness sports enthusiasts. The objective was to present findings of this review and make recommendations on the counseling component of a wilderness sports/adventure PPE. The counseling component of a PPE for wilderness sports/adventures should take place after a basic medical evaluation, and include a discussion on sport or activity-specific injury prevention, personal health, travel recommendations, and emergency event planning. Counseling should be individualized and thorough, and involve shared decision making. This should take place early enough to allow ample time for the athlete or adventurer to further prepare as needed based on the recommendations. Resources may be recommended for individuals desiring more information on selected topics. Copyright © 2015. Published by Elsevier Inc.
Cryptosporidiosis outbreak at an academic animal research laboratory-Colorado, 2014.
Hancock-Allen, Jessica; Alden, Nisha B; Cronquist, Alicia B
2017-02-01
After cryptosporidiosis was reported in three workers caring for preweaned calves at an academic research laboratory, we sought to identify cases, determine risk factors, and implement control measures. A cryptosporidiosis case was defined as diarrhea duration ≥72 hr, abdominal cramps, or vomiting in an animal research laboratory worker during July 14-July 31. A confirmed case had laboratory evidence of Cryptosporidium infection. Staff were interviewed regarding illness, potential exposures, training, and personal protective equipment (PPE) standard operating procedures (SOPs). The cryptosporidiosis attack rate (AR) was 74% (20/27); five were laboratory-confirmed. Median job training was 2 hr including respiratory-fit testing. No SOPs existed for doffing PPE. AR for workers who removed their gloves first was 84% (16/19) compared with 20% (1/5) for workers who removed gloves last (risk ratio = 4.2; P importance of adequate training, enforced proper PPE procedures, and promoting a culture of safety. Am. J. Ind. Med. 60:208-214, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
Serious injury and fatality investigations involving pneumatic nail guns, 1985-2012.
Lowe, Brian D; Albers, James T; Hudock, Stephen D; Krieg, Edward F
2016-02-01
This article examines serious and fatal pneumatic nail gun (PNG) injury investigations for workplace, tool design, and human factors relevant to causation and resulting OS&H authorities' responses in terms of citations and penalties. The U.S. Occupational Safety and Health Administration (OSHA) database of Fatality and Catastrophe Investigation Summaries (F&CIS) were reviewed (1985-2012) to identify n = 258 PNG accidents. 79.8% of investigations, and 100% of fatalities, occurred in the construction industry. Between 53-71% of injuries appear to have been preventable had a safer sequential trigger tool been used. Citations and monetary penalties were related to injury severity, body part injured, disabling of safety devices, and insufficient personal protective equipment (PPE). Differences may exist between construction and other industries in investigators interpretations of PNG injury causation and resulting citations/penalties. Violations of PPE standards were penalized most severely, yet the preventive effect of PPE would likely have been less than that of a safer sequential trigger. Published 2016. This article is a U.S. Government work and is in the public domain in the USA.
Functionalizing CNTs for Making Epoxy/CNT Composites
Chen, Jian; Rajagopal, Ramasubramaniam
2009-01-01
Functionalization of carbon nanotubes (CNTs) with linear molecular side chains of polyphenylene ether (PPE) has been shown to be effective in solubilizing the CNTs in the solvent components of solutions that are cast to make epoxy/CNT composite films. (In the absence of solubilization, the CNTs tend to clump together instead of becoming dispersed in solution as needed to impart, to the films, the desired CNT properties of electrical conductivity and mechanical strength.) Because the PPE functionalizes the CNTs in a noncovalent manner, the functionalization does not damage the CNTs. The functionalization can also be exploited to improve the interactions between CNTs and epoxy matrices to enhance the properties of the resulting composite films. In addition to the CNTs, solvent, epoxy resin, epoxy hardener, and PPE, a properly formulated solution also includes a small amount of polycarbonate, which serves to fill voids that, if allowed to remain, would degrade the performance of the film. To form the film, the solution is drop-cast or spin-cast, then the solvent is allowed to evaporate.
Shamsi, Mahmoud; Pariani, Abbas; Shams, Mohsen; Soleymani-nejad, Marzieh
2016-04-01
To study the effects of an intervention based on social marketing to persuade workers to use personal protective equipment (PPE) in constructing subway stations in Isfahan, Iran. This was a quasi-experimental study. Two stations were selected as intervention and control groups. Intervention was designed based on results of a formative research. A free package containing a safety helmet with a tailored message affixed to it, mask and gloves and an educational pamphlet was delivered to the intervention group. After 6 weeks, behaviours in the intervention and control stations were measured using an observational checklist. After the intervention, the percentage of workers who used PPE at the intervention station increased significantly. OR for helmet and mask usage was 7.009 and 2.235, respectively, in the intervention group. Social marketing can be used to persuade workers to use PPE in the workplace. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
The safety and efficacy of contact lens wear in the industrial and chemical workplace.
Tyhurst, Keith; McNett, Ryan; Bennett, Edward
2007-11-01
The use and safety of contact lenses in the industrial and chemical workplace has often been questioned since the 1960s because of many unconfirmed reports of ocular injury resulting from contact lens wear. Because of these urban legends, contact lens wear has been banned or wearers have been required to wear additional personal protective equipment (PPE) not required of non-contact lens wearers. Literature review via Medline and Google search. Research has shown that contact lenses typically provide protective benefits that decrease the severity of ocular injury and improve worker performance. While contact lens wear contraindications do exist, in most cases, and with proper precautions, contact lens wear is still possible. Industrial and chemical companies need to establish written contact lens use policies based on current studies that have shown the safety of workplace contact lens wear when combined with the same PPE required of non-contact lens wearers. Practitioners need to discuss, with their contact lens patients, the additional responsibilities required to maintain proper lens hygiene and proper PPE in the workplace.
International Nuclear Information System (INIS)
Salazar, Agustín; Oleaga, Alberto; Mendioroz, Arantza; Apiñaniz, Estibaliz
2017-01-01
The photopyroelectric (PPE) technique in the front configuration consists in illuminating one surface of a pyroelectric slab while the other surface is in contact with the test sample. This method has been widely used to measure the thermal effusivity of liquids. Recently, it has been extended to measure the thermal effusivity of solids, by taking into account the influence of the coupling fluid layer used to guarantee the thermal contact. In both cases, the sample (liquid or solid) must be very thick. In this work, we propose a classical frequency scan of a thin sample slab to retrieve the thermal diffusivity and effusivity simultaneously. We use the amplitude and the phase of the front PPE signal, which depend on four parameters: the sample diffusivity and effusivity, the coupling fluid thickness and the coefficient of heat losses. It is demonstrated that the four quantities are not correlated. PPE measurements performed on a set of calibrated solids confirm the ability of the method to obtain the thermal diffusivity and effusivity of solids accurately. (paper)
Bradley, Kailyn A L; Case, Julia A C; Freed, Rachel D; Stern, Emily R; Gabbay, Vilma
2017-07-01
There has been growing interest under the Research Domain Criteria initiative to investigate behavioral constructs and their underlying neural circuitry. Abnormalities in reward processes are salient across psychiatric conditions and may precede future psychopathology in youth. However, the neural circuitry underlying such deficits has not been well defined. Therefore, in this pilot, we studied youth with diverse psychiatric symptoms and examined the neural underpinnings of reward anticipation, attainment, and positive prediction error (PPE, unexpected reward gain). Clinically, we focused on anhedonia, known to reflect deficits in reward function. Twenty-two psychotropic medication-free youth, 16 with psychiatric symptoms, exhibiting a full range of anhedonia, were scanned during the Reward Flanker Task. Anhedonia severity was quantified using the Snaith-Hamilton Pleasure Scale. Functional magnetic resonance imaging analyses were false discovery rate corrected for multiple comparisons. Anticipation activated a broad network, including the medial frontal cortex and ventral striatum, while attainment activated memory and emotion-related regions such as the hippocampus and parahippocampal gyrus, but not the ventral striatum. PPE activated a right-dominant fronto-temporo-parietal network. Anhedonia was only correlated with activation of the right angular gyrus during anticipation and the left precuneus during PPE at an uncorrected threshold. Findings are preliminary due to the small sample size. This pilot characterized the neural circuitry underlying different aspects of reward processing in youth with diverse psychiatric symptoms. These results highlight the complexity of the neural circuitry underlying reward anticipation, attainment, and PPE. Furthermore, this study underscores the importance of RDoC research in youth. Copyright © 2016 Elsevier B.V. All rights reserved.
Mumma, Joel M; Durso, Francis T; Ferguson, Ashley N; Gipson, Christina L; Casanova, Lisa; Erukunuakpor, Kimberly; Kraft, Colleen S; Walsh, Victoria L; Zimring, Craig; DuBose, Jennifer; Jacob, Jesse T
2018-03-05
Doffing protocols for personal protective equipment (PPE) are critical for keeping healthcare workers (HCWs) safe during care of patients with Ebola virus disease. We assessed the relationship between errors and self-contamination during doffing. Eleven HCWs experienced with doffing Ebola-level PPE participated in simulations in which HCWs donned PPE marked with surrogate viruses (ɸ6 and MS2), completed a clinical task, and were assessed for contamination after doffing. Simulations were video recorded, and a failure modes and effects analysis and fault tree analyses were performed to identify errors during doffing, quantify their risk (risk index), and predict contamination data. Fifty-one types of errors were identified, many having the potential to spread contamination. Hand hygiene and removing the powered air purifying respirator (PAPR) hood had the highest total risk indexes (111 and 70, respectively) and number of types of errors (9 and 13, respectively). ɸ6 was detected on 10% of scrubs and the fault tree predicted a 10.4% contamination rate, likely occurring when the PAPR hood inadvertently contacted scrubs during removal. MS2 was detected on 10% of hands, 20% of scrubs, and 70% of inner gloves and the predicted rates were 7.3%, 19.4%, 73.4%, respectively. Fault trees for MS2 and ɸ6 contamination suggested similar pathways. Ebola-level PPE can both protect and put HCWs at risk for self-contamination throughout the doffing process, even among experienced HCWs doffing with a trained observer. Human factors methodologies can identify error-prone steps, delineate the relationship between errors and self-contamination, and suggest remediation strategies.
DEFF Research Database (Denmark)
Carlsen, Martin; Koehl, Patrice; Røgen, Peter
2014-01-01
(PPD), while the other had the set of all distances filtered to reflect consistency in an ensemble of decoys (PPE). We tested four types of metric to characterize the distance between the decoy and the native structure, two based on extrinsic geometry (RMSD and GTD-TS*), and two based on intrinsic...... geometry (Q* and MT). The corresponding eight potentials were tested on a large collection of decoy sets. We found that it is usually better to train a potential using an intrinsic distance measure. We also found that PPE outperforms PPD, emphasizing the benefits of capturing consistent information...
Sarvghad-Moghaddam, Hesam; Jazi, Mehdi Salimi; Rezaei, Asghar; Karami, Ghodrat; Ziejewski, Mariusz
2015-01-01
A parametric study was conducted to delineate the efficacy of personal protective equipment (PPE), such as ballistic faceshields and advanced combat helmets, in the case of a blast. The propagations of blast waves and their interactions with an unprotected head, a helmeted one, and a fully protected finite element head model (FEHM) were modeled. The biomechanical parameters of the brain were recorded when the FEHM was exposed to shockwaves from the front, back, top, and bottom. The directional dependent tissue response of the brain and the variable efficiency of PPE with respect to the blast orientation were two major results of this study.
Incompressible SPH (ISPH) with fast Poisson solver on a GPU
Chow, Alex D.; Rogers, Benedict D.; Lind, Steven J.; Stansby, Peter K.
2018-05-01
This paper presents a fast incompressible SPH (ISPH) solver implemented to run entirely on a graphics processing unit (GPU) capable of simulating several millions of particles in three dimensions on a single GPU. The ISPH algorithm is implemented by converting the highly optimised open-source weakly-compressible SPH (WCSPH) code DualSPHysics to run ISPH on the GPU, combining it with the open-source linear algebra library ViennaCL for fast solutions of the pressure Poisson equation (PPE). Several challenges are addressed with this research: constructing a PPE matrix every timestep on the GPU for moving particles, optimising the limited GPU memory, and exploiting fast matrix solvers. The ISPH pressure projection algorithm is implemented as 4 separate stages, each with a particle sweep, including an algorithm for the population of the PPE matrix suitable for the GPU, and mixed precision storage methods. An accurate and robust ISPH boundary condition ideal for parallel processing is also established by adapting an existing WCSPH boundary condition for ISPH. A variety of validation cases are presented: an impulsively started plate, incompressible flow around a moving square in a box, and dambreaks (2-D and 3-D) which demonstrate the accuracy, flexibility, and speed of the methodology. Fragmentation of the free surface is shown to influence the performance of matrix preconditioners and therefore the PPE matrix solution time. The Jacobi preconditioner demonstrates robustness and reliability in the presence of fragmented flows. For a dambreak simulation, GPU speed ups demonstrate up to 10-18 times and 1.1-4.5 times compared to single-threaded and 16-threaded CPU run times respectively.
Arc mRNA induction in striatal efferent neurons associated with response learning.
Daberkow, D P; Riedy, M D; Kesner, R P; Keefe, K A
2007-07-01
The dorsal striatum is involved in motor-response learning, but the extent to which distinct populations of striatal efferent neurons are differentially involved in such learning is unknown. Activity-regulated, cytoskeleton-associated (Arc) protein is an effector immediate-early gene implicated in synaptic plasticity. We examined arc mRNA expression in striatopallidal vs. striatonigral efferent neurons in dorsomedial and dorsolateral striatum of rats engaged in reversal learning on a T-maze motor-response task. Male Sprague-Dawley rats learned to turn right or left for 3 days. Half of the rats then underwent reversal training. The remaining rats were yoked to rats undergoing reversal training, such that they ran the same number of trials but ran them as continued-acquisition trials. Brains were removed and processed using double-label fluorescent in situ hybridization for arc and preproenkephalin (PPE) mRNA. In the reversal, but not the continued-acquisition, group there was a significant relation between the overall arc mRNA signal in dorsomedial striatum and the number of trials run, with rats reaching criterion in fewer trials having higher levels of arc mRNA expression. A similar relation was seen between the numbers of PPE(+) and PPE(-) neurons in dorsomedial striatum with cytoplasmic arc mRNA expression. Interestingly, in behaviourally activated animals significantly more PPE(-) neurons had cytoplasmic arc mRNA expression. These data suggest that Arc in both striatonigral and striatopallidal efferent neurons is involved in striatal synaptic plasticity mediating motor-response learning in the T-maze and that there is differential processing of arc mRNA in distinct subpopulations of striatal efferent neurons.
The effect of severe acute respiratory syndrome (SARS) on emergency airway management.
Wong, Evelyn; Ho, Khoy Kheng
2006-07-01
From early March 2003 to late May 2003, severe acute respiratory syndrome (SARS) was detected in Singapore. The increase in workload and new infection control procedures were thought to affect resuscitation and airway management. Our aim was to study the effects of wearing of personal protective equipment (PPE) and powered air-purifying respirator (PAPR) and the restriction in the number of resuscitation personnel on airway management during the SARS crisis. Data was collected prospectively through an ongoing emergency airway registry. The data was divided into three periods: (1) before PPE was instituted from 1 November 2002 to 31 March 2003; (2) during SARS (when PPE use was mandatory) from 1 April to 31 July 2003; (3) post-SARs (when PPE use was non-mandatory but encouraged) from 1 August to 31 March 2004. There was no change in patient demographics during the three periods. There were significant increases in the proportion of resuscitation cases and airway interventions during the SARS period compared to the pre-SARS period. The resident medical officer intubation rate decreased from 45.1% pre-SARS to 35.2% during SARS and 17.7% post-SARS. The complication rates were 10.5%, 9.9% and 9.4% in periods 1-3, respectively. Restriction in the number of healthcare staff attending to each patient may have influenced the department's decision to allow only the most confident or experienced personnel to manage the airway. The exposure of junior medical officers in emergency airway management during SARS and the immediate post-SARS period was decreased. This trend should be monitored further and intervention may be necessary should it continue to decline.
Directory of Open Access Journals (Sweden)
Wertheimer Michael R
2007-09-01
Full Text Available Abstract Background The loss of the notochordal cells from the nucleus pulposus is associated with ageing and disc degeneration. However, understanding the mechanisms responsible for the loss of these cells has been hampered in part due to the difficulty of culturing and maintaining their phenotype. Furthermore, little is known about the influence of the substratum on the molecular markers of notochordal cells. Methods Notochordal cells were isolated from lumbar spine of non-chondrodystrophoid dogs and cultured on N-rich plasma polymer layers, so-called "PPE:N" (N-doped plasma-polymerised ethylene, containing up to 36% [N] surfaces, for 3, 7 or 14 days. Gene expression of vimentin (VIM, pleiotrophin (PTN, matrix Gla protein (MGP, cartilage oligomeric matrix protein (COMP, keratin 18 (KRT 18, aggrecan (AGG, collagen type 1 (COL1A2, collagen type 2 (COL2A1 was analyzed through semi-quantitative reverse transcription-polymerase chain reaction (RT-PCR. Results Notochordal cells were maintained in culture on PPE:N for up to 14 days with no loss in cell viability. Except for VIM, gene expression varied depending on the culture periods and [N] concentration of the substratum. Generally, PPE:N surfaces altered gene expression significantly when cells were cultured for 3 or 7 days. Conclusion The present study has shown that notochordal cells from dogs can attach to and grow on PPE:N surfaces. Analysis of the expression of different genes in these cells cultured on different N-functionalized surfaces indicates that cellular behaviour is gene-specific and time-dependent. Further studies are required to better understand the roles of specific surface functionalities on receptor sites, and their effects on cellular phenotypes.
Kenny, Sarah J; Palacios-Derflingher, Luz; Shi, Qian; Whittaker, Jackie L; Emery, Carolyn A
2017-10-20
To determine the prevalence of self-reported 1-year injury history and examine its association with preparticipation evaluation components aimed at predicting future injury risk (PPE-IP) among preprofessional ballet and contemporary dancers. Cross-sectional study. Preprofessional ballet school, university contemporary dance program. Full-time preprofessional ballet and contemporary dancers. Preparticipation evaluation consisted of the Athletic Coping Skills Inventory-28, body mass index, total bone mineral density, ankle range of motion, active standing turnout, lumbopelvic control, unipedal dynamic balance, and Y-Balance test. Self-reported 1-year history of dance-related medical attention and/or time-loss injury. A total of 155 ballet [n = 90, 80 females, median age 15 years (range 11-19)] and contemporary [n = 65, 63 females, median age 20 years (range 17-30)] dancers participated. Forty-six percent (95% confidence interval (CI), 38.4-54.6) reported a 1-year injury history. Self-reported injury history was not associated with any PPE-IP, however, an influence of age and psychological coping skills on the relationship between 1-year injury history and PPE-IP was identified. Multivariable analyses revealed that prevalence of 1-year injury history did not differ by age [referent group 18 years: OR 0.69 (95% CI, 0.30-1.56)], or level of psychological coping skills [OR 1.35 (95% CI, 0.61-2.94)]. The prevalence of self-reported 1-year injury history among preprofessional ballet and contemporary dancers is high. Although measures of PPE-IP did not differ based on injury history, it is important that age and psychological coping skills are considered in future dance injury prevention and prediction research. Level 3 evidence.
Directory of Open Access Journals (Sweden)
W.W. Arrais-Silva
2014-09-01
Full Text Available Pentavalent antimonials are the first choice for the treatment of human leishmaniasis. However in rural areas the traditional plants may be preferred for the treatment of lesions. In recent years a number of papers are published related to the natural products especially plant derivative with infectious diseases. The present work was undertaken to evaluate the antileishmanial activity of Pterodon pubescens which is a native tree widely distributed over the central region of Brazil and used in folk medicine as wine infusions to treat inflammatory disease. The phytochemical screening and the biological essay of ethanolic extract of Pterodon pudescens (PPE leaves at the concentrations of 150, 300, 450, 600 µg/ml were tested in vitro in Leishmania amazonensis-infected macrophages to support its traditional medicinal use as a leishmaniasis remedy. Phytochemical screening of PPE has shown the presence of catechemical tannins, steroids, triterpenoids and flavonoids. The biological test suggests that PPE were found to control parasite burden of cell cultures in dose-dependent manner. These findings highlight the fact that the apparent potency of Pterodon pudescens compounds, together with their widely distribution over Latin America and Brazil, may represent a promising antileishmanial agent.
Umar, Dilshad; Dilshad, Bahija; Farhan, Mohammed; Ali, Arshiya; Baroudi, Kusai
2016-01-01
Herbal mouthwashes have been considered to be a more advantageous option to their chemical counterparts, for a long-time. The use of pomegranate fruit dates from ancient times and reports of its therapeutic abilities have echoed throughout the ages. To evaluate the effect on the salivary pH and the Streptococcus mutans count in healthy subjects before and after pomegranate mouthrinse. Fifty healthy patients were randomly divided into two groups of 25 subjects each. Group A was treated with 0.2% chlorhexidine mouthrinse; while Group B was treated with pomegranate peel extract (PPE) mouthrinse and the saliva samples were collected at three different intervals: Prerinse, after 10 min, and 60 min. The salivary pH was measured using a digital pH meter and the S. mutans count was determined by the commercial system Dentocult SM. The statistical analyses used in this study are Mann-Whitney U-test and t-test. PPE mouthrinse had an inhibitory effect on S. mutans count in adults. There was also an increase in the salivary pH after 10 min of the mouthrinse. PPE mouthrinse may be considered as a potential anticariogenic mouthrinse.
Preparticipation Evaluation for Climbing Sports.
Campbell, Aaron D; Davis, Christopher; Paterson, Ryan; Cushing, Tracy A; Ng, Pearlly; Peterson, Charles S; Sedgwick, Peter E; McIntosh, Scott E
2015-09-01
Climbing is a popular wilderness sport among a wide variety of professional athletes and amateur enthusiasts, and many styles are performed across many environments. Potential risks confront climbers, including personal health or exacerbation of a chronic condition, in addition to climbing-specific risks or injuries. Although it is not common to perform a preparticipation evaluation (PPE) for climbing, a climber or a guide agency may request such an evaluation before participation. Formats from traditional sports PPEs can be drawn upon, but often do not directly apply. The purpose of this article was to incorporate findings from expert opinion from professional societies in wilderness medicine and in sports medicine, with findings from the literature of both climbing epidemiology and traditional sports PPEs, into a general PPE that would be sufficient for the broad sport of climbing. The emphasis is on low altitude climbing, and an overview of different climbing styles is included. Knowledge of climbing morbidity and mortality, and a standardized approach to the PPE that involves adequate history taking and counseling have the potential for achieving risk reduction and will facilitate further study on the evaluation of the efficacy of PPEs.
Lara, Francisco J; Chan, Danny; Dickinson, Michael; Lloyd, Antony S; Adams, Stuart J
2017-05-05
Direct analysis in real time (DART) was evaluated for the determination of a number of highly polar pesticides using the Quick Polar Pesticides Extraction (QuPPe) method. DART was hyphenated to high resolution mass spectrometry (HRMS) in order to get the required selectivity that allows the determination of these compounds in complex samples such as lettuce and celery. Experimental parameters such as desorption temperature, scanning speed, and distances between the DART ion source and MS inlet were optimized. Two different mass analyzers (Orbitrap and QTOF) and two accessories for sample introduction (Dip-it ® tips and QuickStrip™ sample cards) were evaluated. An extra clean-up step using primary-secondary amine (PSA) was included in the QuPPe method to improve sensitivity. The main limitation found was in-source fragmentation, nevertheless QuPPe-DART-HRMS proved to be a fast and reliable tool with quantitative capabilities for at least seven compounds: amitrole, cyromazine, propamocarb, melamine, diethanolamine, triethanolamine and 1,2,4-triazole. The limits of detection ranged from 20 to 60μg/kg. Recoveries for fortified samples ranged from 71 to 115%, with relative standard deviations <18%. Copyright © 2017 Elsevier B.V. All rights reserved.
Preparticipation Evaluation for Climbing Sports.
Campbell, Aaron D; Davis, Christopher; Paterson, Ryan; Cushing, Tracy A; Ng, Pearlly; Peterson, Charles S; Sedgwick, Peter E; McIntosh, Scott E
2015-12-01
Climbing is a popular wilderness sport among a wide variety of professional athletes and amateur enthusiasts, and many styles are performed across many environments. Potential risks confront climbers, including personal health or exacerbation of a chronic condition, in addition to climbing-specific risks or injuries. Although it is not common to perform a preparticipation evaluation (PPE) for climbing, a climber or a guide agency may request such an evaluation before participation. Formats from traditional sports PPEs can be drawn upon, but often do not directly apply. The purpose of this article was to incorporate findings from expert opinion from professional societies in wilderness medicine and in sports medicine, with findings from the literature of both climbing epidemiology and traditional sports PPEs, into a general PPE that would be sufficient for the broad sport of climbing. The emphasis is on low altitude climbing, and an overview of different climbing styles is included. Knowledge of climbing morbidity and mortality, and a standardized approach to the PPE that involves adequate history taking and counseling have the potential for achieving risk reduction and will facilitate further study on the evaluation of the efficacy of PPEs. Copyright © 2015. Published by Elsevier Inc.
Conformation of ionizable poly Para phenylene ethynylene in dilute solutions
International Nuclear Information System (INIS)
Wijesinghe, Sidath; Maskey, Sabina; Perahia, Dvora; Grest, Gary S.
2015-01-01
The conformation of dinonyl poly para phenylene ethynylenes (PPEs) with carboxylate side chains, equilibrated in solvents of different quality is studied using molecular dynamics simulations. PPEs are of interest because of their tunable electro-optical properties, chemical diversity, and functionality which are essential in wide range of applications. The polymer conformation determines the conjugation length and their assembly mode and affects electro-optical properties which are critical in their current and potential uses. The current study investigates the effect of carboxylate fraction on PPEs side chains on the conformation of chains in the dilute limit, in solvents of different quality. The dinonyl PPE chains are modeled atomistically, where the solvents are modeled both implicitly and explicitly. Dinonyl PPEs maintained a stretched out conformation up to a carboxylate fraction f of 0.7 in all solvents studied. The nonyl side chains are extended and oriented away from the PPE backbone in toluene and in implicit good solvent whereas in water and implicit poor solvent, the nonyl side chains are collapsed towards the PPE backbone. Thus, rotation around the aromatic ring is fast and no long range correlations are seen within the backbone
A murine model of elastase- and cigarette smoke-induced emphysema.
Rodrigues, Rubia; Olivo, Clarice Rosa; Lourenço, Juliana Dias; Riane, Alyne; Cervilha, Daniela Aparecida de Brito; Ito, Juliana Tiyaki; Martins, Milton de Arruda; Lopes, Fernanda Degobbi Tenório Quirino Dos Santos
2017-01-01
To describe a murine model of emphysema induced by a combination of exposure to cigarette smoke (CS) and instillation of porcine pancreatic elastase (PPE). A total of 38 C57BL/6 mice were randomly divided into four groups: control (one intranasal instillation of 0.9% saline solution); PPE (two intranasal instillations of PPE); CS (CS exposure for 60 days); and CS + PPE (two intranasal instillations of PPE + CS exposure for 60 days). At the end of the experimental protocol, all animals were anesthetized and tracheostomized for calculation of respiratory mechanics parameters. Subsequently, all animals were euthanized and their lungs were removed for measurement of the mean linear intercept (Lm) and determination of the numbers of cells that were immunoreactive to macrophage (MAC)-2 antigen, matrix metalloproteinase (MMP)-12, and glycosylated 91-kDa glycoprotein (gp91phox) in the distal lung parenchyma and peribronchial region. Although there were no differences among the four groups regarding the respiratory mechanics parameters assessed, there was an increase in the Lm in the CS + PPE group. The numbers of MAC-2-positive cells in the peribronchial region and distal lung parenchyma were higher in the CS + PPE group than in the other groups, as were the numbers of cells that were positive for MMP-12 and gp91phox, although only in the distal lung parenchyma. Our model of emphysema induced by a combination of PPE instillation and CS exposure results in a significant degree of parenchymal destruction in a shorter time frame than that employed in other models of CS-induced emphysema, reinforcing the importance of protease-antiprotease imbalance and oxidant-antioxidant imbalance in the pathogenesis of emphysema. Descrever um modelo murino de enfisema induzido por exposição a fumaça de cigarro (FC) e instilação de elastase pancreática porcina (EPP). Trinta e oito camundongos C57BL/6 foram aleatoriamente divididos em quatro grupos: controle (uma instilação intranasal
Directory of Open Access Journals (Sweden)
P. J. Irvine
2013-09-01
Full Text Available We present a simple method to generate a perturbed parameter ensemble (PPE of a fully-coupled atmosphere-ocean general circulation model (AOGCM, HadCM3, without requiring flux-adjustment. The aim was to produce an ensemble that samples parametric uncertainty in some key variables and gives a plausible representation of the climate. Six atmospheric parameters, a sea-ice parameter and an ocean parameter were jointly perturbed within a reasonable range to generate an initial group of 200 members. To screen out implausible ensemble members, 20 yr pre-industrial control simulations were run and members whose temperature responses to the parameter perturbations were projected to be outside the range of 13.6 ± 2 °C, i.e. near to the observed pre-industrial global mean, were discarded. Twenty-one members, including the standard unperturbed model, were accepted, covering almost the entire span of the eight parameters, challenging the argument that without flux-adjustment parameter ranges would be unduly restricted. This ensemble was used in 2 experiments; an 800 yr pre-industrial and a 150 yr quadrupled CO2 simulation. The behaviour of the PPE for the pre-industrial control compared well to ERA-40 reanalysis data and the CMIP3 ensemble for a number of surface and atmospheric column variables with the exception of a few members in the Tropics. However, we find that members of the PPE with low values of the entrainment rate coefficient show very large increases in upper tropospheric and stratospheric water vapour concentrations in response to elevated CO2 and one member showed an implausible nonlinear climate response, and as such will be excluded from future experiments with this ensemble. The outcome of this study is a PPE of a fully-coupled AOGCM which samples parametric uncertainty and a simple methodology which would be applicable to other GCMs.
Brennan, Emily; Durkin, Sarah J; Wakefield, Melanie A; Kashima, Yoshihisa
2014-09-01
Decisions about which antismoking advertisements should be aired are often guided by audience ratings of perceived effectiveness (PE). Given that the usefulness of PE measures depends on their ability to predict the likelihood that a message will have a positive impact on outcomes such as behaviour change, in the current study we used pre-exposure, postexposure and follow-up measures to test the association between PE and subsequent changes in quitting intentions and smoking behaviours. Daily smokers (N=231; 18 years and older) completed baseline measures of quitting intentions before watching an antismoking advertisement. Immediately following exposure, intentions were measured again and PE was measured using six items that factored into two scales: ad-directed PE (ADPE) and personalised PE (PPE). A follow-up telephone survey conducted within 3 weeks of exposure measured behaviour change (reduced cigarette consumption or quit attempts). From pre-exposure to postexposure, 18% of smokers showed a positive change in their intentions. Controlling for baseline intentions, PPE independently predicted intention change (OR=2.57, p=0.004). At follow-up, 26% of smokers reported that they had changed their behaviour. PPE scores also predicted the likelihood of behaviour change (OR=1.93, p=0.009). Audience ratings of PPE, but not ADPE, were found to predict subsequent intention and behaviour change. These findings increase confidence in the use of PE measures to pretest and evaluate antismoking television advertisements, particularly when these measures tap the extent to which a smoker has been personally affected by the message. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Ogura, Tomoo; Shiogama, Hideo; Watanabe, Masahiro; Yoshimori, Masakazu; Yokohata, Tokuta; Annan, James D.; Hargreaves, Julia C.; Ushigami, Naoto; Hirota, Kazuya; Someya, Yu; Kamae, Youichi; Tatebe, Hiroaki; Kimoto, Masahide
2017-12-01
This study discusses how much of the biases in top-of-atmosphere (TOA) radiation and clouds can be removed by parameter tuning in the present-day simulation of a climate model in the Coupled Model Inter-comparison Project phase 5 (CMIP5) generation. We used output of a perturbed parameter ensemble (PPE) experiment conducted with an atmosphere-ocean general circulation model (AOGCM) without flux adjustment. The Model for Interdisciplinary Research on Climate version 5 (MIROC5) was used for the PPE experiment. Output of the PPE was compared with satellite observation data to evaluate the model biases and the parametric uncertainty of the biases with respect to TOA radiation and clouds. The results indicate that removing or changing the sign of the biases by parameter tuning alone is difficult. In particular, the cooling bias of the shortwave cloud radiative effect at low latitudes could not be removed, neither in the zonal mean nor at each latitude-longitude grid point. The bias was related to the overestimation of both cloud amount and cloud optical thickness, which could not be removed by the parameter tuning either. However, they could be alleviated by tuning parameters such as the maximum cumulus updraft velocity at the cloud base. On the other hand, the bias of the shortwave cloud radiative effect in the Arctic was sensitive to parameter tuning. It could be removed by tuning such parameters as albedo of ice and snow both in the zonal mean and at each grid point. The obtained results illustrate the benefit of PPE experiments which provide useful information regarding effectiveness and limitations of parameter tuning. Implementing a shallow convection parameterization is suggested as a potential measure to alleviate the biases in radiation and clouds.
Antifungal Properties of Cationic Phenylene Ethynylenes and Their Impact on β-Glucan Exposure.
Pappas, Harry C; Sylejmani, Rina; Graus, Matthew S; Donabedian, Patrick L; Whitten, David G; Neumann, Aaron K
2016-08-01
Candida species are the cause of many bloodstream infections through contamination of indwelling medical devices. These infections account for a 40% mortality rate, posing a significant risk to immunocompromised patients. Traditional treatments against Candida infections include amphotericin B and various azole treatments. Unfortunately, these treatments are associated with high toxicity, and resistant strains have become more prevalent. As a new frontier, light-activated phenylene ethynylenes have shown promising biocidal activity against Gram-positive and -negative bacterial pathogens, as well as the environmental yeast Saccharomyces cerevisiae In this study, we monitored the viability of Candida species after treatment with a cationic conjugated polymer [poly(p-phenylene ethynylene); PPE] or oligomer ["end-only" oligo(p-phenylene ethynylene); EO-OPE] by flow cytometry in order to explore the antifungal properties of these compounds. The oligomer was found to disrupt Candida albicans yeast membrane integrity independent of light activation, while PPE is able to do so only in the presence of light, allowing for some control as to the manner in which cytotoxic effects are induced. The contrast in killing efficacy between the two compounds is likely related to their size difference and their intrinsic abilities to penetrate the fungal cell wall. Unlike EO-OPE-DABCO (where DABCO is quaternized diazabicyclo[2,2,2]octane), PPE-DABCO displayed a strong propensity to associate with soluble β-glucan, which is expected to inhibit its ability to access and perturb the inner cell membrane of Candida yeast. Furthermore, treatment with PPE-DABCO unmasked Candida albicans β-glucan and increased phagocytosis by Dectin-1-expressing HEK-293 cells. In summary, cationic phenylene ethynylenes show promising biocidal activity against pathogenic Candida yeast cells while also exhibiting immunostimulatory effects. Copyright © 2016, American Society for Microbiology. All Rights
Basura, G J; Walker, P D
2000-09-30
Dopamine (DA) depletion in neonatal rodents results in depressed tachykinin and elevated enkephalin gene expression in the adult striatum (STR). Concurrently, serotonin (5-HT) fibers sprout to hyperinnervate the DA-depleted anterior striatum (A-STR). The present study was designed to determine if increased 5-HT release from sprouted terminals influences dysregulated preprotachykinin (PPT) and preproenkephalin (PPE) mRNA expression in the DA-depleted STR. Three-day-old Sprague-Dawley rat pups received bilateral intracerebroventricular injections of vehicle or the DA neurotoxin 6-hydroxydopamine (6-OHDA, 100 microg). Two months later, rats received a single intraperitoneal injection of vehicle or the acute 5-HT releasing agent p-chloroamphetamine (PCA; 10 mg/kg). Rats were killed 4 h later and striata processed for monoamine content by HPLC-ED and mRNA expression by in situ hybridization within specific subregions of the A-STR and posterior striatum (P-STR). 6-OHDA treatment severely (>98%) reduced striatal DA levels, while 5-HT content in the A-STR was significantly elevated (doubled), indicative of 5-HT hyperinnervation. Following 6-OHDA, PPT mRNA levels were depressed 60-66% across three subregions of the A-STR and 52-59% across two subregions of the P-STR, while PPE mRNA expression was elevated in both the A-STR (50-62%) and P-STR (55-82%). PCA normalized PPT mRNA levels in all regions of the DA-depleted A-STR and P-STR, yet did not alter PPE levels in either dorsal central or medial regions from 6-OHDA alone, but reduced PPE to control levels in the dorsal lateral A-STR. These data indicate that increased 5-HT neurotransmission, following neonatal 6-OHDA treatment, primarily influences PPT-containing neurons of the direct striatal output pathway.
Directory of Open Access Journals (Sweden)
T. Ogura
2017-12-01
Full Text Available This study discusses how much of the biases in top-of-atmosphere (TOA radiation and clouds can be removed by parameter tuning in the present-day simulation of a climate model in the Coupled Model Inter-comparison Project phase 5 (CMIP5 generation. We used output of a perturbed parameter ensemble (PPE experiment conducted with an atmosphere–ocean general circulation model (AOGCM without flux adjustment. The Model for Interdisciplinary Research on Climate version 5 (MIROC5 was used for the PPE experiment. Output of the PPE was compared with satellite observation data to evaluate the model biases and the parametric uncertainty of the biases with respect to TOA radiation and clouds. The results indicate that removing or changing the sign of the biases by parameter tuning alone is difficult. In particular, the cooling bias of the shortwave cloud radiative effect at low latitudes could not be removed, neither in the zonal mean nor at each latitude–longitude grid point. The bias was related to the overestimation of both cloud amount and cloud optical thickness, which could not be removed by the parameter tuning either. However, they could be alleviated by tuning parameters such as the maximum cumulus updraft velocity at the cloud base. On the other hand, the bias of the shortwave cloud radiative effect in the Arctic was sensitive to parameter tuning. It could be removed by tuning such parameters as albedo of ice and snow both in the zonal mean and at each grid point. The obtained results illustrate the benefit of PPE experiments which provide useful information regarding effectiveness and limitations of parameter tuning. Implementing a shallow convection parameterization is suggested as a potential measure to alleviate the biases in radiation and clouds.
Parker, Lindsay M; Damanhuri, Hanafi A; Fletcher, Sophie P S; Goodchild, Ann K
2015-04-16
Hypotensive drugs have been used to identify central neurons that mediate compensatory baroreceptor reflex responses. Such drugs also increase blood glucose. Our aim was to identify the neurochemical phenotypes of sympathetic preganglionic neurons (SPN) and adrenal chromaffin cells activated following hydralazine (HDZ; 10mg/kg) administration in rats, and utilize this and SPN target organ destination to ascribe their function as cardiovascular or glucose regulating. Blood glucose was measured and adrenal chromaffin cell activation was assessed using c-Fos immunoreactivity (-ir) and phosphorylation of tyrosine hydroxylase, respectively. The activation and neurochemical phenotype of SPN innervating the adrenal glands and celiac ganglia were determined using the retrograde tracer cholera toxin B subunit, in combination with in situ hybridization and immunohistochemistry. Blood glucose was elevated at multiple time points following HDZ administration but little evidence of chromaffin cell activation was seen suggesting non-adrenal mechanisms contribute to the sustained hyperglycemia. 16±0.1% of T4-T11 SPN contained c-Fos and of these: 24.3±1.4% projected to adrenal glands and 29±5.5% projected to celiac ganglia with the rest innervating other targets. 62.8±1.4% of SPN innervating adrenal glands were activated and 29.9±3.3% expressed PPE mRNA whereas 53.2±8.6% of SPN innervating celiac ganglia were activated and 31.2±8.8% expressed PPE mRNA. CART-ir SPN innervating each target were also activated and did not co-express PPE mRNA. Neurochemical coding reveals that HDZ administration activates both PPE+SPN, whose activity increase glucose mobilization causing hyperglycemia, as well as CART+SPN whose activity drive vasomotor responses mediated by baroreceptor unloading to raise vascular tone and heart rate. Copyright © 2015 Elsevier B.V. All rights reserved.
Anti-corrosion and Anti-bacteria Property of Modified Pomegranate Peel Extract
Gu, Xue-Fan; Chang, Xiao-Feng; Cheng, Chao; Zhang, Li; Zhang, Yong-Ming; Zhang, Jie; Chen, Gang
2018-03-01
Using weight loss method, the pomegranate peel extract (PPE), that is a green corrosion inhibitors, have been studied in the corrosion inhibition of Q235A steel in 1M hydrochloric acid solution at 30°C, 45°C, 60°C, respectively. The inhibition rate of extract varies with the extraction concentration in the range of 10 ∼ 1000mg / L, up to 92.7%. Extract inhibits corrosion through adsorption mechanisms. Besides polyphenols hydroxyl and ether groups can slow down corrosion by capturing H+. Polyphenols can remove the dissolved O2, and curb oxygen reducing corrosion. PPE is antifungal active against TGB and FB, but not so active against SRB.
Methods and systems for identifying ligand-protein binding sites
Gao, Xin
2016-05-06
The invention provides a novel integrated structure and system-based approach for drug target prediction that enables the large-scale discovery of new targets for existing drugs Novel computer-readable storage media and computer systems are also provided. Methods and systems of the invention use novel sequence order-independent structure alignment, hierarchical clustering, and probabilistic sequence similarity techniques to construct a probabilistic pocket ensemble (PPE) that captures even promiscuous structural features of different binding sites for a drug on known targets. The drug\\'s PPE is combined with an approximation of the drug delivery profile to facilitate large-scale prediction of novel drug- protein interactions with several applications to biological research and drug development.
Kvaliteedimärk näitab sihikindlust / Vadim Mitroškin, Eda Anton ; küsitlenud Kaidi Holm
Mitroškin, Vadim
2006-01-01
Elukestva Õppe Arendamise Sihtasutuse INNOVE eestvedamisel korraldatud kutsekoolide kvaliteediauhinna konkursist. Küsimustele vastavad Võrumaa Kutsehariduskeskuse kvaliteedidirektor Vadim Mitroškin ja Tartu Kutsehariduskeskuse kvaliteedijuht Eda Anton
Fundamentals of the knowledge about chemical additives present in rubber gloves.
Oliveira, Hegles Rosa de; Alchorne, Alice de Oliveira de Avelar
2011-01-01
One of the most frequent causes of allergic contact dermatitis of occupational origin are rubber additives, which are present in Personal Protective Equipment (PPE). The most allergenic additives of natural and synthetic gloves are thiurams, carbamates and mercapto group. To investigate the state of knowledge about the chemical additives used in the manufacture of synthetic rubber gloves. This was a qualitative research study in which professionals working in the manufacture, research, prescription and commercialization of gloves answered an open questionnaire. 30 individuals were interviewed: 4 researchers in occupational medicine, 5 occupational physicians, 2 occupational safety technicians, a rubber workers' union physician, an occupational safety engineer, a pro duction engineer of rubber gloves, 4 importers of gloves, a manufacturer of gloves, 3 businessmen who sell PPE, 3 salesclerks working in stores that sell PPE, 2 businessmen who own stores that sell products for allergic individuals, and 3 dermatologists. Knowledge of the chemical composition of rubber gloves is scant. The labeling of gloves, with the description of their chemical composition, would facilitate choosing the best type of glove for each person. This low-cost action to businesses would be a gain from the standpoint of public health, with huge repercussions for users of rubber gloves.
Knowledge, Attitudes, and Practices for Respiratory and Hearing Health among Midwestern Farmers.
Cramer, Mary E; Wendl, Mary J; Sayles, Harlan; Duysen, Ellen; Achutan, Chandran
2017-07-01
The purpose of this study was to assess knowledge, attitudes, and practices for hearing and respiratory health/safety among farmers in seven Midwestern states served by a federally funded Agricultural Center. Findings provided a baseline to longitudinally track the Agricultural Center's program outcomes and to design community education to improve safety and health among farmers. This was a cross-sectional study using a 30 item mailed survey to describe farmers' operations, demographics, health conditions, related information sources, and knowledge/attitude/practices for personal protective equipment (PPE) (i.e., ear plugs/muffs and dust masks/respirators). Frequencies and percentages were calculated for each item and according to responses from younger versus older farmers. The unit of study was farm operators (N = 280) randomly selected from a publicly available database of corn/soybean and hog farmers in seven Midwestern states. Findings revealed important knowledge gaps among respondents regarding (1) hazardous exposure sources; (2) long-term health consequences of noise/dust exposure; (3) proper selection/fitting of PPE. Public health nurses and primary care providers in rural communities should address specific knowledge gaps in order to enhance farmers' perceived understanding of their susceptibility to hazardous exposures. Increasing farmers' knowledge through preferred venues may help to improve PPE effectiveness. © 2016 Wiley Periodicals, Inc.
Extreme regimes of femtosecond photoemission from a copper cathode in a dc electron gun
Directory of Open Access Journals (Sweden)
P. L. E. M. Pasmans
2016-10-01
Full Text Available The femtosecond photoemission yield from a copper cathode and the emittance of the created electron beams has been studied in a 12 MeV/m, 100 keV dc electron gun over a wide range of laser fluence, from the linear photoemission regime until the onset of image charge limitations and cathode damaging. The measured photoemission curves can be described well with available theory which includes the Schottky effect, second-order photoemission, and image charge limitation. The second-order photoemission can be explained by thermally assisted one-photon photoemission (1PPE and by above-threshold two-photon photoemission (2PPE. Measurements with a fresh cathode suggest that the 2PPE process is dominant. The beam emittance has been measured for the entire range of initial surface charge densities as well. The emittance measurements of space-charge dominated beams can be described well by an envelope equation with generalized perveance. The dc gun produces 0.1 pC bunches with 25 nm rms normalized emittance, corresponding to a normalized brightness usually associated with rf photoguns. In this experimental study the limits of femtosecond photoemission from a copper cathode have been explored and analyzed in great detail, resulting in improved understanding of the underlying mechanisms.
Frequency Analysis of Failure Scenarios from Shale Gas Development.
Abualfaraj, Noura; Gurian, Patrick L; Olson, Mira S
2018-04-29
This study identified and prioritized potential failure scenarios for natural gas drilling operations through an elicitation of people who work in the industry. A list of twelve failure scenarios of concern was developed focusing on specific events that may occur during the shale gas extraction process involving an operational failure or a violation of regulations. Participants prioritized the twelve scenarios based on their potential impact on the health and welfare of the general public, potential impact on worker safety, how well safety guidelines protect against their occurrence, and how frequently they occur. Illegal dumping of flowback water, while rated as the least frequently occurring scenario, was considered the scenario least protected by safety controls and the one of most concern to the general public. In terms of worker safety, the highest concern came from improper or inadequate use of personal protective equipment (PPE). While safety guidelines appear to be highly protective regarding PPE usage, inadequate PPE is the most directly witnessed failure scenario. Spills of flowback water due to equipment failure are of concern both with regards to the welfare of the general public and worker safety as they occur more frequently than any other scenario examined in this study.
Lemmer, K; Howaldt, S; Heinrich, R; Roder, A; Pauli, G; Dorner, B G; Pauly, D; Mielke, M; Schwebke, I; Grunow, R
2017-11-01
The work aimed at developing and evaluating practically relevant methods for testing of disinfectants on contaminated personal protective equipment (PPE). Carriers were prepared from PPE fabrics and contaminated with Bacillus subtilis spores. Peracetic acid (PAA) was applied as a suitable disinfectant. In method 1, the contaminated carrier was submerged in PAA solution; in method 2, the contaminated area was covered with PAA; and in method 3, PAA, preferentially combined with a surfactant, was dispersed as a thin layer. In each method, 0·5-1% PAA reduced the viability of spores by a factor of ≥6 log 10 within 3 min. The technique of the most realistic method 3 proved to be effective at low temperatures and also with a high organic load. Vaccinia virus and Adenovirus were inactivated with 0·05-0·1% PAA by up to ≥6 log 10 within 1 min. The cytotoxicity of ricin was considerably reduced by 2% PAA within 15 min of exposure. PAA/detergent mixture enabled to cover hydrophobic PPE surfaces with a thin and yet effective disinfectant layer. The test methods are objective tools for estimating the biocidal efficacy of disinfectants on hydrophobic flexible surfaces. © 2017 The Society for Applied Microbiology.
Direct liquefaction of plastics and coprocessing of coal with plastics
Energy Technology Data Exchange (ETDEWEB)
Huffman, G.P.; Feng, Z.; Mahajan, V. [Univ. of Kentucky, Lexington, KY (United States)
1995-12-31
The objectives of this work were to optimize reaction conditions for the direct liquefaction of waste plastics and the coprocessing of coal with waste plastics. In previous work, the direct liquefaction of medium and high density polyethylene (PE), polypropylene (PPE), poly(ethylene terephthalate) (PET), and a mixed plastic waste, and the coliquefaction of these plastics with coals of three different ranks was studied. The results established that a solid acid catalyst (HZSM-5 zeolite) was highly active for the liquefaction of the plastics alone, typically giving oil yields of 80-95% and total conversions of 90-100% at temperatures of 430-450 {degrees}C. In the coliquefaction experiments, 50:50 mixtures of plastic and coal were used with a tetralin solvent (tetralin:solid = 3:2). Using approximately 1% of the HZSM-5 catalyst and a nanoscale iron catalyst, oil yields of 50-70% and total conversion of 80-90% were typical. In the current year, further investigations were conducted of the liquefaction of PE, PPE, and a commingled waste plastic obtained from the American Plastics Council (APC), and the coprocessing of PE, PPE and the APC plastic with Black Thunder subbituminous coal. Several different catalysts were used in these studies.
Presence of mercury in natural gas
International Nuclear Information System (INIS)
Gijselman, P.B.
1991-01-01
This paper describes the occupational health programme used to ensure that NAM and contractor personnel of the Nederlandse Aardolie Mij (NAM) exposed to mercury, common in Dutch gas, are adequately protected through the correct use of Personal Protective Equipment (PPE), proper instruction and suitable work procedures. To avoid health damage due to mercury exposure during maintenance and shutdown activities the occupational health department of NAM set up a programme covering 3 activities: monitoring of atmospheric air; sampling of inspired air during work, and measurement of mercury excretion in urine of workers instruction of company and contractor personnel consultancy during preparation of work instructions. The monitoring program showed that, through correct use of PPE, staff do not exhibit mercury concentration levels exceeding the human toxicity limit (100 ug/g creatinine) even after exposure to mercury vapor concentrations above the TLV of 0.5 mg/m 3 . The correct use of PPE is a result of the instruction programme which also promotes increased awareness for personnel of the harmful effects of mercury. Finally, the provision of consultancy during the preparation of work instructions has contributed to various measures; for instance, staff wearing plastic (Viton) protective suits may not work longer than 2 hours continuously to avoid heat exhaustion
Directory of Open Access Journals (Sweden)
Susana Lastras González
2008-09-01
Full Text Available En este trabajo proporcionaremos la información disponible sobre los equipos de protección individual (EPIs como parte importante de nuestra labor como médicos del trabajo. Todos los trabajadores están expuestos a una serie de riesgos, la mayor parte de ellos prevenibles de forma colectiva, pero en algunas ocasiones, estas medidas no llegan a ser del todo eficaces por lo que son necesarios equipos de protección individual. Estos equipos están destinados a ser llevados o sujetados por los trabajadores para protegerles de los riesgos que puedan amenazar su seguridad o su salud en el ámbito del trabajo, pero sin embargo, son capaces por sí mismos de crear efectos indeseables en la salud de los trabajadores, derivados de su uso. Por este motivo, los médicos del trabajo deben vigilar la salud de los trabajadores, valorando sus factores personales que puedan dificultar el uso de EPIs, informar y formar a los trabajadores sobre todo lo relativo al uso de los mismos, elegir el EPI adecuado para cada trabajador y, sobretodo, realizar un seguimiento para detectar posibles efectos indeseables del uso de EPIs y así evitar la no utilización y, por tanto, la ineficacia del EPI.In this study will provide information on personal protective equipment (PPE as an important part of our work as doctors work. All workers are exposed to a number of risks, most of them preventable in a collective manner, but in some cases, these measures do not become fully effective it is necessary protective equipment. These teams are intended to be carried or restrained by workers to protect them from risks that may threaten their safety or health in the workplace, but nevertheless they are capable of creating their own effects on the health of workers, derived from its use. For this reason, doctors should monitor the work of health workers, assessing their personal factors that might hinder the use of PPE, inform and train workers on all matters relating to the use of
ORF Alignment: NC_000117 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available sphate 3-epimerase (Pentose-5-phosphate ... 3-epimerase) (PPE) (R5P3E) ... Length = 216 ... Query: 1 ... MREEAMKKQGVLVAPSIM...GADLACIGREARNIEESGADLIHIDVMDGHFVPNITFGPGVV 60 ... MREEAMKKQGVLVAPSIMGADLACIGR...EARNIEESGADLIHIDVMDGHFVPNITFGPGVV Sbjct: 1 ... MREEAMKKQGVLVAPSIMGADLACIGREARNIEESG
ORF Alignment: NC_002620 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available hosphate 3-epimerase (Pentose-5-phosphate ... 3-epimerase) (PPE) (R5P3E) ... Length = 205 ... Query: 7 ... LIAPSIM...GADLACLGDAARNIEESGANLIHIDVMDGHFVPNITFGPGIIAAINRSTDLFL 66 ... LIAPSIMGADLACLGDAARNIEESG...ANLIHIDVMDGHFVPNITFGPGIIAAINRSTDLFL Sbjct: 1 ... LIAPSIMGADLACLGDAARNIEESGANLIHIDVM
Pronkslamp viis arheoloogi keemia rüppe / Kaspar Koort
Koort, Kaspar
2016-01-01
Tartu ülikooli Chemicumis arheokeemia alast teadustööd tegevast Ester Orasest. Doktoritööst, mille Ester Oras kaitses Cambridge Ülikoolis "Väärisesemete peitmispraktikad 1.-9. sajandini Baltimaades"
Pluri-annual programming of energy (PPE): an escalation policy
International Nuclear Information System (INIS)
Perves, J.P.
2016-01-01
Concerning the pluri-annual programming of energy for the 2018-2023 period, the French government proposes to accelerate the deployment of wind and solar energies in order to reach 43.000 - 49.200 MW globally in 2023. To compare wind and solar energies totaled 16.500 MW in 2015. The 2023 level will represent around 70% of the today's nuclear power production. This energy policy will require a huge investment of 60 billions euros by 2023. It appears that offshore wind energy is not favoured because of its important costs and this acceleration will imply more wind turbines installed on land which can have a negative impact on the environment. Furthermore wind and solar energies will require other sources of energy to compensate seasonal effects, the back-up energy may be nuclear but it would increase the kWh cost because nuclear energy will be under-used. The gain in CO_2 will be null because the electricity production in France is largely de-carbonized thanks to the use of nuclear energy. A more progressive deployment of renewable energies in the French energy mix is recommended. (A.C.)
Theodor Lutsu mälestusi (III) / Theodor Luts
Luts, Theodor, 1896-1980
1989-01-01
Õppe-propagandafilm "Gaas! Gaas! Gaas!" ("Th. Lutsu Filmiproduktsioon", 1931), dokumentaalfilm "Ruhno" ("Th. Lutsu Filmiproduktsioon", 1931) ja mängufilm "Päikese lapsed" ("Th. Lutsu Filmiproduktsioon" ja "Suomi Film", 1932)
Health Problems among Sawmill Workers in Abakaliki and ...
African Journals Online (AJOL)
adedamla
Unawareness of PPE (29.8%), non-availability (21.1%) and cost (17.5%) were the commonest reasons for .... consent. Smokers were not excluded ... demographics, smoking history, occupational ..... Environmental Health Perspectives 1995;.
Jefferson Proving Ground, South of the Firing Line Health and Safety Plan, Volume 4
National Research Council Canada - National Science Library
1992-01-01
.... The purpose of this Site Health and Safety Plan (SHSP) is to assign SECD personnel health and safety responsibilities, to prescribe mandatory operating procedures, and to establish personal-protective-equipment (PPE...
Interaction of calcitonin gene related peptide (CGRP) and substance P (SP) in human skin.
Schlereth, Tanja; Schukraft, Jonas; Krämer-Best, Heidrun H; Geber, Christian; Ackermann, Tatiana; Birklein, Frank
2016-10-01
Calcitonin gene related peptide (CGRP) and substance P (SP) are neuropeptides that are simultaneously released from nociceptive C-fibers. CGRP is a potent vasodilator, inducing a long-lasting increase in superficial skin blood flow, whereas SP induces only a brief vasodilation but a significant plasma extravasation. CGRP and SP may play important roles in the pathophysiology of various pain states but little is known about their interaction. Different concentrations of SP (ranging from 10 -5 M to 10 -9 M) were applied to the volar forearm of 24 healthy subjects via dermal microdialysis. SP was applied either alone or in combination with CGRP10 -9 M and CGRP 10 -6 M. As expected, SP induced a transient increase in skin blood flow that decayed shortly after application. This transient blood flow peak was blunted with co-application of CGRP 10 -9 M and inhibited with co-application of CGRP10 -6 M. SP alone induced plasma protein extravasation (PPE). However, when CGRP10 -6 M was added, the PPE significantly increased. Our results demonstrate a complex interaction of the neuropeptides CGRP and SP. CGRP10 -6 M prevented SP-induced early vasodilation but augmented SP-induced PPE. These interactions might explain why vascular symptoms in chronic pain can differ strikingly between individuals. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Tobinaga, Shuichi; Matsumoto, Keitaro; Nagayasu, Takeshi; Furukawa, Katsuro; Abo, Takafumi; Yamasaki, Naoya; Tsuchiya, Tomoshi; Miyazaki, Takuro; Koji, Takehiko
2015-01-01
Pulmonary emphysema is a progressive disease with airspace destruction and an effective therapy is needed. Keratinocyte growth factor (KGF) promotes pulmonary epithelial proliferation and has the potential to induce lung regeneration. The aim of this study was to determine the possibility of using KGF gene therapy for treatment of a mouse emphysema model induced by porcine pancreatic elastase (PPE). Eight-week-old BALB/c male mice treated with intra-tracheal PPE administration were transfected with 80 μg of a recombinant human KGF (rhKGF)-expressing FLAG-CMV14 plasmid (pKGF-FLAG gene), or with the pFLAG gene expressing plasmid as a control, into the quadriceps muscle by electroporation. In the lung, the expression of proliferating cell nuclear antigen (PCNA) was augmented, and surfactant protein A (SP-A) and KGF receptor (KGFR) were co-expressed in PCNA-positive cells. Moreover, endogenous KGF and KGFR gene expression increased significantly by pKGF-FLAG gene transfection. Arterial blood gas analysis revealed that the PaO 2 level was not significantly reduced on day 14 after PPE instillation with pKGF-FLAG gene transfection compared to that of normal mice. These results indicated that KGF gene therapy with electroporation stimulated lung epithelial proliferation and protected depression of pulmonary function in a mouse emphysema model, suggesting a possible method of treating pulmonary emphysema
Li, S.; Rupp, D. E.; Hawkins, L.; Mote, P.; McNeall, D. J.; Sarah, S.; Wallom, D.; Betts, R. A.
2017-12-01
This study investigates the potential to reduce known summer hot/dry biases over Pacific Northwest in the UK Met Office's atmospheric model (HadAM3P) by simultaneously varying multiple model parameters. The bias-reduction process is done through a series of steps: 1) Generation of perturbed physics ensemble (PPE) through the volunteer computing network weather@home; 2) Using machine learning to train "cheap" and fast statistical emulators of climate model, to rule out regions of parameter spaces that lead to model variants that do not satisfy observational constraints, where the observational constraints (e.g., top-of-atmosphere energy flux, magnitude of annual temperature cycle, summer/winter temperature and precipitation) are introduced sequentially; 3) Designing a new PPE by "pre-filtering" using the emulator results. Steps 1) through 3) are repeated until results are considered to be satisfactory (3 times in our case). The process includes a sensitivity analysis to find dominant parameters for various model output metrics, which reduces the number of parameters to be perturbed with each new PPE. Relative to observational uncertainty, we achieve regional improvements without introducing large biases in other parts of the globe. Our results illustrate the potential of using machine learning to train cheap and fast statistical emulators of climate model, in combination with PPEs in systematic model improvement.
Directory of Open Access Journals (Sweden)
Diego Gil de Los Santos
Full Text Available In a previous paper we showed that the yeast Pichia pastoris X-33 grown in parboiled rice effluent supplemented with glycerol byproduct from the biodiesel industry improved the quality of the effluent. In this paper we show the validation of this yeast (PPE as probiotic for broilers. Its effect on feed efficiency and immunomodulation was compared with the same yeast grown in yeast peptone dextrose medium (PPY, with Saccharomyces boulardii (SBY and with the controls fed unsupplemented feed (CON. One-day-old female chicks were vaccinated against infectious bursal disease (IBD and the titers of anti-IBD antibodies were measured by ELISA. PPE group had the highest mean titres on days 14 and 28 (p<0,05, and at 28 days, 64% of the animals showed seroconvertion. The PPE group also showed the best weight gains at 42 days of age, that, on days 7, 14 and 21 were 19%, 15%, and 8.7% higher, respectively, than the control group. The best feed conversion, 8.2% higher than the control group, was obtained by PPY at 42 days. Histopathological studies did not detect any undesirable effects in the supplemented animals. We concluded that Pichia pastoris X-33 when grown in effluents of the rice parboiling industry supplemented with glycerol byproduct from the biodiesel has probiotic properties for poultry.
Moreau, William J.; Nabhan, Dustin C.; Roecker, Christopher; Kimura, Melissa Nagare; Klein, Andrew; Guimard, Brett; Pierce, Kevin; Helma, Patrick; Nelson, Robert; Bahr, Kelly Shockley; Nelson, Laney; Williams, Perry
2015-01-01
Objective The purpose of this paper is to present a position statement of best practices for the provision of a safe and high-quality pre-participation examination (PPE) and to provide recommendations on education requirements for doctors of chiropractic providing the PPE. Methods In 2014, the American Chiropractic Board of Sports Physicians (ACBSP) Board of Directors identified a need to review and update the ACBSP position statements and practice guidelines in order to be current with evolving best practices. Twelve ACBSP certificants, 10 Diplomates of the ACBSP, and 2 Certified Chiropractic Sports Physicians, met in April 2015 to author a pre-participation position statement using an expert consensus process. Panel members excluded anyone with commercial conflicts of interest and included individuals with expertise in clinical sports medicine and the performance of PPEs. A literature review was performed and circulated in advance for use by the panel in addressing the topic. The position statement was written through a consensus process and accepted by the ACBSP Board of Directors in May of 2015. Results The ACBSP Position Statement on Pre-participation Examinations identifies the qualifications and best practices for doctors of chiropractic to perform a PPE. Conclusion This position statement states that doctors of chiropractic with post graduate education and current Diplomates of the ACBSP or Certified Chiropractic Sports Physicians certification have the prerequisite education and qualifying skills to perform PPEs. PMID:26778931
Han, Don-Hee; Park, Min Soo
2018-02-10
With economic growth, the use of chemicals has continually increased, resulting in an increase of chemical accidents. Chemical accidents pose a life threat and can lead to many health problems among the residents living in close proximity to chemical plants. This study aimed to investigate the awareness of the residents living near chemical plants about hazardous chemicals, as well as to survey the awareness of workers who do not directly handle chemicals at chemical plants (WNHCs). To this end, a questionnaire survey was conducted among a total of 600 residents and 160 WNHCs. The questionnaire was composed of three items: awareness of chemical risk, awareness of countermeasures in chemical accidents, and imperious necessity of PPE (personal protective equipment). Statistical analysis of the data was performed with the Statistical Package for Social Sciences (SPSS) version 18.0. The results show that the government needs to complement the notification system of chemical risk for residents who live close to chemical plants. The highest priority of PPE which residents want to prepare for chemical accidents was respiratory protective equipment (RPE). They responded that, if necessary to purchase PPE, they could bear a portion of the expenses (up to US $30). This study provides basic data for the development of programs and policies on chemical safety relevant for the residents living in close proximity to chemical plants in South Korea.
Moreau, William J; Nabhan, Dustin C; Roecker, Christopher; Kimura, Melissa Nagare; Klein, Andrew; Guimard, Brett; Pierce, Kevin; Helma, Patrick; Nelson, Robert; Bahr, Kelly Shockley; Nelson, Laney; Williams, Perry
2015-09-01
The purpose of this paper is to present a position statement of best practices for the provision of a safe and high-quality pre-participation examination (PPE) and to provide recommendations on education requirements for doctors of chiropractic providing the PPE. In 2014, the American Chiropractic Board of Sports Physicians (ACBSP) Board of Directors identified a need to review and update the ACBSP position statements and practice guidelines in order to be current with evolving best practices. Twelve ACBSP certificants, 10 Diplomates of the ACBSP, and 2 Certified Chiropractic Sports Physicians, met in April 2015 to author a pre-participation position statement using an expert consensus process. Panel members excluded anyone with commercial conflicts of interest and included individuals with expertise in clinical sports medicine and the performance of PPEs. A literature review was performed and circulated in advance for use by the panel in addressing the topic. The position statement was written through a consensus process and accepted by the ACBSP Board of Directors in May of 2015. The ACBSP Position Statement on Pre-participation Examinations identifies the qualifications and best practices for doctors of chiropractic to perform a PPE. This position statement states that doctors of chiropractic with post graduate education and current Diplomates of the ACBSP or Certified Chiropractic Sports Physicians certification have the prerequisite education and qualifying skills to perform PPEs.
Surgical management for displaced pediatric proximal humeral fractures: a cost analysis.
Shore, Benjamin J; Hedequist, Daniel J; Miller, Patricia E; Waters, Peter M; Bae, Donald S
2015-02-01
The purpose of this investigation was to determine which of the following methods of fixation, percutaneous pinning (PP) or intramedullary nailing (IMN), was more cost-effective in the treatment of displaced pediatric proximal humeral fractures (PPHF). A retrospective cohort of surgically treated PPHF over a 12-year period at a single institution was performed. A decision analysis model was constructed to compare three surgical strategies: IMN versus percutaneous pinning leaving the pins exposed (PPE) versus leaving the pins buried (PPB). Finally, sensitivity analyses were performed, assessing the cost-effectiveness of each technique when infection rates and cost of deep infections were varied. A total of 84 patients with displaced PPHF underwent surgical stabilization. A total of 35 cases were treated with IMN, 32 with PPE, and 17 with PPB. The age, sex, and preoperative fracture angulation were similar across all groups. A greater percentage of open reduction was seen in the IMN and PPB groups (p = 0.03), while a higher proportion of physeal injury was seen in the PPE group (p = 0.02). Surgical time and estimated blood loss was higher in the IMN group (p exposed implants approached 55 %. Leaving pins exposed after surgical fixation of PPHF is more cost-effective than either burying pins or using intramedullary fixation.
Obeidat, Abdalla; Abu-Ghazleh, Hind
2018-06-01
Two intermolecular potential models of methanol (TraPPE-UA and OPLS-AA) have been used in order to examine their validity in reproducing the selected structural, dynamical, and thermodynamic properties in the unary and binary systems. These two models are combined with two water models (SPC/E and TIP4P). The temperature dependence of density, surface tension, diffusion and structural properties for the unary system has been computed over specific range of temperatures (200-300K). The very good performance of the TraPPE-UA potential model in predicting surface tension, diffusion, structure, and density of the unary system led us to examine its accuracy and performance in its aqueous solution. In the binary system the same properties were examined, using different mole fractions of methanol. The TraPPE-UA model combined with TIP4P-water shows a very good agreement with the experimental results for density and surface tension properties; whereas the OPLS-AA combined with SPCE-water shows a very agreement with experimental results regarding the diffusion coefficients. Two different approaches have been used in calculating the diffusion coefficient in the mixture, namely the Einstein equation (EE) and Green-Kubo (GK) method. Our results show the advantageous of applying GK over EE in reproducing the experimental results and in saving computer time.
International Nuclear Information System (INIS)
Tanaka, A.; Tohoku University; University of Rochester, NY; Yan, L.; Watkins, N.J.; Gao, Y.
2004-01-01
Full text: Organic semiconductors are recently attracting much interest from the viewpoints of both device and fundamental physics. These organic semiconductors are considered to be important constituents of the future devices, such as organic light-emitting diode, organic field effect transistor, and organic solid-state injection laser. In order to elucidate their detailed physical properties and to develop the future devices, it is indispensable to understand their excited-state dynamics as well as their electronic structures. The femtosecond time-resolved two-photon photoemission (TR-2PPE) spectroscopy is attracting much interest because of its capability to observe the energy-resolved excited electron dynamics. In this work, we have carried out a TR-2PPE study of the organic semiconductor copper phthalocyanine (CuPc) film. Furthermore, we have investigated the detailed electronic structure of CuPc film using the photoemission (PES) and inverse photoemission (IPES) spectroscopies. From the simultaneous PES and IPES measurements for CuPc film with a thickness of 100 nm, the lowest unoccupied molecular orbital (LUMO), highest occupied molecular orbital, and ionization potential of CuPc film have been directly determined. The observed two-photon photoemission (2PPE) spectrum of the present CuPc film, measured with photon energy of about hv=3.3 eV, exhibits a broad feature. From the energy diagram of CuPc film determined by the PES and IPES measurements, the intermediate state observed in the present 2PPE spectrum of CuPc film corresponds to the energy region between about 0.4 and 1.7 eV above the LUMO energy. From the time-resolved pump-probe measurements, it is found that the relaxation lifetimes of excited states in the present CuPc films are very short (all below 50 fs) and monotonously become faster with increasing excitation energy. We attribute this extremely fast relaxation process of photoexcitation to a rapid internal conversion process. From these results
Identification of cis-acting regulatory elements in the human oxytocin gene promoter.
Richard, S; Zingg, H H
1991-12-01
The expression of hormone-inducible genes is determined by the interaction of trans-acting factors with hormone-inducible elements and elements mediating basal and cell-specific expression. We have shown earlier that the gene encoding the hypothalamic nonapeptide oxytocin (OT) is under the control of an estrogen response element (ERE). The present study was aimed at identifying cis-acting elements mediating basal expression of the OT gene. A construct containing sequences -381 to +36 of the human OT gene was linked to a reporter gene and transiently transfected into a series of neuronal and nonneuronal cell lines. Expression of this construct was cell specific: it was highest in the neuroblastoma-derived cell line, Neuro-2a, and lowest in NIH 3T3 and JEG-3 cells. By 5' deletion analysis, we determined that a segment from -49 to +36 was capable of mediating cells-pecific promoter activity. Within this segment, we identified three proximal promoter elements (PPE-1, PPE-2, and PPE-3) that are each required for promoter activity. Most notably, mutation of a conserved purine-rich element (GAGAGA) contained within PPE-2 leads to a 10-fold decrease in promoter strength. Gel mobility shift analysis with three different double-stranded oligonucleotides demonstrated that each proximal promoter element binds distinct nuclear factors. In each case, only the homologous oligonucleotide, but neither of the oligonucleotides corresponding to adjacent elements, was able to act as a competitor. Thus, a different set of factors appears to bind independently to each element. By reinserting the homologous ERE or a heterologous glucocorticoid response element upstream of intact or altered proximal promoter segments we determined that removal or mutation of proximal promoter elements decreases basal expression, but does not abrogate the hormone responsiveness of the promoter. In conclusion, these results indicate that an important component of the transcriptional activity of the OT
Research Article Special Issue
African Journals Online (AJOL)
2016-07-16
Jul 16, 2016 ... According to conducted studies, financial structure of organization was so important in its ... Market balance is not established based on nominal values and investors .... PPE (Gross of property, equipment and Machinery).
Research Article Special Issue
African Journals Online (AJOL)
2016-07-16
Jul 16, 2016 ... Ownership structure is different (Hussaini, 1390). ... recognized as an organization that is managed and controlled by several ... Based on agency theory, the ..... PPE = The gross value of property, machinery, and equipment.
T-algebra - samm drillist edasi / Rein Prank
Prank, Rein, 1949-
2009-01-01
Õpiprogrammist T-algebra, mille andis Tartu Ülikooli arvutiteaduse instituudi töörühm üle Tiigrihüppe sihtasutusele ja mis võimaldab õpilastel saada kiiresti tagasisidet lahenduste õigsuse kohta
Directory of Open Access Journals (Sweden)
Adeola Alex Adesuyi
2018-06-01
Full Text Available The unsafe and indiscriminate use of pesticides in wetlands for agriculture represents a major hazard to the environment and human health globally. The hazard of pesticide exposure and farmers susceptibility is due to lack of knowledge regarding its safe use, proper pesticides handling and practices. The aim of this study was to evaluate vegetable farmers’ knowledge, practices and exposure level during pesticides preparation and application in their crop production. A total of eighty one (81 vegetable farmers were identified in these wetlands. Four (4 declined the usage of pesticides because they are organic farmers. In all, seventy seven (77 vegetable farms and farmers were sampled for this study using a structured questionnaire. Data obtained were subjected to descriptive and inferential statistics. The results indicate high risks of exposure of the vegetable farmers to toxicity and health hazards to pesticides. 71.4% of the farmers agreed that pesticide use poses some potential risk to human health while 63.6% agreed that it poses risk also to the environment. The majority of the farmers (48.1% stored their pesticides in the open field. Some respondents also stored their pesticides in open shed meant just for pesticides (18.2, and locked chemical stores designated only for pesticides (14.3%. A worrying 6.5% of the farmers reported storing pesticides within their living area. Respondents with higher education levels were significantly less likely to store pesticides in their home (?2 = 24.65, p< 0.05. Over 67% of the farmers indicated using at least one PPE during handling, preparation and spraying of pesticides. Among respondents who reported using PPE, less that 11% wore all the recommended six key PPE items (coveralls, protective boots, glasses/goggles, gloves, respirator, and hat. A substantial number of respondents reported not wearing respirators/nose mask (84.6%, coveralls (59.6%, or glasses/goggles (46.1% at all. The PPE most often
Kusumawardani, R.; Hasanah, N.; Sukemi
2018-04-01
In Indonesia, reuse of cooking oil is high and common. Heating process and reuse of the cooking oil causes a change in its chemical constituents and decrease its qualities. This research aimed to investigate the addition of pineapple flesh extract (PFE) and pineapple peel extract (PPE) on the increment of the quality of oxidized (used) cooking oil. The cooking oil has been used three times. Treatment was done by mixing the used cooking oil with the extract (2:1) at 50°C. Peroxide value, FFA and iodine number of treated and untreated used cooking oils were measured by using titration method. The result showed that the treatment could increase the quality of the used cooking oils. PPE was better than PFE to increase the quality of the used cooking oil.
Microspot two-photon photoemission spectroscopy for CuPc film on HOPG
International Nuclear Information System (INIS)
Yamada, T.; Yamamoto, R.; Munakata, T.
2015-01-01
Highlights: • Unoccupied levels of CuPc/HOPG are assigned by using 2PPE microspectroscopy. • Lateral distribution of unoccupied energy levels is imaged. • Modified IPS stabilized by the hole localized in the 2nd layer molecule is identified. - Abstract: Microspot two-photon photoemission (micro-2PPE) spectroscopy has been applied to measure the lateral distribution of unoccupied levels on copper phthalocyanine (CuPc) film on HOPG. In addition to the LUMO-derived level and the image potential state (IPS) on the film, we identified the modified IPS which is stabilized by the hole localized in a molecule. We show that modified IPS is observed only on bilayer area, reflecting the localization of the hole in a molecule. The modified IPS is absent on monolayer area, because the hole strongly interacts with substrate.
Addition of the electrocardiogram to the preparticipation examination of college athletes.
Le, Vy-Van; Wheeler, Matthew T; Mandic, Sandra; Dewey, Frederick; Fonda, Holly; Perez, Marco; Sungar, Gannon; Garza, Daniel; Ashley, Euan A; Matheson, Gordon; Froelicher, Victor
2010-03-01
Although the use of standardized cardiovascular (CV) system-focused history and physical examination is recommended for the preparticipation examination (PPE) of athletes, the addition of the electrocardiogram (ECG) has been controversial. Because the impact of ECG screening on college athletes has rarely been reported, we analyzed the findings of adding the ECG to the PPE of Stanford athletes. For the past 15 years, the Stanford Sports Medicine program has mandated a PPE questionnaire and physical examination by Stanford physicians for participation in intercollegiate athletics. In 2007, computerized ECGs with digital measurements were recorded on athletes and entered into a database. Although the use of standardized CV-focused history and physical examination are recommended for the PPE of athletes, the addition of the ECG has been controversial. Because the feasibility and outcomes of ECG screening on college athletes have rarely been reported, we present findings derived from the addition of the ECG to the PPE of Stanford athletes. For the past 15 years, the Stanford Sports Medicine program has mandated a PPE questionnaire and physical examination by Stanford physicians for participation in intercollegiate athletics. In 2007, computerized ECGs with digital measurements were recorded on athletes and entered into a database. Six hundred fifty-eight recordings were obtained (54% men, 10% African-American, mean age 20 years) representing 24 sports. Although 68% of the women had normal ECGs, only 38% of the men did so. Incomplete right bundle branch block (RBBB) (13%), right axis deviation (RAD) (10%), and atrial abnormalities (3%) were the 3 most common minor abnormalities. Sokolow-Lyon criteria for left ventricular hypertrophy (LVH) were found in 49%; however, only 27% had a Romhilt-Estes score of >or=4. T-wave inversion in V2 to V3 occurred in 7%, and only 5 men had abnormal Q-waves. Sixty-three athletes (10%) were judged to have distinctly abnormal ECG findings
Diffusivities and Viscosities of Poly(ethylene oxide) Oligomers †
Hong, Bingbing; Escobedo, Fernando; Panagiotopoulos, Athanassios Z.
2010-01-01
Diffusivities and viscosities of poly(ethylene oxide) (PEO) oligomer melts with 1 to 12 repeat units have been obtained from equilibrium molecular dynamics simulations using the TraPPE-UA force field. The simulations generated diffusion coefficients
Effectiveness of ultraviolet light personal protective equipment used ...
African Journals Online (AJOL)
Journal of Agriculture, Science and Technology ... (UV) light personal protective equipment (PPE) used by arc welders in the informal sector. ... all had formal education: 31.1% had primary school level as the highest attained education level, ...
2007-01-01
Tartu Ülikooli maalikunsti eriala lõpetajate Veiko Klemmeri, Helen Kikkase ja Margit Lõhmuse tööde näitus Tartu Kunstimuuseumis ning Ronald Baumanni, Nadezhda Tshernobai ja Jäppe Johansoni näitus Tartu Kunstimajas
National Research Council Canada - National Science Library
Granetto, Paul
2003-01-01
.... The Navy reported an estimated $ 1.3 billion of deterred maintenance at the beginning of FY 2002 on its aircraft, ships, missiles, combat vehicles, and other weapon systems national defense property, plant, and equipment (PP&E) commodities...
Horio, Yuko; Ichiyasu, Hidenori; Kojima, Keisuke; Saita, Naoki; Migiyama, Yohei; Iriki, Toyohisa; Fujii, Kazuhiko; Niki, Toshiro; Hirashima, Mitsuomi; Kohrogi, Hirotsugu
2017-01-01
Purpose Chronic obstructive pulmonary disease (COPD) is characterized by irreversible airflow obstruction and pulmonary emphysema. Persistent inflammation and remodeling of the lungs and airways result in reduced lung function and a lower quality of life. Galectin (Gal)-9 plays a crucial role as an immune modulator in various diseases. However, its role in the pathogenesis of pulmonary emphysema is unknown. This study investigates whether Gal-9 is involved in pulmonary inflammation and changes in emphysema in a porcine pancreatic elastase (PPE)-induced emphysema model. Materials and methods Gal-9 was administered to mice subcutaneously once daily from 1 day before PPE instillation to day 5. During the development of emphysema, lung tissue and bronchoalveolar lavage fluid (BALF) were collected. Histological and cytological findings, concentrations of chemokines and matrix metalloproteinases (MMPs) in the BALF, and the influence of Gal-9 treatment on neutrophils were analyzed. Results Gal-9 suppressed the pathological changes of PPE-induced emphysema. The mean linear intercept (Lm) of Gal-9-treated emphysema mice was significantly lower than that of PBS-treated emphysema mice (66.1 ± 3.3 μm vs. 118.8 ± 14.8 μm, respectively; p emphysema progressed significantly compared with that in wild–type (WT) mice (108.7 ± 6.58 μm vs. 77.19 ± 6.97 μm, respectively; p emphysema by inhibiting the infiltration of neutrophils and decreasing MMPs levels. Exogenous Gal-9 could be a potential therapeutic agent for COPD. PMID:28704475
The pre-vertebrate origins of neurogenic placodes.
Abitua, Philip Barron; Gainous, T Blair; Kaczmarczyk, Angela N; Winchell, Christopher J; Hudson, Clare; Kamata, Kaori; Nakagawa, Masashi; Tsuda, Motoyuki; Kusakabe, Takehiro G; Levine, Michael
2015-08-27
The sudden appearance of the neural crest and neurogenic placodes in early branching vertebrates has puzzled biologists for over a century. These embryonic tissues contribute to the development of the cranium and associated sensory organs, which were crucial for the evolution of the vertebrate "new head". A previous study suggests that rudimentary neural crest cells existed in ancestral chordates. However, the evolutionary origins of neurogenic placodes have remained obscure owing to a paucity of embryonic data from tunicates, the closest living relatives to those early vertebrates. Here we show that the tunicate Ciona intestinalis exhibits a proto-placodal ectoderm (PPE) that requires inhibition of bone morphogenetic protein (BMP) and expresses the key regulatory determinant Six1/2 and its co-factor Eya, a developmental process conserved across vertebrates. The Ciona PPE is shown to produce ciliated neurons that express genes for gonadotropin-releasing hormone (GnRH), a G-protein-coupled receptor for relaxin-3 (RXFP3) and a functional cyclic nucleotide-gated channel (CNGA), which suggests dual chemosensory and neurosecretory activities. These observations provide evidence that Ciona has a neurogenic proto-placode, which forms neurons that appear to be related to those derived from the olfactory placode and hypothalamic neurons of vertebrates. We discuss the possibility that the PPE-derived GnRH neurons of Ciona resemble an ancestral cell type, a progenitor to the complex neuronal circuit that integrates sensory information and neuroendocrine functions in vertebrates.
International Nuclear Information System (INIS)
1997-08-01
On July 2, 1997 at approximately 6:00 A.M., two operators (Workers 1 and 2), wearing approved personal protective equipment (PPE), began a shredding operation of HEPA filters for volume reduction in Building 513 (B-513) at Lawrence Livermore National Laboratory (LLNL). The waste requisitions indicated they were shredding filters containing ≤ 1 μCi of americium-241 (Am-241). A third operator (Worker 3) provided support to the shredder operators in the shredding area (hot area) from a room that was adjacent to the shredding area (cold area). At Approximately 8:00 A.M., a fourth operator (Worker 4) relieved Worker 2 in the shredding operation. Sometime between 8:30 A.M. and 9:00 A.M., Worker 3 left the cold area to make a phone call and set off a hand and foot counter in Building 514. Upon discovering the contamination, the shredding operation was stopped and surveys were conducted in the shredder area. Surveys conducted on the workers found significant levels of contamination on their PPE and the exterior of their respirator cartridges. An exit survey of Worker 1 was conducted at approximately 10:05 A.M., and found contamination on his PPE, as well as on the exterior and interior of his respirator. Contamination was also found on his face, chest, back of neck, hair, knees, and mustache. A nose blow indicated significant contamination, which was later determined to be curium-244
Motion-oriented 3D analysis of body measurements
Loercher, C.; Morlock, S.; Schenk, A.
2017-10-01
The aim of this project is to develop an ergonomically based and motion-oriented size system. New concepts are required in order to be able to deal competently with complex requirements of function-oriented workwear and personal protective equipment (PPE). Body dimensions change through movement, which are basis for motion optimized clothing development. This affects fit and ergonomic comfort. The situation has to be fundamentally researched in order to derive well-founded anthropometric body data, taking into account kinematic requirements of humans and to define functional dimensions for clothing industry. Research focus shall be on ergonomic design of workwear and PPE. There are huge differences in body forms, proportions and muscle manifestations between genders. An improved basic knowledge can be provided as a result, supporting development as well as sales of motion-oriented clothing with perfect fit for garment manufacturers.
Falcão, Jorge Tarcísio Da Rocha; Hazin, Izabel
2012-03-01
Køppe's proposition of four layers in theoretical building are used here in the exploration of a specific case of eclectic combination, the use of Piagetian and Vygotskian general approaches to the analysis of proportional reasoning as a cognitive mathematical ability. It is proposed here that the eclectic consideration of these contributions depends on the consideration of their specificity, in the sense that they highlight different aspects of the phenomenon under scrutiny, and also on the consideration of the coherence between this eclectic convergence and premises in terms of schools of thought under which each contribution is framed. We conclude proposing in accordance to S. Køppe's proposal that eclecticism can be valuable and heuristic in theory development, but this contribution will depend largely on the effort in establishing careful relations between the four layers of theory-building.
Endel Siff : linn sai vastu näppe / Urmas Seaver
Seaver, Urmas, 1973-
2007-01-01
Ilmunud ka: Postimees : na russkom jazõke, 20. dets. 2007, lk. 5. Tallinna halduskohus tühistas suurärimees Endel Siffi firma Primos Kinnisvara ja Tallinna linna vahelises kohtuvaidluses mitu linnavõimu otsust, mis on seotud Kopli liinide ja selle hoonestamiseks tehtud konkursiga. Kaart: Kopli liinid
Development of a honeycomb gas proportional counter array for ...
Indian Academy of Sciences (India)
channels, (e) the technology should be amenable to modular design with a minimum of dead space .... contents) of all the affected cells in a cluster. ... the Department of Science and Technology of the Government of India and the CERN PPE.
78 FR 24207 - Request for Information About Diethanolamine (CAS No. 111-42-2)
2013-04-24
.... engineering controls, work practices, personal protective equipment, exposure data before and after... agent in agricultural chemicals, a corrosion inhibitor and wetting agent in metalworking fluids. The...., engineering controls, work practices, PPE) being taken to minimize worker exposure to diethanolamine. (8...
USA sõdurid tulid Eestisse langevarjuhüppega / fotod: Dmitri Kotjuh
2016-01-01
Sada Ameerika Ühendriikide 173. õhudessantbrigaadi õhudessantväelast sooritasid langevarjuhüppe Järvamaa Nurmsi murulennuväljale. Ameerika Ühendriikide sõjaväelased teevad kaasa õppuses Bayonet Strike, mis viiakse läbi kolmes Balti riigis ja Poolas
Personal protective equipment for registration purposes of pesticides
Gerritsen-Ebben, M.G.; Brouwer, D.H.; Hemmen, J.J. van
2007-01-01
Regulatory authorities in North America, Europe and Australia use different approaches for the estimation of exposure reduction effectiveness of personal protective equipment (PPE) in registration processes of agrochemical pesticides. TNO has investigated current views and facts for the use of
Injection safety practices among resident doctors in a tertiary health ...
African Journals Online (AJOL)
2013-11-20
Nov 20, 2013 ... E‑mail: drbecky4flex@yahoo.com. Introduction. Injection is one of ... materials, inadequate facilities for sterilization as well as an average of 4.9 .... protective equipment (PPE), safety boxes at strategic locations in the hospital ...
Tippsportlased suudavad ka ülikoolis edukad olla / Kadri Inselberg, Eleena Sammler, Kaidi Koort
Inselberg, Kadri
2009-01-01
Kergejõustiklasest ja kolmikhüppajast Kaire Leibakust, maailmameistrist kreeka-rooma maadluses Heiki Nabist, suusatajast ja sprinterist Kein Einastest, Eesti kõrgushüppe rekordiomanikust Anna Iljuštšenkost, Eesti meistrist naiste iluuisutamises Jelena Glebovast ja profitantsijast Martin Parmasest
2013-02-07
... Healthcare Workers'', and ``Advances toward Improved Respirators for Healthcare Workers''. Status: The... research to design and promote the appropriate use of PPE. Compliance with appropriate respirator use.... Poor compliance has been linked to safety culture, workload issues, time constraints, risk perception...
Kolmanda põlvkonna mobiilside saab hoogu / Tõnu Grünberg
Grünberg, Tõnu, 1963-
2003-01-01
EMT arendus- ja tehnoloogiadirektor Tõnu Grünberg kommenteerib 3G mobiilsidevõrgu arengut maailmas ning prognoosib, et aastaks 2005 jõutakse ka Eestis toimiva 3G kommertsvõrguni. 3G toob mobiilse andmeside arengusse olulise hüppe, leiab autor
Chidambaram, Nachiappan; Mazzalai, Andrea; Muralt, Paul
2012-08-01
Interdigitated electrode (IDE) systems with lead zirconate titanate (PZT) thin films play an increasingly important role for two reasons: first, such a configuration generates higher voltages than parallel plate capacitor-type electrode (PPE) structures, and second, the application of an electric field leads to a compressive stress component in addition to the overall stress state, unlike a PPE structure, which results in tensile stress component. Because ceramics tend to crack at relatively moderate tensile stresses, this means that IDEs have a lower risk of cracking than PPEs. For these reasons, IDE systems are ideal for energy harvesting of vibration energy, and for actuators. Systematic investigations of PZT films with IDE systems have not yet been undertaken. In this work, we present results on the evaluation of the in-plane piezoelectric coefficients with IDE systems. Additionally, we also propose a simple and measurable figure of merit (FOM) to analyze and evaluate the relevant piezoelectric parameter for harvesting efficiency without the need to fabricate the energy harvesting device. Idealized effective coefficients e(IDE) and h(IDE) are derived, showing its composite nature with about one-third contribution of the transverse effect, and about two-thirds contribution of the longitudinal effect in the case of a PZT film deposited on a (100)-oriented silicon wafer with the in-plane electric field along one of the Si directions. Randomly oriented 1-μm-thick PZT 53/47 film deposited by a sol-gel technique, was evaluated and yielded an effective coefficient e(IDE) of 15 C·m(-2). Our FOM is the product between effective e and h coefficient representing twice the electrical energy density stored in the piezoelectric film per unit strain deformation (both for IDE and PPE systems). Assuming homogeneous fields between the fingers, and neglecting the contribution from below the electrode fingers, the FOM for IDE structures with larger electrode gap is derived to be
Mendez, Diana; Buttner, Petra; Speare, Rick
2014-11-01
Following the emergence of Hendra virus (HeV), private veterinarians have had to adopt additional infection control strategies to manage this zoonosis. Between 1994 and 2010, seven people became infected with HeV, four fatally. All infected people were at a higher risk of exposure from contact with horses as they were either veterinary personnel, assisting veterinarians, or working in the horse industry. The management of emerging zoonoses is best approached from a One Health perspective as it benefits biosecurity as well as a public health, including the health of those most at risk, in this case private veterinarians. In 2011 we conducted a cross-sectional study of private veterinarians registered in Queensland and providing veterinary services to horses. The aim of this study was to gauge if participants had adopted recommendations for improved infection control, including the use of personal protective equipment (PPE), and the development of HeV specific management strategies during the winter of 2011. A majority of participants worked in practices that had a formal HeV management plan, mostly based on the perusal of official guidelines and an HeV field kit. The use of PPE increased as the health status of an equine patient decreased, demonstrating that many participants evaluated the risk of exposure to HeV appropriately; while others remained at risk of HeV infection by not using the appropriate PPE even when attending a sick horse. This study took place after Biosecurity Queensland had sent a comprehensive package about HeV management to all private veterinarians working in Queensland. However, those who had previous HeV experience through the management of suspected cases or had attended a HeV specific professional education programme in the previous 12 months were more likely to use PPE than those who had not. This may indicate that for private veterinarians in Queensland personal experience and face-to-face professional education sessions may be more
Separation of Armchair SWNTs by Using Polymer Conformation Guided Assembly
2013-08-22
Chan-Park, M. B. Diameter- and Metallicity-Selective Enrichment of Single-Walled Carbon Nanotubes Using Polymethacrylates with Pendant Aromatic...Emitting PPE-PPV Hybrid Polymers: Efficient Energy Transfer across the m-Phenylene Bridge . Macromolecules 2003, 36, 3848-3853. 34. Yao, J.; Chen, Y
Jagt, K. van der; Tielemans, E.; Links, I.; Brouwer, D.; Hemmen, J. van
2004-01-01
This study assessed the effectiveness of a custom fit personal protective equipment (PPE) program aimed at reducing occupational exposure to pesticides. The intervention study was carried out on 15 pest control operators (PCOs) during mixing/loading and application of chlorpyrifos. Each worker was
ESX-5-deficient Mycobacterium marinum is hypervirulent in adult zebrafish
Weerdenburg, Eveline M.; Abdallah, Abdallah; Mitra, Suman; De Punder, Karin; Van Der Wel, Nicole N.; Bird, Steve; Appelmelk, Ben J.; Bitter, Wilbert M.; Van Der Sar, Astrid M.
2012-01-01
ESX-5 is a mycobacterial type VII protein secretion system responsible for transport of numerous PE and PPE proteins. It is involved in the induction of host cell death and modulation of the cytokine response in vitro. In this work, we studied
Puerperas' knowledge regarding postpartum exercises in a tertiary ...
African Journals Online (AJOL)
and 25 years old, had no knowledge, while only 7 (14%) had knowledge with regard to PPE. Only 1 ... Eleven (22%) puerperas who delivered by caesarean section (C/S) had .... New York: Mosby Elsevier Inc., 2010. 13. Wagner DL, Bear M, ...
Pronk, A.; Yu, F.; Vlaanderen, J.; Tielemans, E.; Preller, L.; Bobeldijk, I.; Deddens, J.A.; Latza, U.; Baur, X.; Heederik, D.
2006-01-01
Objectives: To study inhalation and dermal exposure to hexamethylene diisocyanate (HDI) and its oligomers as well as personal protection equipment (PPE) use during task performance in conjunction with urinary hexamethylene diamine (HDA) in car body repair shop workers and industrial spray painters.
The development of a ballistic method for simulating fragments from buried explosive devices
Jagt-Deutekom, M.J. van der
2016-01-01
No standard scientific methodology currently exists to assess the performance of personal protection equipment (PPE) against secondary debris, such as soil, grit and stones, ejected when a buried improvised explosive device (IED) detonates. Different test methods are used for this evaluation. The
Li, Shengliang; Chen, Tao; Wang, Yunxia; Liu, Libing; Lv, Fengting; Li, Zhiliang; Huang, Yanyi; Schanze, Kirk S; Wang, Shu
2017-10-16
Development of Raman-active materials with enhanced and distinctive Raman vibrations in the Raman-silent region (1800-2800 cm -1 ) is highly required for specific molecular imaging of living cells with high spatial resolution. Herein, water-soluble cationic conjugated polymers (CCPs), poly(phenylene ethynylene) (PPE) derivatives, are explored for use as alkyne-state-dependent Raman probes for living cell imaging due to synergetic enhancement effect of alkyne vibrations in Raman-silent region compared to alkyne-containing small molecules. The enhanced alkyne signals result from the integration of alkyne groups into the rigid backbone and the delocalized π-conjugated structure. PPE-based conjugated polymer nanoparticles (CPNs) were also prepared as Raman-responsive nanomaterials for distinct imaging application. This work opens a new way into the development of conjugated polymer materials for enhanced Raman imaging. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Flocard, Hubert; Le Gorgeu, Jean-Pierre
2018-01-01
Even if the Sein Island emits less CO 2 emissions than 700 vehicles, the Government set an objective of 50 per cent for renewable energy production within its multi-year energy planning (PPE). The objectives of the authors is herein to analyse the credibility of these PPE objectives, more particularly as far as electric power autonomy is concerned. They used available and precise data related to the island's energy consumption. They show that this 50 per cent coverage can indeed be reached, but with investments which are not justified when the population size and current resulting pollution are considered. They also outline that diesel engines will still be used from time to time, and that their emissions will not even be reduced as diesel units will not operate in optimal regime. Therefore, they regret that such objectives have been imposed to the island without any detailed preliminary study
Searching for Concurrent Design Patterns in Video Games
Best, Micah J.; Fedorova, Alexandra; Dickie, Ryan; Tagliasacchi, Andrea; Couture-Beil, Alex; Mustard, Craig; Mottishaw, Shane; Brown, Aron; Huang, Zhi Feng; Xu, Xiaoyuan; Ghazali, Nasser; Brownsword, Andrew
The transition to multicore architectures has dramatically underscored the necessity for parallelism in software. In particular, while new gaming consoles are by and large multicore, most existing video game engines are essentially sequential and thus cannot easily take advantage of this hardware. In this paper we describe techniques derived from our experience parallelizing an open-source video game Cube 2. We analyze the structure and unique requirements of this complex application domain, drawing conclusions about parallelization tools and techniques applicable therein. Our experience and analysis convinced us that while existing tools and techniques can be used to solve parts of this problem, none of them constitutes a comprehensive solution. As a result we were inspired to design a new parallel programming environment (PPE) targeted specifically at video game engines and other complex soft real-time systems. The initial implementation of this PPE, Cascade, and its performance analysis are also presented.
Duke, Emily; Plexico, Laura W; Sandage, Mary J; Hoch, Matthew
2015-11-01
This study investigated the effect of traditional vocal warm-up versus semioccluded vocal tract exercises on the acoustic parameters of voice through three questions: does vocal warm-up condition significantly alter the singing power ratio of the singing voice? Is singing power ratio dependent upon vowel? Is perceived phonatory effort affected by warm-up condition? Hypotheses were that vocal warm-up would alter the singing power ratio, and that semioccluded vocal tract warm-up would affect the singing power ratio more than no warm-up or traditional warm-up, that singing power ratio would vary across vowel, and that perceived phonatory effort would vary with warm-up condition. This study was a within-participant repeated measures design with counterbalanced conditions. Thirteen male singers were recorded under three different conditions: no warm-up, traditional warm-up, and semioccluded vocal tract exercise warm-up. Recordings were made of these singers performing the Star Spangled Banner, and singing power ratio (SPR) was calculated from four vowels. Singers rated their perceived phonatory effort (PPE) singing the Star Spangled Banner after each warm-up condition. Warm-up condition did not significantly affect SPR. SPR was significantly different for /i/ and /e/. PPE was not significantly different between warm-up conditions. The present study did not find significant differences in SPR between warm-up conditions. SPR differences for /i/, support previous findings. PPE did not differ significantly across warm-up condition despite the expectation that traditional or semioccluded warm-up would cause a decrease. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
The 'old and the new' of decommissioning Dounreay
International Nuclear Information System (INIS)
Thompson, Peter; Chalmers, Tony; Somerville, Susan; Varallo, Giovanna; Watkin, Tim; White, Simon
2008-01-01
The Dounreay site is situated on the north coast of Scotland, mainland United Kingdom, and since the 1950s it has been instrumental in fast breeder research and fuel reprocessing plant development. The work programme on the site has changed, and is now one of safe decommissioning and site restoration. Previous papers have discussed and reviewed progress during the very early stages of the decommissioning programme and this paper provides an update on the work programme from a primarily radiation protection perspective. This paper discusses progress in decommissioning the Dounreay site and the adoption of 'tried and tested', as well as innovative techniques to achieve this decommissioning safely. This includes detailed discussion of the radiation protection aspects of decommissioning, and the consideration and implementation of various radiological protection controls within varying decommissioning environments, such as: a) Remote operations; b) Robotics; c) Shielding; d) Remote readout dosimetry (during personnel entry into elevated dose rate areas). The change from an operational to a decommissioning work programme at Dounreay, created a requirement to modify the type and variety of radiological personal protective equipment (PPE) available. The selection of appropriate PPE, utilised following exhaustion of the hierarchy of controls, to remove the residual radiological risk to personnel is discussed within the paper. The benefit of developing this PPE, as well as other controls, in collaboration with the operatives performing the work, is clearly obvious. The paper concludes with a review of the relative merits and success of the decommissioning techniques that have been adopted, from a radiological protection perspective, together with a summary of lessons learnt. (author)
Parker, Lindsay M; Le, Sheng; Wearne, Travis A; Hardwick, Kate; Kumar, Natasha N; Robinson, Katherine J; McMullan, Simon; Goodchild, Ann K
2017-06-15
Previous studies have demonstrated that a range of stimuli activate neurons, including catecholaminergic neurons, in the ventrolateral medulla. Not all catecholaminergic neurons are activated and other neurochemical content is largely unknown hence whether stimulus specific populations exist is unclear. Here we determine the neurochemistry (using in situ hybridization) of catecholaminergic and noncatecholaminergic neurons which express c-Fos immunoreactivity throughout the rostrocaudal extent of the ventrolateral medulla, in Sprague Dawley rats treated with hydralazine or saline. Distinct neuronal populations containing PPCART, PPPACAP, and PPNPY mRNAs, which were largely catecholaminergic, were activated by hydralazine but not saline. Both catecholaminergic and noncatecholaminergic neurons containing preprotachykinin and prepro-enkephalin (PPE) mRNAs were also activated, with the noncatecholaminergic population located in the rostral C1 region. Few GlyT2 neurons were activated. A subset of these data was then used to compare the neuronal populations activated by 2-deoxyglucose evoked glucoprivation (Brain Structure and Function (2015) 220:117). Hydralazine activated more neurons than 2-deoxyglucose but similar numbers of catecholaminergic neurons. Commonly activated populations expressing PPNPY and PPE mRNAs were defined. These likely include PPNPY expressing catecholaminergic neurons projecting to vasopressinergic and corticotrophin releasing factor neurons in the paraventricular nucleus, which when activated result in elevated plasma vasopressin and corticosterone. Stimulus specific neurons included noncatecholaminergic neurons and a few PPE positive catecholaminergic neuron but neurochemical codes were largely unidentified. Reasons for the lack of identification of stimulus specific neurons, readily detectable using electrophysiology in anaesthetized preparations and for which neural circuits can be defined, are discussed. © 2017 Wiley Periodicals, Inc.
77 FR 75169 - Silver Nanoparticles (AgNPs); Information and Comment Request
2012-12-19
... control measures (e.g., engineering controls, work practices, PPE) that are being used in workplaces where... (513) 533-8363. Background Nanotechnology is generally defined as the intentional manipulation of...). Nanotechnology involves a wide range of chemistries and almost unlimited types of structures that have highly...
Gcebe, Nomakorinte; Michel, Anita; Gey van Pittius, Nicolaas C; Rutten, Victor
2016-01-01
The Esx and PE/PPE families of proteins are among the most immunodominant mycobacterial antigens and have thus been the focus of research to develop vaccines and immunological tests for diagnosis of bovine and human tuberculosis, mainly caused by Mycobacterium bovis and Mycobacterium tuberculosis,
29 CFR 1915.154 - Respiratory protection.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Respiratory protection. 1915.154 Section 1915.154 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... (PPE) § 1915.154 Respiratory protection. Respiratory protection for shipyard employment is covered by...
2013-10-02
... Assessment programs, and (3) solicit input to define a national framework for PPE conformity assessment... Institute of Medicine (IOM) and the National Research Council based on a review of NPPTL's program activities. The IOM report identified gaps and inconsistencies in the certification and other conformity...
Directory of Open Access Journals (Sweden)
Geert Castryck
2015-01-01
Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages
Pallister-Wilkins, P.
2016-01-01
This article focuses on the use of Personal Protective Equipment in humanitarianism. It takes the recent Ebola outbreak as a case through which to explore the role of objects in saving individual lives and protecting populations. The argument underlines the importance of PPE in mediating between
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Amino acid sequence analysis corresponding to the PPE proteins in H37Rv and CDC1551 strains of the Mycobacterium tuberculosis genomes resulted in the identification of a previously uncharacterized 225 amino acidresidue common region in 22 proteins. The pairwise sequence identities were as low as 18%.
Accurate photopyroelectric measurements of thermal diffusivity of (semi)liquids
Dadarlat, D.; Neamtu, C.; Surducan, E.; Sahraoui, A.H.; Longuemart, S.; Bicanic, D.
2002-01-01
The back photopyroelectric (PPE) configuration, with opaque sample and thermally thick sample and sensor, was applied in order to obtain room temperature values of the thermal diffusivity of some (semi)liquid materials. The methodology is based on a sample's thickness scan, and not on a frequency
Afghanistan: Håbet lever – og elektrikerne er tilkaldt
DEFF Research Database (Denmark)
Vestenskov, David
2013-01-01
Håbet for den civile afghaner kan til tider virke som et skamskudt fyrtårn, og det bliver næppe genopbygget af kritiske observationer og selvretfærdig debat. Operationens fokus forud for de udenlandske troppers exit er at udvikle sikkerhedsinstitutionerne og skabe arbejdspladser...
Pesticide-related safety risks among vegetable farmers: A Cross ...
African Journals Online (AJOL)
The most common was organophosphate (45.2%). Twelve of the identified pesticide brands were insecticides while the remaining two were fungicides. Twenty-three practiced cocktailing of pesticides (60.5%), mostly to save time. The most common PPE used while spraying pesticides were gas masks, gloves and boots.
Counter-Chemical, Biological, Radiological, and Nuclear Operations
2007-01-26
operating under the auspices of the PSI intercepted a marine vessel in the Mediterranean Sea on its way from Malaysia to Libya. The ship was...environments where OSHA or applicable AFOSH standards apply, including emergency response to CBRNE incidents in the United States. Also called PPE
Eesti õpetaja pälvis Inspiration Software'i stipendiumi / Ave Lauringson
Lauringson, Ave
2007-01-01
USA tarkvarafirma Inspiration Software tegi teatavaks 30 õpetaja nimed üle maailma, kes saavad 2007. aasta haridusstipendiumi (Inspired Teacher Scholarships for Visual Learning). Nende seas on ka Lasnamäe Lasteaia-Algkooli õpetaja, Tiigrihüppe SA ekspert ja koolitaja ning Tiigri Tegija 2007 auhinnasaaja Ingrid Maadvere
HIV surveillance in needlestick accidents with health workers
Directory of Open Access Journals (Sweden)
Janete Lane Amadei
2010-12-01
Full Text Available Objective: To characterize the occurrence of needlestick accidents with health professionals submitted to rapid HIV tests. Methods: A descriptive, epidemiological study, carried out by notification of the occurrence of needlestick accidents in the Epidemiology Sector of the State Health Secretariat, in 2008. The following variables were assessed: gender, age, exposed biological material, type of exposure, source patient, and injured patient, progression of the case, accident situation, and use of personal protective equipment (PPE, 180 days serology and occupational area. Results: There have been reports of 143 accidents, prevailing in nursing, female, 20 to 30 years, involving the blood and biological material by percutaneous puncture. We found no standardization in the use of PPE. The HIV test revealed no positive cases. Conclusion: This study helped to characterize the occurrence of accidents reported in health care professionals and evaluate the protocol of care given. It also revealed non-contamination by HIV.
HIV surveillance in needlestick accidents with health workers - doi: 10.5020/18061230.2010.p325
Directory of Open Access Journals (Sweden)
Janete Lane Amadei
2012-01-01
Full Text Available Objective: To characterize the occurrence of needlestick accidents with health professionals submitted to rapid HIV tests. Methods: A descriptive, epidemiological study, carried out by notification of the occurrence of needlestick accidents in the Epidemiology Sector of the State Health Secretariat, in 2008. The following variables were assessed: gender, age, exposed biological material, type of exposure, source patient, and injured patient, progression of the case, accident situation, and use of personal protective equipment (PPE, 180 days serology and occupational area. Results: There have been reports of 143 accidents, prevailing in nursing, female, 20 to 30 years, involving the blood and biological material by percutaneous puncture. We found no standardization in the use of PPE. The HIV test revealed no positive cases. Conclusion: This study helped to characterize the occurrence of accidents reported in health care professionals and evaluate the protocol of care given. It also revealed non-contamination by HIV.
Basura, G J; Walker, P D
1999-01-11
The acute effects of the monoamine releaser p-chloroamphetamine (pCA, 10 mg/kg, i.p.) on preprotachykinin (PPT) and preproenkephalin (PPE) mRNA expression in the anterior (A-STR) vs. posterior (P-STR) striatum were studied in rodents at postnatal days (PND) 10, 21 and 35. Northern analysis 4 h post-injection yielded no significant mRNA changes within the A-STR of any pCA group. However, significant increases (80-200% of saline control) in PPT mRNA levels occurred within the P-STR at all three postnatal ages. Interestingly, pCA did not increase PPE mRNA levels within the P-STR until PND 35 (150% of saline control). Such observation suggests that tachykinin neurons of the P-STR achieve an earlier monoamine-responsive signal transduction linkage to gene regulation as compared to enkephalin neurons. Given its predominance in the caudal regions of the striatum, 5-HT neurotransmission at the 5-HT2 receptor is suggested to play a central role in this mechanism.
Directory of Open Access Journals (Sweden)
Dian Perwitasari
2012-11-01
Full Text Available Level of Risk Used Material Safety and Hygiene Laboratory Employee In Clinical Laboratory Ciptomangunkusumo Hospital, Jakarta.The study on the description of personal protective equipment (PPE and personal hygiene for laboratorian were undertaken, in relation to high risk factor being infected with diseases including HIV/AIDS, in cl inical laboratory Ciptomangunkusumo Hospital, Jakarta, in 2001. The number of samplesis 48 personnel who work in laboratories (24 hour, emergency installation, hematology, and child laboratory, and the study design is cross-sectional. The risk level is being scored in several criteria. There are 56.8% laboratorian who did not use PPE. Based on risks, the high risk group is those who work inchild laboratory (100% and hematological laboratory (75%. Based on personal hygiene habit after handling specimen, such as handwashing, 45.4% personnel had bad personal hygiene, thus the high riskgroup in child laboratory and hematological laboratory are both 75%.Keywords: clinical laboratory, level of risk, personal hygiene
Occupational noise exposure and hearing defects among sawmill workers in the south of Thailand.
Thepaksorn, Phayong; Koizumi, Akio; Harada, Kouji; Siriwong, Wattasit; Neitzel, Richard L
2018-01-19
The aim of this study was to investigate occupational noise exposure and hearing defects among sawmill workers in the south of Thailand. Seven hundred sawmill workers participated, of which 335 (47.9%) were male. The mean age of the sawmill workers was 33.5 years (SD 10.2), and more than 60% were workers had less than 5 years of work experience. Only about one in four workers (25%) had been trained in use of personal protective equipment (PPE), and half of the participants never or rarely wore PPE while working. The prevalence rate of noise-induced hearing loss (NIHL) was 22.8% (N = 42). Male workers had significantly higher risk than female workers (odds ratio [OR] = 2.21). Workers aged older than 25 years had significantly higher risks for NIHL (OR = 3.51-12.42) than workers younger than 25 years. Sawing workers had higher risk for NIHL than office workers (OR = 3.07).
Analysis of Maize Seed Germs by Photoacoustic Microscopy and Photopyroelectric Technique
Pacheco, A. Domínguez; Aguilar, C. Hernández; Cruz-Orea, A.
2013-05-01
A knowledge about thermal parameters of structural components of maize seed is of great relevance in the seed technology practice. The objective of the present study was to determine the thermal effusivity of germs of maize ( Zea mays L.) of different genotypes by means of the photopyroelectric technique (PPE) in the inverse configuration and obtaining the thermal imaging of these samples by photoacoustic microscopy (PAM). Germs from crystalline maize (white pigment), semi-crystalline maize (yellow pigment), and floury maize (blue pigment) were used in this investigation. The results show differences between germs of maize seeds mainly in the values of their thermal effusivities. The thermal images showed minimum inhomogeneity of these seed germs. Characterizations of thermal parameters in seeds are important in agriculture and food production and could be particularly useful to define their quality and determine their utility. PPE and PAM can be considered as potential diagnostic tools for the characterization of agriculture seeds.
Continuing medical education in radiation oncology
International Nuclear Information System (INIS)
Chauvet, B.; Barillot, I.; Denis, F.; Cailleux, P.E.; Ardiet, J.M.; Mornex, F.
2012-01-01
In France, continuing medical education (CME) and professional practice evaluation (PPE) became mandatory by law in July 2009 for all health professionals. Recently published decrees led to the creation of national specialty councils to implement this organizational device. For radiation oncology, this council includes the French Society for Radiation Oncology (SFRO), the National Radiation Oncology Syndicate (SNRO) and the Association for Continuing Medical Education in Radiation Oncology (AFCOR). The Radiation Oncology National Council will propose a set of programs including CME and PPE, professional thesaurus, labels for CME actions consistent with national requirements, and will organize expertise for public instances. AFCOR remains the primary for CME, but each practitioner can freely choose an organisation for CME, provided that it is certified by the independent scientific commission. The National Order for physicians is the control authority. Radiation oncology has already a strong tradition of independent CME that will continue through this major reform. (authors)
Accounting Issues: An Essay Series Part IV--Property, Plant, & Equipment
Laux, Judy
2007-01-01
This fourth article in a series of theoretical essays intended to supplement the introductory financial accounting course is dedicated to the topic of property, plant, and equipment (PP&E), including both the accounting treatment and its related conceptual connections. The paper also addresses the measurement dilemmas, scandalous accounting…
Deformation and toughness of polymeric systems: 4 Influence of strain rate and temperature
Sanden, van der M.C.M.; Meijer, H.E.H.
1994-01-01
The influence of testing speed and temperature on the brittle-to-tough transition of non-adhering core-shell rubber-modified polystyrene-poly(2,6-dimethyl-1,4-phenylene ether) (PS-PPE) blends was studied. The validity of the concept of a network density dependent, critical matrix ligament thickness
A Mokken scale analysis of the peer physical examination questionnaire.
Vaughan, Brett; Grace, Sandra
2018-01-01
Peer physical examination (PPE) is a teaching and learning strategy utilised in most health profession education programs. Perceptions of participating in PPE have been described in the literature, focusing on areas of the body students are willing, or unwilling, to examine. A small number of questionnaires exist to evaluate these perceptions, however none have described the measurement properties that may allow them to be used longitudinally. The present study undertook a Mokken scale analysis of the Peer Physical Examination Questionnaire (PPEQ) to evaluate its dimensionality and structure when used with Australian osteopathy students. Students enrolled in Year 1 of the osteopathy programs at Victoria University (Melbourne, Australia) and Southern Cross University (Lismore, Australia) were invited to complete the PPEQ prior to their first practical skills examination class. R, an open-source statistics program, was used to generate the descriptive statistics and perform a Mokken scale analysis. Mokken scale analysis is a non-parametric item response theory approach that is used to cluster items measuring a latent construct. Initial analysis suggested the PPEQ did not form a single scale. Further analysis identified three subscales: 'comfort', 'concern', and 'professionalism and education'. The properties of each subscale suggested they were unidimensional with variable internal structures. The 'comfort' subscale was the strongest of the three identified. All subscales demonstrated acceptable reliability estimation statistics (McDonald's omega > 0.75) supporting the calculation of a sum score for each subscale. The subscales identified are consistent with the literature. The 'comfort' subscale may be useful to longitudinally evaluate student perceptions of PPE. Further research is required to evaluate changes with PPE and the utility of the questionnaire with other health profession education programs.
A multi-faceted approach of a nursing led education in response to MERS-CoV infection
Directory of Open Access Journals (Sweden)
Jaffar A. Al-Tawfiq
2018-03-01
Full Text Available Background: The emergence of the Middle East respiratory syndrome-coronavirus (MERS-CoV resulted in multiple healthcare associated outbreaks. In response, we developed a nurse-led program to screen and triage patients with MERS-CoV infection. Methods: A formal educational program was implemented to ensure a standardized approach to care planning and delivery. The essential skills that were included were the use of Personal Protective Equipment (PPE including gown, gloves, head cover and N95 mask, hand hygiene, the practice of donning and doffing and the collection of MERS-CoV nasopharyngeal specimens. Results: A core group of nurses were identified from high-risk units. The education program consisted of four skill-days. Nurses were assigned a pre-course work from Mosby’s Nursing Skills, an online skill module, donning and doffing of PPE, and the process for obtaining a nasopharyngeal swab. The skill lab incorporated multiple methods such group discussion, watching an on-line video, and a simulated demonstration and practice on a mannequin. In total, 450 nurses attended the Nasopharyngeal Skills Day and 1000 nurses received training. Donning and doffing PPE and N95 mask fit testing has become an annual mandatory competency requirement for staff in nursing and clinical services. Conclusion: The application of specified protocols minimizes the risks of cross infection, placing emphasis on patient and staff safety as well as expediting the patient to definitive treatment. Nurse educators have an instrumental role in training nurses and other healthcare providers on the specifics needed to identify, contain and manage patient presenting with MERS-CoV. Keywords: Coronavirus, Education, MERS-CoV, Middle East respiratory syndrome, Saudi Arabia, Outbreak preparedness, Hospital care
Kim, C-J; Choi, W S; Jung, Y; Kiem, S; Seol, H Y; Woo, H J; Choi, Y H; Son, J S; Kim, K-H; Kim, Y-S; Kim, E S; Park, S H; Yoon, J H; Choi, S-M; Lee, H; Oh, W S; Choi, S-Y; Kim, N-J; Choi, J-P; Park, S Y; Kim, J; Jeong, S J; Lee, K S; Jang, H C; Rhee, J Y; Kim, B-N; Bang, J H; Lee, J H; Park, S; Kim, H Y; Choi, J K; Wi, Y-M; Choi, H J
2016-10-01
Given the mode of transmission of Middle East respiratory syndrome (MERS), healthcare workers (HCWs) in contact with MERS patients are expected to be at risk of MERS infections. We evaluated the prevalence of MERS coronavirus (CoV) immunoglobulin (Ig) G in HCWs exposed to MERS patients and calculated the incidence of MERS-affected cases in HCWs. We enrolled HCWs from hospitals where confirmed MERS patients had visited. Serum was collected 4 to 6 weeks after the last contact with a confirmed MERS patient. We performed an enzyme-linked immunosorbent assay (ELISA) to screen for the presence of MERS-CoV IgG and an indirect immunofluorescence test (IIFT) to confirm MERS-CoV IgG. We used a questionnaire to collect information regarding the exposure. We calculated the incidence of MERS-affected cases by dividing the sum of PCR-confirmed and serology-confirmed cases by the number of exposed HCWs in participating hospitals. In total, 1169 HCWs in 31 hospitals had contact with 114 MERS patients, and among the HCWs, 15 were PCR-confirmed MERS cases in study hospitals. Serologic analysis was performed for 737 participants. ELISA was positive in five participants and borderline for seven. IIFT was positive for two (0.3%) of these 12 participants. Among the participants who did not use appropriate personal protective equipment (PPE), seropositivity was 0.7% (2/294) compared to 0% (0/443) in cases with appropriate PPE use. The incidence of MERS infection in HCWs was 1.5% (17/1169). The seroprevalence of MERS-CoV IgG among HCWs was higher among participants who did not use appropriate PPE. Copyright © 2016. Published by Elsevier Ltd.
Lee, Lindsay; Mann, Graham; Carslaw, Ken; Toohey, Matthew; Aquila, Valentina
2016-04-01
The World Climate Research Program's SPARC initiative has a new international activity "Stratospheric Sulphur and its Role in Climate" (SSiRC) to better understand changes in stratospheric aerosol and precursor gaseous sulphur species. One component of SSiRC involves an intercomparison "ISA-MIP" of composition-climate models that simulate the stratospheric aerosol layer interactively. Within PoEMS each modelling group will run a "perturbed physics ensemble" (PPE) of interactive stratospheric aerosol (ISA) simulations of the Pinatubo eruption, varying several uncertain parameters associated with the eruption's SO2 emissions and model processes. A powerful new technique to quantify and attribute sources of uncertainty in complex global models is described by Lee et al. (2011, ACP). The analysis uses Gaussian emulation to derive a probability density function (pdf) of predicted quantities, essentially interpolating the PPE results in multi-dimensional parameter space. Once trained on the ensemble, a Monte Carlo simulation with the fast Gaussian emulator enabling a full variance-based sensitivity analysis. The approach has already been used effectively by Carslaw et al., (2013, Nature) to quantify the uncertainty in the cloud albedo effect forcing from a 3D global aerosol-microphysics model allowing to compare the sensitivy of different predicted quantities to uncertainties in natural and anthropogenic emissions types, and structural parameters in the models. Within ISA-MIP, each group will carry out a PPE of runs, with the subsequent analysis with the emulator assessing the uncertainty in the volcanic forcings predicted by each model. In this poster presentation we will give an outline of the "PoEMS" analysis, describing the uncertain parameters to be varied and the relevance to further understanding differences identified in previous international stratospheric aerosol assessments.
Berthet, Aurélie; Hopf, Nancy B; Miles, Alexandra; Spring, Philipp; Charrière, Nicole; Garrigou, Alain; Baldi, Isabelle; Vernez, David
2014-01-01
Skin exposures to chemicals may lead, through percutaneous permeation, to a significant increase in systemic circulation. Skin is the primary route of entry during some occupational activities, especially in agriculture. To reduce skin exposures, the use of personal protective equipment (PPE) is recommended. PPE efficiency is characterized as the time until products permeate through material (lag time, Tlag). Both skin and PPE permeations are assessed using similar in vitro methods; the diffusion cell system. Flow-through diffusion cells were used in this study to assess the permeation of two herbicides, bentazon and isoproturon, as well as four related commercial formulations (Basagran(®), Basamais(®), Arelon(®) and Matara(®)). Permeation was measured through fresh excised human skin, protective clothing suits (suits) (Microchem(®) 3000, AgriSafe Pro(®), Proshield(®) and Microgard(®) 2000 Plus Green), and a combination of skin and suits. Both herbicides, tested by itself or as an active ingredient in formulations, permeated readily through human skin and tested suits (Tlag < 2 h). High permeation coefficients were obtained regardless of formulations or tested membranes, except for Microchem(®) 3000. Short Tlag, were observed even when skin was covered with suits, except for Microchem(®) 3000. Kp values tended to decrease when suits covered the skin (except when Arelon(®) was applied to skin covered with AgriSafe Pro and Microgard(®) 2000), suggesting that Tlag alone is insufficient in characterizing suits. To better estimate human skin permeations, in vitro experiments should not only use human skin but also consider the intended use of the suit, i.e., the active ingredient concentrations and type of formulations, which significantly affect skin permeation.
5-fluorouracil Toxicity Mechanism Determination in Human Keratinocytes: in vitro Study on HaCaT
Directory of Open Access Journals (Sweden)
Jan Hartinger
2018-01-01
Full Text Available 5-fluorouracil (5-FU and capecitabine therapy is often accompanied by palmar-plantar erythrodysesthesia (PPE which is manifestation of 5-FU toxicity in keratinocytes. The main mechanisms of 5-FU action are thymidylate synthase (TS inhibition which can be abrogated by thymidine and strengthened by calciumfolinate (CF and incorporation of fluorouridinetriphosphate into RNA which can be abrogated by uridine. For proper PPE treatment 5-FU mechanism of action in keratinocytes needs to be elucidated. We used the 5-FU toxicity modulators uridine, thymidine and CF to discover the mechanism of 5-FU action in human keratinocyte cell line HaCaT. To measure the cellular viability, we used MTT test and RTCA test. CF did not augment 5-FU toxicity and 5-FU toxicity was weakened by uridine. Therefore, the primary mechanism of 5-FU toxicity in keratinocytes is 5-FU incorporation into RNA. The uridine protective effect cannot fully develop in the presence of CF. Thymidine addition to 5-FU and uridine treated cells not only prevents the toxicity-augmenting CF effect but it also prolongs the 5-FU treated cells survival in comparison to uridine only. Therefore, it can be assumed that in the presence of uridine the 5-FU toxicity mechanism is switched from RNA incorporation to TS inhibition. Although particular 5-FU toxicity mechanisms were previously described in various cell types, this is the first time when various combinations of pyrimidine nucleosides and CF were used for 5-FU toxicity mechanism elucidation in human keratinocytes. We suggest that for PPE treatment ointment containing uridine and thymidine should be further clinically tested.
Ayoola, Modupe Comfort; Akinseye, Victor Oluwatoyin; Cadmus, Eniola; Awosanya, Emmanuel; Popoola, Olufemi Akinyele; Akinyemi, Oluwaseun Oladapo; Perrett, Lorraine; Taylor, Andrew; Stack, Judy; Moriyon, Ignacio; Cadmus, Simeon Idowu
2017-01-01
Brucellosis is a neglected zoonosis of public health importance. This study was conducted to determine the prevalence and risk factors of brucellosis among slaughtered cattle as well as challenges to the protection of abattoir workers in Nigeria. A slaughterhouse study was conducted in a major abattoir in Ibadan from March to August, 2013. To diagnose brucellosis, serum samples from 1,241 slaughtered cattle were tested using Rose-Bengal test (RBT) and competitive enzyme-linked immunosorbent assay (cELISA); again, 57 milk samples were tested with milk ring test (MRT) and indirect ELISA (iELISA). Furthermore, a survey on the usage of personal protective equipment (PPE) and challenges to its use by abattoir workers was done. Data were analysed using Stata 12. Seroprevalence by RBT was 7.8%; 77.3% (75/97) of these were corroborated by cELISA. Prevalence in milk samples by MRT and indirect ELISA were 33.3% and 3.5%, respectively. Sex (OR: 2.5; 95%CI:1.3-4.5) was the factor significantly associated with Brucella seropositivity. None of the abattoir workers used standard protective overalls; while, 99.6% of the meat handlers and 84.1% of the butchers worked barefoot. Most of the workers (75.7%) wore no protective gloves. The respondents agreed that provision of free PPE and sanctions against non-users would encourage its use. Our findings indicate moderate prevalence (7.8%) of bovine brucellosis with sex of cattle being a risk factor. A notable barrier to better protection of abattoir workers against brucellosis is perceived inconvenience arising from use of gloves. Therefore, preventive and control measures against brucellosis must include education and use of PPE among abattoir workers.
Directory of Open Access Journals (Sweden)
Marc Grohmann
2003-01-01
Full Text Available Rezensiertes Werk:Peter Hanser, Trutz von Trotha, Ordnungsformen der Gewalt. Reflexionen über die Grenzen von Recht und Staat an einem einsamen Ort in Papua-Neuguinea (Siegener Beiträge zur Soziologie 3, Köln: Rüdiger Köppe 2002, 448 S., ISBN 3-89645-330-0
Paris polyphylla extract inhibits proliferation and promotes apoptosis ...
African Journals Online (AJOL)
Methods: Morphological changes were examined by microscopy in A549 cells after exposure to PPE. ... decreased correspondingly, indicating that the cells were in G0/G1-phase arrest. ... Materials. Human lung cancer cell line (A549) was obtained from Chinese .... observed at high magnification (x 400) in 5 fields,.
29 CFR 1910.132 - General requirements.
2010-07-01
..., used, and maintained in a sanitary and reliable condition wherever it is necessary by reason of hazards... be of safe design and construction for the work to be performed. (d) Hazard assessment and equipment...; and, (v) The proper care, maintenance, useful life and disposal of the PPE. (2) Each affected employee...
Textiles for protection at the workplace : Developments in textiles for a safer working environment
Bottenberg, E. (Eliza); Brinks, G.J. (Ger); Luiken, A. (Anton)
2011-01-01
This report was produced within the framework of the RAAK PRP project ‘Veiligheid op de werkvloer’. Personal protective equipment (PPE) is used on a daily basis by millions of people all over the EU, voluntarily or as a result of EU legislation. In this report we deal specifically with
Lidelse og omsorg i organisationens skygge
DEFF Research Database (Denmark)
Poder, Poul
2013-01-01
Hvordan lidelse sættes i skyggen under organisationsforandring Teologer, filosoffer, læger og terapeuter taler om lidelse, men ikke organisationsforskere. Er det fordi lidelse forstået som det at blive overmandet af noget, der gør en passiv - ikke en del af arbejdslivet? Næppe. Artiklen undersøge...
Gomez-Monedero, B.; Faria, J.; Bimbela, F.; Ruiz, M.P.
2017-01-01
The catalytic hydroprocessing of phenethyl phenyl ether (PPE), a model compound of one of the most significant ether linkages within lignin structure, β-O-4, has been studied. Reactions were carried out using two ruthenium-based catalysts, supported on different materials: 3.8 wt.% Ru/C and 3.9 wt.%
Pesticide knowledge, practice and attitude and how it affects the ...
African Journals Online (AJOL)
2014-06-02
Jun 2, 2014 ... has tried to control the use of pesticides with its code ... This is a useful tool, especially for developing countries, for elimination of. Pesticide knowledge, practice and attitude and how it affects the health of ... toxicity, and the majority did not use appropriate PPE nor good hygiene when handling pesticides.
Perception of environmental health risks among workers in a food ...
African Journals Online (AJOL)
Background: Workplace safety relies partially on workers' ability to recognize hazards that could result in personal injury. This study aimed to determine the perception of industrial workers to the environmental risks that they are exposed to and their practice of self protection through the use of PPE. Methods: It was a ...
Poolakate kiirmoe kaubamärk püüab rohkem keskmist inimest / Liis Kängsepp
Kängsepp, Liis, 1981-
2004-01-01
20-25 aastastele noortele suunatud kiirmoe kontseptsiooni esindavate kaubamärkide Monton ja Reserved konkurentsist Tallinna kaubanduskeskustes. Vt. samas: Reserved murdis kiiresti kasumisse; Montoni Eesti päritolu annab koduturul eelise. Lisad: Kaubamärk Monton; Kaubamärk Reserved. Diagramm: LPP Retail Estonia käive tegi mullu hüppe
29 CFR 1915.153 - Eye and face protection.
2010-07-01
... protection that incorporates the prescription in its design, unless the employee is protected by eye... 29 Labor 7 2010-07-01 2010-07-01 false Eye and face protection. 1915.153 Section 1915.153 Labor... (PPE) § 1915.153 Eye and face protection. (a) General requirements. (1) The employer shall ensure that...
Kutsenõustamine ja -suunitlus kultuurierinevuste värvikülluses / Epp Vodja
Vodja, Epp
2001-01-01
Eesti Õppe- ja Praktikateabe Keskus ja Junior Achievementì Arengufond osalesid partneritena Euroopa kutseharidust toetava programmi Leonardo da Vinci pilootprojektis "Towards a European Rainbow - Increasing the Intercultural Awareness Among Guidance Counsellors" (Euroopa vikerkaare suunas - kultuuridevahelise üksteisemõistmise täiustamine kutsesuunitlejate ja -nõustajate seas) ehk lühidalt Rainbow-projektis
Aravõitu gasellist sai ründav lõvi / Tiit Reier
Reier, Tiit
2004-01-01
Mööblitootjate TOP 50 1. koht. Bellus Furnitur OÜ tegevjuhid Urmas Aun ja Rolf Relander kirjeldavad pehme mööbli disainimise ja tootmise protsessi uues tootmishoones Haljalas, turustustegevust Skandinaaviamaades ning rõhutavad investeeringute vajadust toormeladude ja logistika arendamiseks. Diagramm: Käive ja kasum tegid hüppe. Lisa: Bellus Furnitur OÜ
29 CFR 1915.159 - Personal fall arrest systems (PFAS).
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Personal fall arrest systems (PFAS). 1915.159 Section 1915... Protective Equipment (PPE) § 1915.159 Personal fall arrest systems (PFAS). The criteria of this section apply to PFAS and their use. Effective January 1, 1998, body belts and non-locking snaphooks are not...
Kemi er hele fundamentet for vores livsførelse
DEFF Research Database (Denmark)
Kepp, Kasper Planeta
2011-01-01
Talemåden “der er god kemi imellem dem” tager de fleste næppe bogstaveligt. Men som kemiker gør man, for al kommunikation mellem os mennesker styres ikke kun af lys- og lydimpulser, men også af hele den kemiske efterbehandling, der påvirker alle vores sanser....
Weeks, J. W.; Johnson, G.; Burlison, S.; London, S.; Lewis, D. F.
1997-01-01
Objectives: To evaluate the utility of intrapartum amnioinfusion (AI) in reducing the infectious morbidity of patients with meconium-stained fluid (MSF). Previous studies have shown increased intraamniotic infection (IAI) and postpartum endometritis (PPE) rates in patients with MSF. Intraamniotic infection has been reduced with the prophylactic administration of ampicillin–sulbactam in MSF. Intraamniotic infection and PPE have been reduced with the use of AI in patients with clear fluid. No investigators have specifically examined the efficacy of AI in reducing meconium-stained, amniotic-fluid-associated infectious morbidity. Methods: A retrospective cohort study of all cases of MSF was conducted and included patients who delivered at Louisiana State University Medical Center–Shreveport during the one-year period from January to December 1996. Patients were identified from the perinatal database by the diagnosis code of MSF. The medical records were reviewed to determine the consistency of MSF and the presence or absence of infectious morbidity. Patient demographics, labor characteristics, and various risk factors for infection were sought. The main outcome measures were the occurrence of clinical IAI or PPE. Statistical analysis included two-tailed unpaired t-test, X2, ANOVA, and Fisher exact test when appropriate. Results: Two hundred seventy-three medical records of patients with MSF were studied. One hundred twenty nine patients received AI, and 144 did not receive AI. No significant differences in demographics, labor characteristics, or outcome variables were noted between the two groups. The incidences of IAI were 18.6% and 24.3%, P = 0.13, in the AI and non-AI groups, respectively. Postpartum endometritis occurred in 22.5% of AI patients and 21.5% of non-AI patients, P = 0.97. Conclusions: The use of AI confers no benefit for the reduction of infectious morbidity in patients with MSF. PMID:18476189
Basura, G J; Walker, P D
2001-08-15
Serotonin (5-HT) 2A receptor-mediated regulation of striatal preprotachykinin (PPT) and preproenkephalin (PPE) mRNAs was studied in adult rodents that had been subjected to near-total dopamine (DA) depletion as neonates. Two months following bilateral 6-hydroxydopamine (6-OHDA) lesion, PPT mRNA levels decreased 59-73% across dorsal subregions of the rostral and caudal striatum while PPE transcripts increased 61-94%. Four hours after a single injection of the serotonin 2A/2C receptor agonist, (+/-)-1-(2,5-Dimethoxy-4-iodophenyl)-2-aminopropane (DOI; 1 mg/kg), PPT mRNA expression was significantly increased in DA-depleted rats across all dorsal subregions of the rostral and caudal striatum as compared to 6-OHDA-treated animals alone. In the intact rat, DOI did not influence PPT mRNA levels in the rostral striatum, but did raise expression in the caudal striatum where 5-HT2A receptors are prominent. DOI did not regulate PPE mRNA levels in any striatal sub-region of the intact or DA-depleted rat. Prior administration of the 5-HT2A/2C receptor antagonist, ritanserin (1 mg/kg) or the 5-HT2A receptor antagonist, ketanserin (1 mg/kg) completely blocked the DOI-induced increases in striatal PPT mRNA in both lesioned and intact animals. The ability of ketanserin to produce identical results as ritanserin suggests that 5-HT2A receptor-mediated regulation is selectively strengthened within tachykinin neurons of the rostral striatum which are suppressed by DA depletion. The selectivity suggests that 5-HT2A receptor upregulation following DA depletion is capable of regulating tachykinin biosynthesis without influencing enkephalin expression in striatal output neurons.
Low proportion of high school senior athletes receiving recommended immunizations.
Karpinos, Ashley Rowatt; Rizzone, Katherine H; Cribbs, Sarah P; Roumie, Christianne L
2014-05-01
The preparticipation physical evaluation (PPE) often serves as the only preventive health care visit for athletes, but immunization status is not uniformly addressed in such visits. Thus, athletes may not be receiving recommended immunizations. Our aim was to determine the proportion of high school senior athletes who received all recommended immunizations. Our hypothesis was that females would be less likely than males to receive all recommended immunizations given suboptimal human papillomavirus (HPV) vaccine uptake. We conducted a cross-sectional survey evaluation of the immunization status of high school senior athletes in Davidson County, TN. The primary composite outcome was receipt of recommended immunizations for tetanus, meningococcal, and seasonal influenza. For females, the primary outcome also included completion of the HPV series. A total of 162 participants, 104 males and 58 females, were included. More males than females received all recommended immunizations (15.4% vs 3.5%; P = 0.02). When HPV immunization was excluded from the composite outcome, there was no difference in the proportion of males and females who received all recommended immunizations (15.4% vs 15.5%; P = 0.98). The odds of receiving all recommended immunizations was 0.14 (95% CI, 0.03-0.72) for females compared with males when adjusted for covariates. Athletes seen at retail-based clinics for their PPE were less likely to receive all recommended immunizations compared with athletes seen in primary care (OR, 0.13; 95% CI, 0.02-0.69). Only 1 in 6 high school senior athletes received the recommended tetanus, meningococcal, and influenza immunizations. A lower proportion of females, only 1 in 28, received all recommended immunizations due to the HPV series. Policy changes requiring a review of immunizations at the PPE would benefit many high school athletes.
Aasta e-kursuse konkursil võitis auhinna Tiina Selke
2007-01-01
13. märtsil lõppenud konverentsil "e-õpe e-riigis: strateegiad ja tehnoloogiad" kuulutati välja eelmise aasta parimad e-kursuste loojad. Humaniora kategoorias anti auhind ja multimeedia kasutamise eripreemia e-kursuse "Kodály metoodika" autorile, TLÜ muusikaõpetuse metoodika lektorile Tiina Selkele. e-kursuse konkurssi korraldab e-Õppe Arenduskeskus
Gómez-Monedero, B.; Ruiz, M. P.; Bimbela, F.; Faria, J.
2017-01-01
Benzyl phenyl ether (BPE), phenethyl phenyl ether (PPE) and diphenyl ether (DPE) have been selected as model compounds of the most abundant and significant ether linkages found within the complex structure of lignin (e.g. α–O–4, β–O–4, and 4–O–5, respectively). The catalytic hydrogenolysis of these
DEFF Research Database (Denmark)
Pedersen, Nils Arne
2008-01-01
Gennem en detaljeret historisk-filologisk argumentation viser artiklen dels, at det nyligt publicerede koptiske Judasevangelium næppe kan være en oversættelse af det Judasevangelium, som Irenæus nævner, dels at det forudsætter kendskab til en ældre, skriftlig evangelielitteratur. På denne baggrun...
Herman, Daniel A.; Tofil, Todd A.; Santiago, Walter; Kamhawi, Hani; Polk, James E.; Snyder, John S.; Hofer, Richard R.; Picha, Frank Q.; Jackson, Jerry; Allen, May
2018-01-01
NASA remains committed to the development and demonstration of a high-power solar electric propulsion capability for the Agency. NASA is continuing to develop the 14 kW Advanced Electric Propulsion System (AEPS), which has recently completed an Early Integrated System Test and System Preliminary Design Review. NASA continues to pursue Solar Electric Propulsion (SEP) Technology Demonstration Mission partners and mature high-power SEP mission concepts. The recent announcement of the development of a Power and Propulsion Element (PPE) as the first element of an evolvable human architecture to Mars has replaced the Asteroid Redirect Robotic Mission (ARRM) as the most probable first application of the AEPS Hall thruster system. This high-power SEP capability, or an extensible derivative of it, has been identified as a critical part of an affordable, beyond-low-Earth-orbit, manned exploration architecture. This paper presents the status of the combined NASA and Aerojet Rocketdyne AEPS development activities and updated mission concept for implementation of the AEPS hardware as part of the ion propulsion system for a PPE.
Directory of Open Access Journals (Sweden)
Florin GRECU
2015-09-01
Full Text Available The article analyses the process which led to the nominalization of Klaus Iohannis as candidate in the presidential election campaign representing the Christian Liberal Alliance. The adhesion of the National Liberal Party to the European popular party, the retreat of PNL’s president Crin Antonescu from the presidential race and the ascent of the mayor of Sibiu on the political stage, represent the analytical aim of this study, trough statements and media articles. The causes and the stakes of the change of the political affiliation of the Liberal National Party and the reasons of the adhesion to PPE which led locally to the fusion with the Liberal Democrat Party, will be shown by analyzing the statements of the political actors involved in the negotiation and in the political compromise that named Iohannis as the candidate of the right wing, who was already convinced since fall 2014 of winning the elections. The political actors, the PPE members trough their statements and actions, they sustained their candidate during the campaign and through congratulation letters after winning the elections.
Sfeir, Elia; Nahass, Mona G; Mourad, Ayman
2017-01-01
Severe oligodontia is one of the most important symptoms in children with hypohidrotic ectodermal dysplasia (HED). The growth of the maxilla is a key consideration in restoring their mouth. The aim of this study was to evaluate the transversal maxillary sutural growth, after passive masticatory stimulation, in HED children. We also thought to assess the efficiency and functional outcome of the proposed propriocep-tive passive expansion (PPE) prosthetic device. We studied 13 children (age 6-11 years) suffering from HED with severe oligodontia. Their maxilla was restored by a PPE device formed from two parts and joined by a passive slide system. Distance between the two parts was noted at the anterior and posterior regions at each control visit over an average of 23 months. We also conducted and filled a satisfaction questionnaire over the same period. We tested the hypothesis that the posterior expansion is greater than the anterior expansion (one-tailed Student's t-test with p-value Ectodermal Dysplasia Children. Int J Clin Pediatr Dent 2017;10(1):55-61.
Occupational Pesticide Exposures and Respiratory Health
Ye, Ming; Beach, Jeremy; Martin, Jonathan W.; Senthilselvan, Ambikaipakan
2013-01-01
Pesticides have been widely used to control pest and pest-related diseases in agriculture, fishery, forestry and the food industry. In this review, we identify a number of respiratory symptoms and diseases that have been associated with occupational pesticide exposures. Impaired lung function has also been observed among people occupationally exposed to pesticides. There was strong evidence for an association between occupational pesticide exposure and asthma, especially in agricultural occupations. In addition, we found suggestive evidence for a link between occupational pesticide exposure and chronic bronchitis or COPD. There was inconclusive evidence for the association between occupational pesticide exposure and lung cancer. Better control of pesticide uses and enforcement of safety behaviors, such as using personal protection equipment (PPE) in the workplace, are critical for reducing the risk of developing pesticide-related symptoms and diseases. Educational training programs focusing on basic safety precautions and proper uses of personal protection equipment (PPE) are possible interventions that could be used to control the respiratory diseases associated with pesticide exposure in occupational setting. PMID:24287863
Knowledge Representation Of CT Scans Of The Head
Ackerman, Laurens V.; Burke, M. W.; Rada, Roy
1984-06-01
We have been investigating diagnostic knowledge models which assist in the automatic classification of medical images by combining information extracted from each image with knowledge specific to that class of images. In a more general sense we are trying to integrate verbal and pictorial descriptions of disease via representations of knowledge, study automatic hypothesis generation as related to clinical medicine, evolve new mathematical image measures while integrating them into the total diagnostic process, and investigate ways to augment the knowledge of the physician. Specifically, we have constructed an artificial intelligence knowledge model using the technique of a production system blending pictorial and verbal knowledge about the respective CT scan and patient history. It is an attempt to tie together different sources of knowledge representation, picture feature extraction and hypothesis generation. Our knowledge reasoning and representation system (KRRS) works with data at the conscious reasoning level of the practicing physician while at the visual perceptional level we are building another production system, the picture parameter extractor (PPE). This paper describes KRRS and its relationship to PPE.
Naveed, Hammad; Hameed, Umar Farook Shahul; Harrus, Deborah; Bourguet, William; Arold, Stefan T.; Gao, Xin
2015-01-01
Results: Here, we present a novel integrated structure- and system-based approach of drug-target prediction (iDTP) to enable the large-scale discovery of new targets for small molecules, such as pharmaceutical drugs, co-factors and metabolites (collectively called ‘drugs’). For a given drug, our method uses sequence order–independent structure alignment, hierarchical clustering, and probabilistic sequence similarity to construct a probabilistic pocket ensemble (PPE) that captures promiscuous structural features of different binding sites on known targets. A drug’s PPE is combined with an approximation of its delivery profile to reduce false positives. In our cross-validation study, we use iDTP to predict the known targets of eleven drugs, with 63% sensitivity and 81% specificity. We then predicted novel targets for these drugs—two that are of high pharmacological interest, the nuclear receptor PPARγ and the oncogene Bcl-2, were successfully validated through in vitro binding experiments. Our method is broadly applicable for the prediction of protein-small molecule interactions with several novel applications to biological research and drug development.
Occupational Health Hazards among Healthcare Workers in Kampala, Uganda
Directory of Open Access Journals (Sweden)
Rawlance Ndejjo
2015-01-01
Full Text Available Objective. To assess the occupational health hazards faced by healthcare workers and the mitigation measures. Methods. We conducted a cross-sectional study utilizing quantitative data collection methods among 200 respondents who worked in 8 major health facilities in Kampala. Results. Overall, 50.0% of respondents reported experiencing an occupational health hazard. Among these, 39.5% experienced biological hazards while 31.5% experienced nonbiological hazards. Predictors for experiencing hazards included not wearing the necessary personal protective equipment (PPE, working overtime, job related pressures, and working in multiple health facilities. Control measures to mitigate hazards were availing separate areas and containers to store medical waste and provision of safety tools and equipment. Conclusion. Healthcare workers in this setting experience several hazards in their workplaces. Associated factors include not wearing all necessary protective equipment, working overtime, experiencing work related pressures, and working in multiple facilities. Interventions should be instituted to mitigate the hazards. Specifically PPE supply gaps, job related pressures, and complacence in adhering to mitigation measures should be addressed.
Phosphine Exposure Among Emergency Responders - Amarillo, Texas, January 2017.
Hall, Emily M; Patel, Ketki; Victory, Kerton R; Calvert, Geoffrey M; Nogueira, Leticia M; Bojes, Heidi K
2018-04-06
Phosphine is a highly toxic gas that forms when aluminum phosphide, a restricted-use pesticide* typically used in agricultural settings, reacts with water. Acute exposure can lead to a wide range of respiratory, cardiovascular, and gastrointestinal symptoms, and can be fatal (1). On January 2, 2017, the Texas Department of State Health Services (DSHS) was notified by the Texas Panhandle Poison Center of an acute phosphine exposure incident in Amarillo, Texas. DSHS investigated potential occupational phosphine exposures among the 51 on-scene emergency responders; 40 (78.4%) did not use respiratory protection during response operations. Fifteen (37.5%) of these 40 responders received medical care for symptoms or as a precaution after the incident, and seven (17.5%) reported new or worsening symptoms consistent with phosphine exposure within 24 hours of the incident. Emergency response organizations should ensure that appropriate personal protective equipment (PPE) is used during all incidents when an unknown hazardous substance is suspected. Additional evaluation is needed to identify targeted interventions that increase emergency responder PPE use during this type of incident.
Directory of Open Access Journals (Sweden)
Viswanath Ragupathy
2015-06-01
Full Text Available High titers of infectious viruses for vaccine and diagnostic reference panel development are made by infecting susceptible mammalian cells. Laboratory procedures are strictly performed in a Bio-Safety Level-3 (BSL3 laboratory and each entry and exit involves the use of disposable Personnel Protective Equipment (PPE to observe cell culture conditions. Routine PPE use involves significant recurring costs. Alternative non-invasive optical sensor based approaches to remotely monitor cell culture may provide a promising and cost effective approach to monitor infectious virus cultures resulting in lower disruption and costs. We report here the monitoring of high titer cultures of Human Immunodeficiency Virus-1 (HIV-1 and Herpes Simplex Virus-2 (HSV-2 remotely with the use of optical oxygen sensors aseptically placed inside the cell culture vessel. The replacement of culture media for cell and virus propagation and virus load monitoring was effectively performed using this fluorescent sensor and resulted in half the number of visits to the BSL3 lab (five versus ten.
Wang, Qin; Zhou, Wei-Min; Zhang, Yong; Wang, Huan-Yu; Du, Hai-Jun; Nie, Kai; Song, Jing-Dong; Xiao, Kang; Lei, Wen-Wen; Guo, Jian-Qiang; Wei, He-Jiang; Cai, Kun; Wang, Yan-Hai; Wu, Jiang; Kamara, Gerard; Kamara, Idrissa; Wei, Qiang; Liang, Mi-Fang; Wu, Gui-Zhen; Dong, Xiao-Ping
2016-06-23
The outbreak of Ebola virus disease (EVD) in West Africa between 2014 and 2015 was the largest EDV epidemic since the identification of Ebola virus (EBOV) in 1976, and the countries most strongly affected were Sierra Leone, Guinea, and Liberia. The Sierra Leone-China Friendship Biological Safety Laboratory (SLE-CHN Biosafety Lab), a fixed Biosafety Level 3 laboratory in the capital city of Sierra Leone, was established by the Chinese government and has been active in EBOV detection since 11 March 2015. Complete management and program documents were created for the SLE-CHN Biosafety Lab, and it was divided into four zones (the green, yellow, brown, and red zones) based on the risk assessment. Different types of safe and appropriate personnel protection equipment (PPE) are used in different zones of the laboratory, and it fully meets the Biosafety Level 3 laboratory standards of the World Health Organization. Good preparedness, comprehensive risk assessment and operation documents, appropriate PPE, effective monitoring and intensive training, together with well-designed and reasonable laboratory sectioning are essential for guaranteeing biosafety.
Dificuldades e limitações das luvas de proteção usadas no corte manual da cana
Directory of Open Access Journals (Sweden)
Maria Cristina Gonzaga
2016-07-01
Full Text Available he present study is based on previous researches into the use of safety gloves in manual sugarcane harvesting. It analyses the certification and approval process of this PPE, discussing the issue of the distance between the test standards for the production of protective equipment for the users and the actual activity to be performed. It highlights the importance of the recognition of the various sizes of hands to the selection of safety gloves, as well as it stresses the number of accidents and occupational diseases registered in the activity involving hands, justifying the relevance of their use. During the study, it was observed how the main work tool - the cutting blade - is readapted by the workers to be used with efficiency in the productive process. It presents suggestions made by the workers in order to improve the gloves and the cutting blade. At last, it points out the challenges of recognising and discussing the difficulties and limitations of the use of PPE and of its certification system.
Pikora, T J; Braham, R; Hill, C; Mills, C
2011-06-01
To identify, describe and compare injuries among three water sport activities: kite surfing (KS), personal watercraft (PWC) and towed water sports (TWS). The study was a cross sectional, online survey. The setting was on Perth, Western Australia's popular beaches and riverbanks. Main outcome measures were number of injuries and level of severity; level of exposure and protection measures. Overall, 43% reported at least one injury in the past 12 months, a rate of 22.3 injuries per 100 h. Kite surfers were more likely to report an injury than PWC or TWS. One-half of injuries occurred while on the water. Most injuries were caused by landing awkwardly (56%) and/or trying new tricks (41%). Despite 90% of respondents having used at least one personal protective equipment (PPE) item, half (49%) reported always using a personal floatation device. This study provided information on KS, PWC and TWS injuries as well as a range of safety behaviours. It is recommended that these results form the basis of further research to reduce injury rates and encourage the use of PPE items.
Elsabahy, Mahmoud; Zhang, Shiyi; Zhang, Fuwu; Deng, Zhou J.; Lim, Young H.; Wang, Hai; Parsamian, Perouza; Hammond, Paula T.; Wooley, Karen L.
2013-11-01
The construction of nanostructures from biodegradable precursors and shell/core crosslinking have been pursued as strategies to solve the problems of toxicity and limited stability, respectively. Polyphosphoester (PPE)-based micelles and crosslinked nanoparticles with non-ionic, anionic, cationic, and zwitterionic surface characteristics for potential packaging and delivery of therapeutic and diagnostic agents, were constructed using a quick and efficient synthetic strategy, and importantly, demonstrated remarkable differences in terms of cytotoxicity, immunotoxicity, and biofouling properties, as a function of their surface characteristics and also with dependence on crosslinking throughout the shell layers. For instance, crosslinking of zwitterionic micelles significantly reduced the immunotoxicity, as evidenced from the absence of secretions of any of the 23 measured cytokines from RAW 264.7 mouse macrophages treated with the nanoparticles. The micelles and their crosslinked analogs demonstrated lower cytotoxicity than several commercially-available vehicles, and their degradation products were not cytotoxic to cells at the range of the tested concentrations. PPE-nanoparticles are expected to have broad implications in clinical nanomedicine as alternative vehicles to those involved in several of the currently available medications.
Calorimetric investigations of solids by combined FPPE - TWRC method
International Nuclear Information System (INIS)
Dadarlat, D; Streza, M; Pop, M N; Tosa, V; Delenclos, S; Longuemart, S; Sahraoui, A Hadj
2010-01-01
An alternative photopyroelectric (PPE) technique that combines the front detection configuration (FPPE) with the thermal-wave-resonator-cavity (TWRC) method is proposed for direct measurement of thermal effusivity of solid materials inserted as backings in the FPPE detection cell. The method uses the scan of the normalized PPE phase as a function of sample's thickness, in the thermally thin regime for the sensor and liquid layer, and thermally thick regime for the backing material. The value of backing's thermal effusivity results from the optimization of the fit of the phase of the signal, performed with sample's thickness and backing's thermal effusivity as fitting parameters. The paper presents experimental results on several solid materials (inserted as backing in the cell), with different values of thermal effusivity (brass, steel, wood) and two liquids (ethylene glycol, water) largely used in the FPPE-TWRC cells. The paper stresses mainly on the sensitivity of the technique to different liquid/backing effusivity ratios. It seems that the method is suitable especially when investigating solids with values of thermal effusivity close to the effusivity of the liquid layer.
Directory of Open Access Journals (Sweden)
Felisia Novita Sari
2015-05-01
Full Text Available This study evaluates the impact of IFRS adoption, fair value information of property, plant, and equipment (PPE, and disclosure of appraiser services into a firm's information asymmetry. Information asymmetry is the primary reason for the existence of accounting. Accounting could be a mechanism to enable communication of useful information from insiders to outsiders. IFRS adoption and better disclosure are important factors that avoid exploitation by informed bodies, and protect uninformed investors. Using Indonesian data, this study analyzes two year before and after 2011, an implementation year. This research gives evidence that IFRS adoption is able to decrease information asymmetry. Disclosure of appraiser services is also able to decrease information asymmetry, however, fair value information of PPE is not an important determinant of information asymmetry. Other results present that share prices, share turnover, and firm size can affect information asymmetry. By knowing the factors affecting information asymmetry, information asymmetry problem could be minimized. This study concludes that IFRS implementation and disclosure of appraiser services affect information asymmetry.
Insekticidresistens hos væggelus i Danmark
DEFF Research Database (Denmark)
Kilpinen, Ole; Jensen, Karl-Martin Vagn; Kristensen, Michael
. Organophosfaten chlorpyrifos, var der derimod kun let nedsat følsomhed for og denne viste sig fuldt effektiv når væggelusene blev eksponeret på overflader behandlet med de kommercielle produkter. Da chlorpyrifos næppe bliver gen-registreret, står man tilbage med pyrethroiderne, som ikke længere kan anbefales til...
Den rige personlighed er livsduelig
DEFF Research Database (Denmark)
Holm, Claus
2015-01-01
For omtrent 160 år siden formulerede Karl Marx forestillingen om en rig individualitet som det kommunistiske samfunds individideal. I dag får forestillingen relevans. Lyder det lidt besynderligt, er det ikke mærkeligt. For de fleste af os går næppe rundt og tror, at vi er lige på trapperne til...
Sudden cardiac arrest risk in young athletes
African Journals Online (AJOL)
to accentuate the importance of using PPE to prevent SCA in young athletes. S Afr J SM ... His resting blood pressure was 110/68 mmHg. His first heart ... the intraventricular septum of the left ventricle was 0.99 cm in the ... the medial cusp of the anterior mitral valve leaflet associated with ... assessed as being functional.
Testing household disinfectants for the inactivation of helminth eggs ...
African Journals Online (AJOL)
2016-10-04
Oct 4, 2016 ... last was added because it was identified by franchise operators as being supplied to pit emptiers for cleaning of PPE, tools and spills. The active ingredient in both Product A and Product B was sodium hypochlorite. Although the active ingredient for. Products A and B was the same, Product A also contained ...
Rapid Quantification of Energy Absorption and Dissipation Metrics for PPE Padding Materials
2010-01-22
dampers , i.e., Hooke’s Law springs and viscous ...absorbing/dissipating materials. Input forces caused by blast pressures, determined from computational fluid dynamics (CFD) analysis and simulation...simple lumped-‐ parameter elements – spring, k (energy storage) – damper , b (energy dissipa/on Rapid
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Sørensen, Jesper Givskov; Damgaard, Christian
2012-01-01
forekomst af uønskede effekter af PMI-proteinet på ikke-målorganismer næppe sandsynlige. Anvendelsen af mannose til markørgen må vurderes som miljømæssigt mindre problematisk og dermed miljømæssigt positivt i forhold til anvendelsen af HT-markører. DMU vurderer samlet, at der ikke kan forventes nogen...
DEFF Research Database (Denmark)
Kjellsson, Gøsta; Sørensen, Jesper Givskov; Strandberg, Morten Tune
2011-01-01
forekomst af uønskede effekter af PMI-proteinet på ikke-målorganismer næppe sandsynlige. Anvendelsen af mannose til markørgen må vurderes som miljømæssigt mindre problematisk og dermed miljømæssigt positivt i forhold til anvendelsen af HT-markører. DMU vurderer samlet, at der ikke kan forventes nogen...
Rating af banker og banksystemer
DEFF Research Database (Denmark)
Grosen, Anders
2010-01-01
Banksystemer over hele verdenen er med nød og næppe blevet reddet af diverse statslige hjælpepakker. Derfor er der i disse år øget fokus på banker og banksystemers rating. Denne interesse bliver ikke mindre af, at de statslige garantier til bankerne i mange lande udløber i de kommende år. Rating ...
Energy Technology Data Exchange (ETDEWEB)
Reynolds, J.E. III, Wilcox, J.R.
1986-01-01
Ten one-day aerial surveys were conducted in winter, 1984-85, to assess manatee distribution and abundance around five Florida Power and Light Company (FPL) plants: Cape Canaveral (PCC), Riviera (PRV), Port Everglades (PPE), Lauderdale (PFL) and Fort Myers (PFM). A total of 3804 manatees was observed, with a maximum of 636 animals for a single survey. Individual surveys for 1984-84 produced higher combined counts for all plants than in previous years. Maximum counts for PRV, PPE and PFM were the highest recorded for those particular plants. The maximum count for PCC in 1984-85 was lower than counts from most previous years, and the maximum from PFL was intermediate, relative to maxima from previous years. The counts along the east coast of Florida probably reflected a southward redistribution of manatees as well as very cold January weather after warm December conditions. The high count at PFM probably resulted from cold January weather and surface resting behavior by the manatees which made them more visible than usual. Calves represented 10 x 3% of the animals observed near the FPL plants and in Hobe Sound. PFM had a higher percentage of calves than did other plants.
Baryon resonance production and dielectron decays in proton-proton collisions at 3.5 GeV
Energy Technology Data Exchange (ETDEWEB)
Agakishiev, G.; Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Ladygin, V.; Vasiliev, T.; Zanevsky, Y. [Joint Institute of Nuclear Research, Dubna (Russian Federation); Balanda, A.; Dybczak, A.; Michalska, B.; Palka, M.; Przygoda, W.; Salabura, P.; Trebacz, R. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Belver, D.; Cabanelas, P.; Garzon, J.A. [Univ. de Santiago de Compostela, LabCAF. F. Fisica, Santiago de Compostela (Spain); Berger-Chen, J.C.; Epple, E.; Fabbietti, L.; Lalik, R.; Lapidus, K.; Siebenson, J. [Excellence Cluster ' ' Origin and Structure of the Universe' ' , Garching (Germany); Blanco, A.; Fonte, P.; Lopes, L.; Mangiarotti, A. [LIP-Laboratorio de Instrumentacao e Fisica Experimental de Particulas, Coimbra (Portugal); Boehmer, M.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Weber, M. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Boyard, J.L.; Hennino, T.; Liu, T.; Ramstein, B. [Universite Paris Sud, Institut de Physique Nucleaire (UMR 8608), CNRS/IN2P3, Orsay Cedex (France); Finocchiaro, P.; Schmah, A.; Spataro, S. [Laboratori Nazionali del Sud, INFN, Catania (Italy); Froehlich, I.; Goebel, K.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Pechenova, O.; Rustamov, A.; Stroebele, H.; Tarantola, A.; Teilab, K. [Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany); Galatyuk, T.; Gonzalez-Diaz, D.; Gumberidze, M.; Kornakov, G. [Technische Universitaet Darmstadt, Darmstadt (Germany); Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Reshetin, A.; Sadovsky, A. [Russian Academy of Science, Institute for Nuclear Research, Moscow (Russian Federation); Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Pechenov, V.; Pietraszko, J.; Schwab, E.; Sturm, C.; Traxler, M.; Yurevich, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Iori, I. [Sezione di Milano, INFN, Milano (Italy); Kaempfer, B.; Kotte, R.; Naumann, L.; Wendisch, C.; Wuestenfeld, J. [Institut fuer Strahlenphysik, Helmholtz-Zentrum Dresden-Rossendorf, Dresden (Germany); Krasa, A.; Krizek, F.; Kugler, A.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V. [Academy of Sciences of Czech Republic, Nuclear Physics Institute, Rez (Czech Republic); Kuc, H. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Universite Paris Sud, Institut de Physique Nucleaire (UMR 8608), CNRS/IN2P3, Orsay Cedex (France); Kuehn, W.; Metag, V.; Spruck, B. [Justus Liebig Universitaet Giessen, II.Physikalisches Institut, Giessen (Germany); Lebedev, A. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation); Parpottas, Y.; Tsertos, H. [University of Cyprus, Department of Physics, Nicosia (Cyprus); Stroth, J. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany)
2014-05-15
We report on baryon resonance production and decay in proton-proton collisions at a kinetic energy of 3.5 GeV based on data measured with HADES. The exclusive channels pp → npπ{sup +} and pp → ppπ{sup 0} as well as pp → ppe{sup +}e{sup -} are studied simultaneously for the first time. The invariant masses and angular distributions of the pion-nucleon systems were studied and compared to simulations based on a resonance model ansatz assuming saturation of the pion production by an incoherent sum of baryonic resonances (R) with masses < 2 GeV/c{sup 2}. A very good description of the one-pion production is achieved allowing for an estimate of individual baryon resonance production cross sections which are used as input to calculate the dielectron yields from R → pe{sup +}e{sup -} decays. Two models of the resonance decays into dielectrons are examined assuming a point-like RNγ{sup *} coupling and the dominance of the ρ meson. The results of model calculations are compared to data from the exclusive ppe{sup +}e{sup -} channel by means of the dielectron and pe{sup +}e{sup -} invariant mass distributions. (orig.)
Directory of Open Access Journals (Sweden)
Jhalendra P. Rijal
2018-01-01
Full Text Available Farmers’ knowledge on pesticides and their safe use are critical for implementing effective pest management program. A household survey was conducted using the semi-structured questionnaire to evaluate vegetable growers’ knowledge on pesticide safety and pest management practices in Nepal. Results indicated that chemical pesticides were the primary choice of over 80% growers for pest management. Notably, 90% growers were aware of adverse effects of pesticides on human health and to the environment. Over 84% growers used at least one form of personal protection equipment (PPE during pesticide spray or handling, although the quality and appropriateness of the PPE warrants further investigation. Nearly 17% growers received at least one short-term training on integrated pest management (IPM; however, all of them neither knew the harmful effects of pesticide residues nor practiced proper pesticide disposal methods. Over 90% of growers rely on local pesticide retailers (i.e., Agro-vets for technical know-how about pesticide selection, handling, and use. This study highlighted a need for immediate implementation of strict pesticide use regulations and recommended educational programs for pest control professionals, growers, and pesticide retailers.
International Nuclear Information System (INIS)
Dawson, P. M.; Watson, D. D.; Hylko, J. M.
2002-01-01
This paper documents how WESKEM, LLC utilized available source term information, integrated safety management, and associated project controls to safely decommission a reaction vessel and repackage sludge containing various Resource Conservation and Recovery Act constituents and technetium-99 (Tc-99). The decommissioning activities were segmented into five separate stages, allowing the project team to control work related decisions based on their knowledge, experience, expertise, and field observations. The information and experience gained from each previous stage and rehearsals contributed to modifying subsequent entries, further emphasizing the importance of developing hold points and incorporating lessons learned. The hold points and lessons learned, such as performing detailed personal protective equipment (PPE) inspections during sizing and repackaging operations, and using foam-type piping insulation to prevent workers from cutting or puncturing their PPE on sharp edge s or small shards generated during sizing operations, minimized direct contact with the Tc-99. To prevent the spread of contamination, the decommissioning activities were performed inside a containment enclosure connected to negative air machines. After performing over 235 individual entries totaling over 285 project hours, only one first aid was recorded during this five-stage project
Sustainable Product: Personal Protective Equipment Manufactured with Green Plastic
Directory of Open Access Journals (Sweden)
Hamilton Aparecido Boa Vista
2015-04-01
Full Text Available This study analyzed the case of manufacturing of Personal Protective Equipment (PPE using as raw material biopolymers produced from ethanol from sugar cane, known as green polypropylene, produced since 2008 by BRASKEM. This article studied the PPE for the employee’s head protection, named helmet by NR 6, which is used in situations of exposure to weather and work scenarios in places where there is risk of impact from falling or projecting objects, burns, electric shock, and solar radiation. The MSA, green helmet manufacturer, made an inventory of greenhouse gas emissions into the atmosphere by comparing the two manufacturing processes of the helmet shell, covering the January 1 to December 31, 2011 period. It concluded that the sustainable helmet (green polyethylene and pigments robs 231g of CO2 from the atmosphere per produced unit, while the helmet’s production with traditional raw materials (polyethylene and petrochemical pigments found that, for each unit produced, 1029g of CO2 are emitted into the atmosphere. The study showed that substitution of raw materials has led to reduction in the impact generated in the helmets’ production.
International Nuclear Information System (INIS)
Meyer, C.H.; Eter, N.; Mennel, S.; Kroll, P.
2007-01-01
Blunt ocular trauma at the posterior pole may involve a variety of retinal structures. We examined the most frequent retinal trauma (choroidal folds, commotion retinae, choroidal rupture, valsalva retinopathy, PPE-tears, Purtscher's Retinopathy etc.) by optical coherence tomography (OCT). The damaged pre-, intra- or subretinal structures were clearly visible. The OCT is during acute and chronic phases of different traumatic events an important diagnostic tool. (author) [de
1990-09-01
reactivity features promoted by the polymeric sulfonic acid moiety in contrast to HCI. Further work is being undertaken utilizing para toluene 21 sulfonic...styrene and isoprene block and homo- polymers were synthesized by anionic polymerization. Cyclohexane (Burdick and Jackson HPLC Grade) was degassed and...terephthalic acid and 21 mole-% 4 aminophenol , was purchased from Hoechst Celanese. Blends containing 70 weight-% PPE and 30 weight-% PS were kindly
U.S. Air Force Annual Financial Statement 2010
2010-01-01
agencies must follow generally accepted accounting principles ( GAAP ) promulgated by the Federal Accounting Standards Advisory Board (FASAB). The Air... depreciates all General PP&E, other than land, on a straight-line basis. When it is in the best interest of the government, the Air Force provides...capitalization threshold, Air Force records the applicable asset as though purchased, with an offsetting liability, and depreciates it. The Air Force
DEFF Research Database (Denmark)
Münster-Swendsen, Mia
2005-01-01
Det er nærmest en kliché, at fremhæve den tidlige middelalder som en periode præget af et sammenbrud af en lang række sociale strukturer - ikke mindst de institutionelle og politiske. Uanset hvor kraftigt vi vil betone dette sammenbrud, er der næppe tvivl om at Europa undergik en lang række kr...
DEFF Research Database (Denmark)
Bruun, Hans Henrik
2009-01-01
Der er næppe nogen anden samfundsvidenskabelig tese der er blevet så berømt på et grundlag der som oftest er så misforstået som Max Webers (1864-1920) tese om sammenhængen mellem den protestantiske etik og kapitalismens ånd. Man har set ham som den der ”vender Marx på hovedet” ved at vise, at det...
Personal Ice Cooling System (PICS). Innovative technology summary report
International Nuclear Information System (INIS)
1998-11-01
The United States Department of Energy (DOE) continually seeks safer and more cost-effective remediation technologies for use in the decontamination and decommissioning (D and D) of nuclear facilities. To this end, the Deactivation and Decommissioning Focus Area (DDFA) of the DOE's Office of Science and Technology sponsors Large-Scale Demonstration and Deployment Projects (LSDDPs) in which developers and vendors of improved or innovative technologies showcase products that are potentially beneficial to the DOE's projects and to others in the D and D community. Benefits sought include decreased health and safety risks to personnel and the environment, increased productivity, and decreased cost of operation. As buildings are demolished as part of the DOE Fernald Environmental Management Project's (FEMP's) D and D Plan, many of the activities are performed in hot weather and usually require use of various types and layers of personal protective equipment (PPE). While PPE is designed to protect the worker from contamination, it also significantly compromises the body's ability to cool itself, leading to potentially serious heat stress situations. This report describes a comparative demonstration between the methodology currently used for heat stress management (i.e., limited stay times and cool-down rooms) and an alternative personal ice cooling suit technology. The baseline methodology for heat stress management is limited stay times when working in hot conditions. The FEMP's Safety Performance Requirements outline the procedures and stay times to be followed and consider the temperature of the working environment, work load, and the type and amount of PPE required for the job. While these common criteria for determining stay times, other sites may have different requirements. This demonstration investigates the feasibility of using the personal ice cooling suite as a tool for managing heat stress in workers at the FEMP. This report provides a comparative analysis of
Ulutasdemir, Nilgun; Kilic, Meryem; Zeki, Özge; Begendi, Fatma
2015-01-01
It has been suggested that inappropriate working conditions and unsafe environments at construction sites, longer working hours, and inadequate workplaces adversely affect the health behaviors of workers. The aim of this study was to evaluate the effect of occupational health and safety (OHS) practices on healthy lifestyle behaviors of workers employed at a construction site of a private company in Gaziantep, Turkey. The sampling size of this descriptive study consisted of 400 employees working at the construction site between December 2014 and January 2015. In all, 341 employees still working or participating in the study during the period of this questionnaire study were included in the sampling. Data from the survey were derived from responses to questions regarding sociodemographic characteristics, OHS applications, health state, and working conditions, as well as to the questions in on the Healthy Lifestyle Behaviors Scale (HLBS), under direct surveillance. Male workers with a mean age of 30.61 ± 8.68 years constituted the study population. Of the workers, 41.9% had a primary school education. The majority received professional and OHS training (65.7% and 79.2%, respectively). Although 83.9% reported using personal protective equipment (PPE), only 2.1% said they had experienced an occupational accident. Total mean score of HLBS scale was 116.91 ± 25.62 points. Workers who had positive thoughts about their jobs demonstrated healthy lifestyle behaviors (P = .0001). A positive direct correlation was detected between the training the workers received and the use of PPE (P = .0001). In all, 38.1% of the workers reported experiencing work stress at the time of the study. Mean HLBS scores of those experiencing work stress were lower than the scores for workers not experiencing stress (P < .05). Receiving OHS and professional training and using of PPE favorably affect healthy lifestyle behaviors. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights
Personal Ice Cooling System (PICS). Innovative technology summary report
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
The United States Department of Energy (DOE) continually seeks safer and more cost-effective remediation technologies for use in the decontamination and decommissioning (D and D) of nuclear facilities. To this end, the Deactivation and Decommissioning Focus Area (DDFA) of the DOE`s Office of Science and Technology sponsors Large-Scale Demonstration and Deployment Projects (LSDDPs) in which developers and vendors of improved or innovative technologies showcase products that are potentially beneficial to the DOE`s projects and to others in the D and D community. Benefits sought include decreased health and safety risks to personnel and the environment, increased productivity, and decreased cost of operation. As buildings are demolished as part of the DOE Fernald Environmental Management Project`s (FEMP`s) D and D Plan, many of the activities are performed in hot weather and usually require use of various types and layers of personal protective equipment (PPE). While PPE is designed to protect the worker from contamination, it also significantly compromises the body`s ability to cool itself, leading to potentially serious heat stress situations. This report describes a comparative demonstration between the methodology currently used for heat stress management (i.e., limited stay times and cool-down rooms) and an alternative personal ice cooling suit technology. The baseline methodology for heat stress management is limited stay times when working in hot conditions. The FEMP`s Safety Performance Requirements outline the procedures and stay times to be followed and consider the temperature of the working environment, work load, and the type and amount of PPE required for the job. While these common criteria for determining stay times, other sites may have different requirements. This demonstration investigates the feasibility of using the personal ice cooling suite as a tool for managing heat stress in workers at the FEMP. This report provides a comparative analysis of
The Short-term Protective Effects of ‘Non-PPE’ Gloves Used by Greenhouse Workers
Roff, Martin
2015-01-01
Task-based worker exposure assessments are used in regulatory product approval for pesticides. Some agricultural workers may be exposed to pesticide residues predominantly via transfer to the hands during plant tending or crop harvesting. They may use thin ‘splash-resistant single-use’ (SRSU) gloves or cotton gloves as good industry practice, for example, to protect a delicate crop from bruising, rather than specifically for chemical protection. These ‘non-personal protective equipment (PPE)’ gloves may or may not have been tested for chemical resistance, but can nevertheless give limited protection from chemicals. This paper reports experiments to assess the protection factors (PFs) of ‘non-PPE’ gloves against chemicals, to better inform the regulatory exposure assessments. One type of lightweight cotton and three types of 0.1 mm SRSU gloves 25cm long (latex, nitrile, and vinyl) that might be used as ‘non-PPE’ gloves and one type of 0.4 mm PPE nitrile gauntlet 33cm long were worn by 36 volunteers in greenhouses at four nurseries, handling plants sprayed with transferable but non-permeating strontium acetate in four consecutive 1-h sessions, including one session in which no gloves were worn. Dislodgeable foliar residues were measured by rinsing leaves in bags. Each subject carried out their task such as weeding or trimming, for their four sessions on their set of plants. Handwashes followed each session, and the washings were sampled and analysed for strontium. Unprotected hand contamination was taken to be the within-subject ‘challenge’ in the absence of gloves. It ranged from 166 to 4091 µg equivalent of strontium acetate on the hands and increased with increasing foliar residues. Geometric mean PFs were 60 (95% CI 38–87, n = 22) for PPE gauntlets, 32 (25–41, n = 65) for SRSU gloves and 5.3 (3.5–8, n = 21) for lightweight cotton. The PFs offered by the waterproof gloves (gauntlets and SRSU) increased with challenge, but for the
Selecting PPE for the Workplace (Personal Protective Equipment for the Eyes and Face)
... Safety and Health Program Recommendations It's the Law Poster REGULATIONS Law and Regulations Standard Interpretations Training Requirements ... page requires that javascript be enabled for some elements to function correctly. Please contact the OSHA Directorate ...
1981-01-01
COMPATABILITY (2) PPE (3) SOP’s NOTES (1) USERDA ( RADIOACTIVE MATERIALS) (2) CHEMTREC (ALL OTHER HAZARDOUS MATERIALS) 2. NAVY A. NAVY ENVIRONMENTAL HEALTH...NRC Regulations for Packaging of Radioactive Material for Transport and Transportation of Radioactive Material Under Certain Conditions (10 CFR 71) V...NAVY) I DOD Directives/Instructions--- DOD Instruction 4120.14 DOD Water and Air Polution Abatement Policy DOD 4145.19R Series Storage and Material
DEFF Research Database (Denmark)
Østerlund, A.H.; Thomsen, J.F.; Sekimpi, D.K.
2014-01-01
using a standardized questionnaire. Some 317 small-scale farmers in two districts in Uganda were interviewed about pesticide use, knowledge and attitude, symptoms of intoxication, personal protective equipment (PPE) and hygiene. The risk of reporting symptoms was analysed using logistic regression...... health problems and environmental pollution. Training of farmers in Integrated Pest Management (IPM) methods, use of proper hygiene and personal protective equipment when handling pesticides should be promoted....
Felisia Novita Sari; Dedhy Sulistiawan; Aurelia Carina Sutanto
2015-01-01
This study evaluates the impact of IFRS adoption, fair value information of property, plant, and equipment (PPE), and disclosure of appraiser services into a firm's information asymmetry. Information asymmetry is the primary reason for the existence of accounting. Accounting could be a mechanism to enable communication of useful information from insiders to outsiders. IFRS adoption and better disclosure are important factors that avoid exploitation by informed bodies, and protect uninformed i...
Vertical distribution of major photosynthetic picoeukaryotic groups in stratified marine waters
Cabello, Ana M.
2016-03-14
Photosynthetic picoeukaryotes (PPEs) are fundamental contributors to oceanic primary production and form diverse communities dominated by prymnesiophytes, chlorophytes, pelagophytes and chrysophytes. Here, we studied the vertical distribution of these major groups in two offshore regions of the northern Iberian Peninsula during summer stratification. We performed a fine-scale vertical sampling (every ∼2 m) across the DCM and used fluorescence in situ hybridization (FISH) to determine the PPE composition and to explore the possible segregation of target groups in the light, nutrient and temperature gradients. Chlorophytes, pelagophytes and prymnesiophytes, in this order of abundance, accounted for the total PPEs recorded by flow cytometry in the Avilés canyon, and for more than half in the Galicia Bank, whereas chrysophytes were undetected. Among the three detected groups, often the prymnesiophytes were dominant in biomass. In general, all groups were present throughout the water column with abundance peaks around the DCM, but their distributions differed: pelagophytes were located deeper than the other two groups, chlorophytes presented two peaks and prymnesiophytes exhibited surface abundances comparable to those at the DCM. This study offers first indications that the vertical distribution of different PPE groups is heterogeneous within the DCM. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
A centrifuge simulated push-pull manoeuvre with subsequent reduced +Gz tolerance.
Xu, Yan; Li, Bao-Hui; Zhang, Li-Hui; Jin, Zhao; Wei, Xiao-Yang; Wang, Hong; Wu, San-Yuan; Wang, Hai-Xia; Wang, Quan; Yan, Gui-Ding; Deng, Lue; Geng, Xi-Chen
2012-07-01
The push-pull effect (PPE) has been recognized as a deleterious contributor to fatal flight accidents. The purpose of the study was to establish a push-pull manoeuvre (PPM) simulation with a tri-axes centrifuge, studying the effect of this PPM on the +Gz tolerance, and to make this simulation suitable for pilot centrifuge training. The PPM was realized through pre-programmed acceleration profiles consisting of -1 Gz for 5 s followed by a +Gz plateau for 10 s. Relaxed +Gz tolerance recordings were obtained from 20 healthy male fighter aircraft pilots and 6 healthy male volunteers through exposure to pre-programmed profiles with and without previous -1 Gz exposure. A statistically significant decrease in +Gz tolerance was seen in all subjects after -1 Gz for 5 s exposure, 0.87 ± 0.13 G in the volunteer group and 0.95 ± 0.25 G in the pilot group. The ear opacity pulse as a +Gz tolerance endpoint criterion was sometimes found to be unreliable during the PPM experiments. The simulated PPM in this study elicited a PPE, which was obvious from the significant reduction in +Gz tolerance. The PPM profile appears useful to be included in centrifuge training.
Eye dose to staff involved in interventional and procedural fluoroscopy
International Nuclear Information System (INIS)
McLean, D; Hadaya, D; Tse, J
2016-01-01
In 2011 the International Commission on Radiological Protection (ICRP) lowered the occupational eye dose limit from 150 to 20 mSv/yr [1]. While international jurisdictions are in a process of adopting these substantial changes, medical physicists at the clinical level have been advising medical colleagues on specific situations based on dose measurements. Commissioned and calibrated TLDs mounted in commercially available holders designed to simulate the measurement of Hp(3), were applied to staff involved in x-ray procedures for a one month period. During this period clinical procedure data was concurrently collected and subject to audit. The use or not of eye personal protective equipment (PPE) was noted for all staff. Audits were conducted in the cardiac catheterisation laboratory, the interventional angiography rooms and the procedural room where endoscopic retrograde cholangiopancreatography (ERCP) procedures are performed. Significant levels of occupational dose were recorded in the cardiac and interventional procedures, with maximum reading exceeding the new limit for some interventional radiologists. No significant eye doses were measured for staff performing ERCP procedures. One outcome of the studies was increased use of eye PPE for operators of interventional equipment with increased availability also to nursing staff, when standing in close proximity to the patient during procedures. (paper)
Protective gloves on manual sugar cane cutting are really effective?
Abrahão, R F; Gonzaga, M C; Braunbeck, O A
2012-01-01
Problems related to the use of personal protective equipment (PPE), specially the use of protective gloves for the manual sugar cane cutting, motivated this research, made possible by a tripartite negotiation involving the Ministry of Labor, the Union of Rural Workers and the Employer's Association of sugarcane agribusiness. The main objective was to evaluate, from an ergonomics perspective, the impact of use of the gloves during the manual cane sugar cutting, raising questions on safety, effectiveness and comfort. The research was carried in a sugarcane industry of São Paulo for two seasons involving 47 workers who made a qualitative analysis of acceptance of four models of protective gloves. The methodology included the use of semi-structured interviews, questionnaires and field observations and the experimental determination of the coefficient of static friction developed between the gloves and the surfaces of the machete handle. The main results indicate the general inadequacy of the gloves currently used forcing the employees to improvise. Workers found the glove of leather and nylon scraping the best reported for comfort in use. The overall results highlight the problem of detachment of test standards for the manufacture of PPE, ignoring users and the activity to be performed.
Walsh, Matthew M; Gluck, Kevin A; Gunzelmann, Glenn; Jastrzembski, Tiffany; Krusmark, Michael
2018-03-02
The spacing effect is among the most widely replicated empirical phenomena in the learning sciences, and its relevance to education and training is readily apparent. Yet successful applications of spacing effect research to education and training is rare. Computational modeling can provide the crucial link between a century of accumulated experimental data on the spacing effect and the emerging interest in using that research to enable adaptive instruction. In this paper, we review relevant literature and identify 10 criteria for rigorously evaluating computational models of the spacing effect. Five relate to evaluating the theoretic adequacy of a model, and five relate to evaluating its application potential. We use these criteria to evaluate a novel computational model of the spacing effect called the Predictive Performance Equation (PPE). Predictive Performance Equation combines elements of earlier models of learning and memory including the General Performance Equation, Adaptive Control of Thought-Rational, and the New Theory of Disuse, giving rise to a novel computational account of the spacing effect that performs favorably across the complete sets of theoretic and applied criteria. We implemented two other previously published computational models of the spacing effect and compare them to PPE using the theoretic and applied criteria as guides. © 2018 Cognitive Science Society, Inc.
Parapneumonic effusions in children: five years experience
Directory of Open Access Journals (Sweden)
Atilla Cifci
2017-12-01
Full Text Available Aim: Most severe complication of respiratory tract infections that causing morbidity and mortality in children is parapneumonic effusion(PPE. PPE is a pleural exudate that is related with primary pneumonia. The early and appropriate antibiotic treatment is very important in follow-up of patients who are diagnosed as parapneumonic effusion and also the timing of interventional and surgical treatment is important to decrease morbidity and mortalitiy in whom clinical and laboratory findings are not cured enough. Materials and Methods: In this study, the clinical and laboratory findings of parapneumonic effusion one hundred patients applied to one center in five years time are discussed. Results: The mean age of patients were 52 months(1.5-156, 52 were male(52%.The 71% of patients were smaller than five years old. The mean duration of hospitalization of patients were 19.6 days(1-45 days. Most frequent spymptom in application was fever, most frequent sign were tachycardia and retractions, most frequent laboratory anormality was high white blood count. The most frequent microorganism in pleural fluid culture was S.aureus. Conclusion: The determination of pathogens causing parapneumonic effusions in our country is very important for starting most suitable treatment early and to decrease morbidity and mortality. [J Contemp Med 2017; 7(4.000: 340-347
Update on the enhancement of Florida power and light 400 MW steam generator program
International Nuclear Information System (INIS)
Mazzarell, G.R.; Chang, P.S.
1991-01-01
Florida Power and Light has nine (9) 400 MW units, designed and installed by Foster Wheeler in the 1960's. These fossil units were designed as base loaded units with oil firing. However, natural gas capability was added and for more than seven years these units have been in a cycling mode of operation. The availability of these units has deteriorated over the same time period. This paper reports that Florida Power and Light instituted an enhancement program for improving the availability redundancy of all their fossil fired units. The 400 MW units were the main contributors to the system forced outage rate. Each design and operating problem of these units was studied in detail and the root causes of each problem were identified. The first two (2) units, Port Everglades units No. 3 and 4 have been modified and returned to service. Testing of these two (2) units with respect to performance guarantees and the effectiveness of each of the individual modifications, has been completed. The first unit modified, PPE No. 3 was returned to service May 1989, PPE No. 4 in May of 1990. Both units have performed satisfactorily during subsequent operation. Cape Canaveral Unit No. 2 is modified and scheduled to be returned to service in May 1991
Prevalence and Associated Factors of Depressive Symptoms among Chinese Underground Coal Miners
Directory of Open Access Journals (Sweden)
Li Liu
2014-01-01
Full Text Available Although underground coal miners are quite susceptible to depressive symptoms due to a highly risky and stressful working environment, few studies have focused on this issue. The purpose of the study was to evaluate the prevalence of depressive symptoms and to explore its associated factors in this population. A cross-sectional survey was conducted in a coal-mining population in northeast China. A set of self-administered questionnaires was distributed to 2500 underground coal miners (1,936 effective respondents. Depressive symptoms, effort-reward imbalance (ERI, overcommitment (OC, perceived physical environment (PPE, work-family conflict (WFC, and some demographic and working characteristics were measured anonymously. The prevalence of depressive symptoms was 62.8%, and the mean level was 20.00 (9.99. Hierarchical linear regression showed that marital status, education, monthly income, and weekly working time were significantly associated with depressive symptoms. A high level of depressive symptoms was significantly associated with high ERI, PPE, WFC, and OC. Accordingly, most Chinese underground coal miners probably have depressive symptoms that are mainly predicted by some occupational psychosocial factors. Efforts should be made to develop strategies to reduce ERI and OC, improve physical working environment, and care for workers’ family well-being, thereby mitigating the risk of depression among Chinese underground coal miners.
Treatment of complicated parapneumonic pleural effusion and pleural parapneumonic empyema.
Rodríguez Suárez, Pedro; Freixinet Gilart, Jorge; Hernández Pérez, José María; Hussein Serhal, Mohamed; López Artalejo, Antonio
2012-07-01
We performed this observational prospective study to evaluate the results of the application of a diagnostic and therapeutic algorithm for complicated parapneumonic pleural effusion (CPPE) and pleural parapneumonic empyema (PPE). From 2001 to 2007, 210 patients with CPPE and PPE were confirmed through thoracocentesis and treated with pleural drainage tubes (PD), fibrinolytic treatment or surgical intervention (videothoracoscopy and posterolateral thoracotomy). Patients were divided into 3 groups: I (PD); II (PD and fibrinolytic treatment); IIIa (surgery after PD and fibrinolysis), and IIIb (direct surgery). The statistical study was done by variance analysis (ANOVA), χ2 and Fisher exact test. The presence of alcohol or drug consumption, smoking and chronic obstructive pulmonary disease (COPD) were strongly associated with a great necessity for surgical treatment. The IIIa group was associated with increased drainage time, length of stay and complications. No mortality was observed. The selective use of PD and intrapleural fibrinolysis makes surgery unnecessary in more than 75% of cases. The selective use of PD and fibrinolysis avoids surgery in more than 75% of cases. However, patients who require surgery have more complications, longer hospital stay, and more days on PD and they are more likely to require admittance to the Intensive Care Unit.
Heat stress management program improving worker health and operational effectiveness: a case study.
Huss, Rosalyn G; Skelton, Scott B; Alvis, Kimberly L; Shane, Leigh A
2013-03-01
Heat stress monitoring is a vital component of an effective health and safety program when employees work in exceptionally warm environments. Workers at hazardous waste sites often wear personal protective equipment (PPE), which increases the body heat stress load. No specific Occupational Safety and Health Administration (OSHA) regulations address heat stress; however, OSHA does provide several guidance documents to assist employers in addressing this serious workplace health hazard. This article describes a heat stress and surveillance plan implemented at a hazardous waste site as part of the overall health and safety program. The PPE requirement for work at this site, coupled with extreme environmental temperatures, made heat stress a significant concern. Occupational health nurses and industrial hygienists developed a monitoring program for heat stress designed to prevent the occurrence of significant heat-related illness in site workers. The program included worker education on the signs of heat-related illness and continuous physiologic monitoring to detect early signs of heat-related health problems. Biological monitoring data were collected before workers entered the exclusion zone and on exiting the zone following decontamination. Sixty-six site workers were monitored throughout site remediation. More than 1,700 biological monitoring data points were recorded. Outcomes included improved worker health and safety, and increased operational effectiveness. Copyright 2013, SLACK Incorporated.
Ebola in the Netherlands, 2014-2015: costs of preparedness and response.
Suijkerbuijk, Anita W M; Swaan, Corien M; Mangen, Marie-Josee J; Polder, Johan J; Timen, Aura; Ruijs, Wilhelmina L M
2017-11-17
The recent epidemic of Ebola virus disease (EVD) resulted in countries worldwide to prepare for the possibility of having an EVD patient. In this study, we estimate the costs of Ebola preparedness and response borne by the Dutch health system. An activity-based costing method was used, in which the cost of staff time spent in preparedness and response activities was calculated based on a time-recording system and interviews with key professionals at the healthcare organizations involved. In addition, the organizations provided cost information on patient days of hospitalization, laboratory tests, personal protective equipment (PPE), as well as the additional cleaning and disinfection required. The estimated total costs averaged €12.6 million, ranging from €6.7 to €22.5 million. The main cost drivers were PPE expenditures and preparedness activities of personnel, especially those associated with ambulance services and hospitals. There were 13 possible cases clinically evaluated and one confirmed case admitted to hospital. The estimated total cost of EVD preparedness and response in the Netherlands was substantial. Future costs might be reduced and efficiency increased by designating one ambulance service for transportation and fewer hospitals for the assessment of possible patients with a highly infectious disease of high consequences.
Žurakovskaja, Ksenia, 1984-
2006-01-01
"Sõna" definitsioon ja väljenduse vorm, liberaalsete väljendusvabaduse kontseptsioonide juriidiline teostamine (John Stuart Mill), väljendusvabadus kui eneseteostuse ja demokratiseerumise tähtsaim element
2011-08-01
grade nanoparticles--ZnO, TiO2 , and CeO2, were studied for personal protective equipment (PPE) efficiency, initial uptake by cell lines, and...bioaccumulation in humans. For example, mercury exposure can come from dental amalgams, fish consumption, and drinking water. We are using single stranded...with a yellow metabolic dye (MTT). Live cells convert MTT to an intense purple color , whereas dead cells remain yellow. While this method is a
2008-04-01
treated, such as plants, soil, or water, is: • coveralls • waterproof gloves • shoes plus socks. DIMILIN 4L is an insect growth regulator which is...Handlers Must Wear: A long-sleeved shirt and long pants; shoes plus socks. Follow manufacturer’s instructions for cleaning and maintaining PPE. If no such...EQUIPMENT Applicators and Other Handlers Must Wear: A long-sleeved shirt and long pants; shoes plus socks. Follow manufacturer’s instructions for
Directory of Open Access Journals (Sweden)
Mehdi Jahangiri
2016-12-01
Conclusion: This study revealed a poor level of the implementation of occupational health services in Iranian self-employed enterprises. Based on the findings, providing basic training on the occupational health, more enforcing in conduction of health examinations and providing PPE, and taking appropriate strategies aimed at eliminating or minimizing work environment harmful agents are the major factor that should be considered to improve the level of occupational health services among the studied enterprises.
2013-01-01
researchers have used ultrafast transient absorption spectros - copy to show that the charge separation rate of Type II core− shell QDs depends on the extent...the first direct measurement of the evanescent electron density of the QD exciton. We use ultrafast two-photon photoelectron spectros - copy (2PPE) to...clusters are well preserved after the aerosol system, as observed using UV − visible spectroscopy (Supporting Information Figure S1). The isolation of the
Evaluation of Expedient Decontamination Options with Activated Peroxide-based Liquid Sporicides
2013-02-05
Figure 2-1) that are typical of the materials found in residential dwellings and meet industry standards or specifications for indoor use. Documented...Anthrax inhalation and lethal human infection. Lancet, 2002. 359(9307): p. 710-1. 14. Glassman, H.N., Industrial inhalation anthrax. Bacteriol. Rev...Begin by donning PPE (gloves, lab coat, and protective eyewear ). 2. Clean the workspace by wiping with pAB, next with DI water , and lastly with a 70
Asset Accounting According to National and International Standards
Karina Utenkova
2014-01-01
The Article overviews the issues of complying National Accounting Standards at the enterprises of Ukraine with International Financial Reporting Standards. Key provisions of national and international standards governing the accounting of fixed assets (NP(S)A 7 'Property, Plant, Equipment', IFRS 16 'Fixed Assets') have been analyzed. It has been found that the list of PPE regulated by both accounting standard frameworks is not identical. Specifics of fixed assets recognition, their classifica...
Directory of Open Access Journals (Sweden)
Hassan Salehi
2016-04-01
Full Text Available Introduction Poultry meat enriched with long-chain polyunsaturated fatty acids n-3 (PUFA Lc n-3 can make a nutritionally meaningful contribution to Western diets in which consumption of PUFA Lc n-3 is low. Enrichment of poultry meat with this fatty acid is usually achieved by inclusion of fish oil in broiler diet (23, 24. However, meat enriched in this way is susceptible to quality deterioration by lipid oxidation during storage or cooking, leading to reduction in nutritive value and accumulation of lipid oxidation products (10. Oxidation is a very general process affecting lipids, pigments, proteins, DNA, carbohydrates, and vitamins (11. The objective of this study was to evaluate the effects of dietary α-tocopherol (α-Toc, pomegranate peel extract (PPE and pomegranate peel (PP on fatty acid profile, aoxidation and phenolic compounds in raw thigh and breast meat during refrigeration. Materials and methods Peels of pomegranate were harvested in October 2011 from pomegranate trees (Ardestani, variety in Khorasan Razavi province (East, Iran. Dried powders of peels (2.5 g were extracted with 40 mL of methanol solvent at room temperature for 6 hours. Three hundred and eighty four 1-d-old male broiler chicks (Ross 308 were randomly allotted to 8 groups with 4 replicates of 12 birds. Eight dietary treatments including control diet without feed additives, control diet mixed with 200 mg/kg α-Toc, control diet mixed with PPE (100, 200 and 300 mg/kg, and control diet mixed with PP (1, 2 and 3 g/kg. In all diets 2% fish oil were added to enhance the enrichment of unsaturated n-3 fatty acid in birds. One broiler chick was randomly selected from each pen of 42 d of age. The antioxidative potential and various meat quality characteristics were determined on 0, 7, and 11 days of refrigerated storage. Total phenols content in the aqueous supernatant was estimated by the Folin-Ciocalteu method (33. 1, 1-Diphenyl-2-picrylhydrazyl (DPPH radical scavenging
Nutritional status of children hospitalized for parapneumonic effusion.
Directory of Open Access Journals (Sweden)
Koen Huysentruyt
Full Text Available BACKGROUND & AIMS: Among children hospitalized for pneumonia, those with parapneumonic effusion (PPE are at particular risk for nutritional deterioration. This study aimed to 1 investigate the evolution of the nutritional status during hospitalization and at outpatient follow-up; 2 determine clinical risk factors for weight loss during hospitalization; 3 describe the nutritional interventions for these children. METHODS: Retrospective chart review (January '07 - September '12 of 56 children with pneumonia, complicated by PPE in two Belgian hospitals for data on body weight and height at admission (t0 and discharge (t1, and two weeks (t2 and one month (t3 after discharge. Length of hospitalization (LoS, length of stay in paediatric intensive care (LoSPICU and maximal in-hospital weight loss (tmax were calculated and nutritional interventions were recorded. RESULTS: The median (range age was 3.5 (1.0-14.8 years. Weight or height was lacking in five (8.9% children at t0 and in 28 (50% at t1; 21.4% was weighed only once during hospitalization. At tmax, respectively 17/44 and 5/44 children lost ≥ 5% and ≥ 10% of their weight. Median (range LoS and LoSPICU were 18.0 (10-41 and 4.0 (0-23 days. One-fourth received a nutritional intervention. Weight for height at admission (WFH(t0 significantly predicted maximal weight loss (β (95% CI = -0.34 (-2.0--0.1; p = 0.03. At t2 and t3, 13/32 and 5/22 of the children with available follow-up data did not reach WFH(t0, whilst in 4/35 and 5/26 body weight remained ≥ 5% under the weight(t0. CONCLUSIONS: One-third of children with pneumonia complicated by PPE and monitored for weight and height, lost ≥ 5% of their body weight during hospitalization. One-fourth did not reach initial WFH one month after discharge. Those with a higher WFH at admission were at higher risk of weight loss. More attention for monitoring of weight loss and the nutritional policy during and after hospitalization is warranted.
Energy Technology Data Exchange (ETDEWEB)
Ridley, M.D. [Department of Physics, Biomaterials Research Laboratory, University of Memphis, 216 Manning Hall, Memphis, TN 38152 (United States); Jahan, M.S. [Department of Physics, Biomaterials Research Laboratory, University of Memphis, 216 Manning Hall, Memphis, TN 38152 (United States)], E-mail: mjahan@memphis.edu
2007-12-15
Ultra-high molecular weight polyethylene (UHMWPE), doped with vitamin E ({alpha}-tocopherol ({alpha}-T)), was irradiated with gamma rays in nitrogen (N{sub 2}) or air, and the resulting free radicals were detected in air using an electron spin resonance (ESR) technique. Two groups of samples were investigated. In one group, samples were prepared from blends of {alpha}-T (20 wt%) and UHMWPE powder (PPE-{alpha}-T) and, in the other, from compression molded blocks (CMPE-{alpha}-T). The CMPE-{alpha}-T blocks contained 0% (control), 0.5%, 1.0%, 10.0%, 15.0%, 20.0% and 25.0% {alpha}-T by weight. When irradiation was performed in air, the ESR spectrum of powder samples showed the presence of only vitamin E radical (tocopheroxyl, {alpha}-T-O{sup {center_dot}}), and there was no detectable signal due to PE radicals (alkyl/allyl). Most likely, all PE radicals were quenched by vitamin E during irradiation in air. However, when irradiation was performed in N{sub 2}, composite ESR spectra showed the presence of both PE and {alpha}-T-O{sup {center_dot}} radicals. Compared to the control (PPE, 0% {alpha}-T) PE radicals in PPE-20% {alpha}-T were found to be significantly reduced or quenched by {alpha}-T. The presence of {alpha}-T in powder samples, however, did not affect the long-term (71 days in this study) oxidation behavior of the PE radicals. Compression molded samples, with and without {alpha}-T, produced identical ESR spectra irrespective of their irradiation environment N{sub 2} or air. However, radical concentration, measured immediately after irradiation, was found to be an order of magnitude less in CMPE-{alpha}-T than in the control (CMPE-0% {alpha}-T). They also evidenced identical structural changes in the respective ESR spectra during subsequent oxidation for 24 days in open air. These observations suggest that {alpha}-T can effectively quench a significant fraction of PE radicals during irradiation, but has no measurable effect on subsequent reactions. No
Tapp, Loren; Ramsey, Jessica G; Wen, Anita; Gerona, Roy
2017-12-01
Synthetic cannabinoids (SCs), commonly known by the street name "Spice," are designer drugs of abuse that mimic the psychoactive effects of marijuana. Intentional SC use has resulted in multiple toxicities (1,2), but little is known about occupational SC exposure. After a federal agency's law enforcement personnel in Nevada reported irritability and feeling "high" after raiding illegal SC laboratories and processing seized SCs, a request for a health hazard evaluation was made by the agency to CDC's National Institute for Occupational Safety and Health (NIOSH) in 2014 to evaluate agents' occupational SC exposures. After making the request for a health hazard evaluation, federal agents conducted a raid of an illegal SC laboratory, with assistance from local law enforcement and Drug Enforcement Administration (DEA) personnel and with NIOSH investigators observing from a distance. After the raid, agents collected and processed material evidence. NIOSH investigators tested agents' urine for SC levels before and after the raid and measured SCs in the air and on surfaces after the raid. DEA determined that AB-PINACA (an SC compound) and mitragynine (a plant material with opium-like effects, also known as "kratom") were present in the illegal laboratory. AB-PINACA, its metabolites, and mitragynine were not detected in agents' urine before the raid; however, one or more of these substances was found in the urine of six of nine agents after the raid and processing of the SC evidence. AB-PINACA was detected in one surface wipe sample from the SC laboratory; none was detected in the air in the laboratory or in the offices of the law enforcement agency where the materials were processed after the raid. No policies were in place regarding work practices and use of personal protective equipment (PPE) during raids and evidence processing. To protect agents from SC exposures, NIOSH recommended that the agency require agents to wear a minimum level of PPE (e.g., protective gloves
Energy Technology Data Exchange (ETDEWEB)
Garrido, J. M. [Departamento de Ingeniería Química, Universidad de Concepción, POB 160-C Concepción (Chile); Algaba, J.; Blas, F. J., E-mail: felipe@uhu.es [Laboratorio de Simulación Molecular y Química Computacional, CIQSO-Centro de Investigación en Química Sostenible and Departamento de Física Aplicada, Universidad de Huelva, 21007 Huelva (Spain); Míguez, J. M. [Laboratoire des Fluides Complexes et Leurs Reservoirs, Université de Pau et des Pays de l’Adour, CNRS, TOTAL–UMR 5150, Avenue de l’Université, B.P. 1155, Pau F-64013 (France); Departamento de Física Aplicada, Universidade de Vigo, E36310 Vigo (Spain); Mendiboure, B. [Laboratoire des Fluides Complexes et Leurs Reservoirs, Université de Pau et des Pays de l’Adour, CNRS, TOTAL–UMR 5150, Avenue de l’Université, B.P. 1155, Pau F-64013 (France); Moreno-Ventas Bravo, A. I. [Laboratorio de Simulación Molecular y Química Computacional, CIQSO-Centro de Investigación en Química Sostenible and Departamento de Geología, Universidad de Huelva, 21007 Huelva (Spain); Piñeiro, M. M. [Departamento de Física Aplicada, Universidade de Vigo, E36310 Vigo (Spain)
2016-04-14
We have determined the interfacial properties of tetrahydrofuran (THF) from direct simulation of the vapor-liquid interface. The molecules are modeled using six different molecular models, three of them based on the united-atom approach and the other three based on a coarse-grained (CG) approach. In the first case, THF is modeled using the transferable parameters potential functions approach proposed by Chandrasekhar and Jorgensen [J. Chem. Phys. 77, 5073 (1982)] and a new parametrization of the TraPPE force fields for cyclic alkanes and ethers [S. J. Keasler et al., J. Phys. Chem. B 115, 11234 (2012)]. In both cases, dispersive and coulombic intermolecular interactions are explicitly taken into account. In the second case, THF is modeled as a single sphere, a diatomic molecule, and a ring formed from three Mie monomers according to the SAFT-γ Mie top-down approach [V. Papaioannou et al., J. Chem. Phys. 140, 054107 (2014)]. Simulations were performed in the molecular dynamics canonical ensemble and the vapor-liquid surface tension is evaluated from the normal and tangential components of the pressure tensor along the simulation box. In addition to the surface tension, we have also obtained density profiles, coexistence densities, critical temperature, density, and pressure, and interfacial thickness as functions of temperature, paying special attention to the comparison between the estimations obtained from different models and literature experimental data. The simulation results obtained from the three CG models as described by the SAFT-γ Mie approach are able to predict accurately the vapor-liquid phase envelope of THF, in excellent agreement with estimations obtained from TraPPE model and experimental data in the whole range of coexistence. However, Chandrasekhar and Jorgensen model presents significant deviations from experimental results. We also compare the predictions for surface tension as obtained from simulation results for all the models with
Huang, Wen-Yao
A series of substituted poly(p-phenyleneethynylene)s, PPE, were synthesized by alkyne metathesis. The substituents dibutyl (a), dioctyl (b), ditetradecyl (c), di-2-ethylhexyl (d) and di-2-cyclohexylethyl; (e)were placed on the 2,5 positions of the phenyl rings. X-ray diffraction studies indicated that the main chains of each polymer were arranged in regular, layered arrays. Liquid crystalline structures were observed by polarized optical microscopy in PPE 4b, 4c and 4d. The temperatures of isotropization of the liquid crystalline structures coincided with the disordering temperatures determined by differential scanning calorimetry. The UV absorption spectra showed a gradual blue shift of the λmax for all these polymers, suggesting a decrease in the electronic delocalization along the chain as the size and geometry of the side group changed. The photoluminescence spectra in dilute toluene solutions are consistent with vibronic coupling and emission from localized excited states. The emission spectra of thin films show characteristics typical of excimer or aggregate formation in the solid state. Lastly, an improved method of molecular weight determination by end group analysis was devised. Molecular organization and orientation in thin films (~100 nm) of a triblock copolymer, PPEPEG, was studied. The morphology of the thin film can be visualized as consisting of PMMA as the major phase in which domains of vertically oriented triblock copolymers are dispersed with PEG groups facing the air-film interface. The molecular and supramolecular structure of a series of well-defined fully conjugated poly(2,5- diakyl-p-phenyleneethynylene)s, PPE, in toluene has been studied in the sol state and in the gel state by surface tension and photoluminescence measurements. Poly (2,6[4- phenyl quinoline]), I, and poly (2,6[p-phenylene] 4- phenyl quinoline), II, were synthesized by the self- condensation of 5-acetyl-2-aminobezophenone and 4-amino- 4 '-acetyl-3-benzoyl biphenyl
International Nuclear Information System (INIS)
Garrido, J. M.; Algaba, J.; Blas, F. J.; Míguez, J. M.; Mendiboure, B.; Moreno-Ventas Bravo, A. I.; Piñeiro, M. M.
2016-01-01
We have determined the interfacial properties of tetrahydrofuran (THF) from direct simulation of the vapor-liquid interface. The molecules are modeled using six different molecular models, three of them based on the united-atom approach and the other three based on a coarse-grained (CG) approach. In the first case, THF is modeled using the transferable parameters potential functions approach proposed by Chandrasekhar and Jorgensen [J. Chem. Phys. 77, 5073 (1982)] and a new parametrization of the TraPPE force fields for cyclic alkanes and ethers [S. J. Keasler et al., J. Phys. Chem. B 115, 11234 (2012)]. In both cases, dispersive and coulombic intermolecular interactions are explicitly taken into account. In the second case, THF is modeled as a single sphere, a diatomic molecule, and a ring formed from three Mie monomers according to the SAFT-γ Mie top-down approach [V. Papaioannou et al., J. Chem. Phys. 140, 054107 (2014)]. Simulations were performed in the molecular dynamics canonical ensemble and the vapor-liquid surface tension is evaluated from the normal and tangential components of the pressure tensor along the simulation box. In addition to the surface tension, we have also obtained density profiles, coexistence densities, critical temperature, density, and pressure, and interfacial thickness as functions of temperature, paying special attention to the comparison between the estimations obtained from different models and literature experimental data. The simulation results obtained from the three CG models as described by the SAFT-γ Mie approach are able to predict accurately the vapor-liquid phase envelope of THF, in excellent agreement with estimations obtained from TraPPE model and experimental data in the whole range of coexistence. However, Chandrasekhar and Jorgensen model presents significant deviations from experimental results. We also compare the predictions for surface tension as obtained from simulation results for all the models with
KEBIJAKAN PENDANAAN DAN DIVIDEN DENGAN PENDEKATAN INVESTMENT OPPORTUNITY SET
Christian Herdinata
2017-01-01
This research aimed to identify policy difference of debt and dividend policy amongcompanies having potency high and low growth with approach of investment opportunity setin Indonesia Stock Exchange (BEI). To classify company growth, it was applied five proxiesInvestment Opportunity Set (IOS) that was market to book of asset ratio (MVE/BE), price earningratio (PER), value book of plant, property, and equipment to asset ratio ( PPE/BVA) and capitaladdition to book of asset ratio (CAP/BVA). The...
Kebijakan Pendanaan Dan Dividen Dengan Pendekatan Investment Opportunity Set
Herdinata, Christian
2009-01-01
This research aimed to identify policy difference of debt and dividend policy amongcompanies having potency high and low growth with approach of investment opportunity setin Indonesia Stock Exchange (BEI). To classify company growth, it was applied five proxiesInvestment Opportunity Set (IOS) that was market to book of asset ratio (MVE/BE), price earningratio (PER), value book of plant, property, and equipment to asset ratio ( PPE/BVA) and capitaladdition to book of asset ratio (CAP/BVA). The...
1982-07-15
most critical . It is best to install it inside the housing to measure the temperature inside the pump. If the outlet temperature probe is installed in...141I1HL PPE’SSUPL IS: :M49.65 PS It THE S5THNDiAPL L’E’,J.’I- OF (1-HE: r’EASUREL’ F LOW’ 1 ’-:-- A-. caPM MEASURED. S.PEED’I 9 i;*-j3%1 P* MEASURED
Directory of Open Access Journals (Sweden)
Srujana Medithi
2017-12-01
Full Text Available Background: Inevitable pesticide use in Indian agriculture has posed an increased risk of exposure to the farmers, which may lead to adverse health manifestations. Therefore, it is essential that the farmers must be aware of the harmful effects of pesticides. Aims and Objectives: To assess knowledge, practice and identify self-reported morbidity symptoms associated with pesticide use among farm women in the identified villages of Telangana, India. Materials and Methods: Community based cross-sectional study was conducted using a pre-tested questionnaire to carry out the survey among farmwomen. Results: 129 women working in agricultural farms were included in the study. Meagre knowledge regarding route of pesticide exposure was observed. Majority of them were not aware of toxicity symbols and never read the precautions on the pesticide containers. Inaccessibility was the main reason for insubstantial use of personal protective equipments (PPEs. Unsafe storage and disposal practices of containers were observed. Weakness (57.3%, headache (52% and itching of skin (51.1% were the common morbidity symptoms. Significant association was found between morbidity symptoms and use of PPE and hygienic practices, indicating importance of such practices. Conclusion: Improving knowledge which influences their practices and encouraging PPE use might be useful to remediate these issues. Monitoring studies may further aid to obtain the outcome of the awareness programmes and subsequently improved intervention methods can also be implemented.
Naveed, Hammad
2015-08-18
Motivation: The inherent promiscuity of small molecules towards protein targets impedes our understanding of healthy versus diseased metabolism. This promiscuity also poses a challenge for the pharmaceutical industry as identifying all protein targets is important to assess (side) effects and repositioning opportunities for a drug. Results: Here, we present a novel integrated structure- and system-based approach of drug-target prediction (iDTP) to enable the large-scale discovery of new targets for small molecules, such as pharmaceutical drugs, co-factors and metabolites (collectively called ‘drugs’). For a given drug, our method uses sequence order–independent structure alignment, hierarchical clustering, and probabilistic sequence similarity to construct a probabilistic pocket ensemble (PPE) that captures promiscuous structural features of different binding sites on known targets. A drug’s PPE is combined with an approximation of its delivery profile to reduce false positives. In our cross-validation study, we use iDTP to predict the known targets of eleven drugs, with 63% sensitivity and 81% specificity. We then predicted novel targets for these drugs—two that are of high pharmacological interest, the nuclear receptor PPARγ and the oncogene Bcl-2, were successfully validated through in vitro binding experiments. Our method is broadly applicable for the prediction of protein-small molecule interactions with several novel applications to biological research and drug development.
Phagotrophy by the picoeukaryotic green alga Micromonas: implications for Arctic Oceans.
McKie-Krisberg, Zaid M; Sanders, Robert W
2014-10-01
Photosynthetic picoeukaryotes (PPE) are recognized as major primary producers and contributors to phytoplankton biomass in oceanic and coastal environments. Molecular surveys indicate a large phylogenetic diversity in the picoeukaryotes, with members of the Prymnesiophyceae and Chrysophyseae tending to be more common in open ocean waters and Prasinophyceae dominating coastal and Arctic waters. In addition to their role as primary producers, PPE have been identified in several studies as mixotrophic and major predators of prokaryotes. Mixotrophy, the combination of photosynthesis and phagotrophy in a single organism, is well established for most photosynthetic lineages. However, green algae, including prasinophytes, were widely considered as a purely photosynthetic group. The prasinophyte Micromonas is perhaps the most common picoeukaryote in coastal and Arctic waters and is one of the relatively few cultured representatives of the picoeukaryotes available for physiological investigations. In this study, we demonstrate phagotrophy by a strain of Micromonas (CCMP2099) isolated from Arctic waters and show that environmental factors (light and nutrient concentration) affect ingestion rates in this mixotroph. In addition, we show size-selective feeding with a preference for smaller particles, and determine P vs I (photosynthesis vs irradiance) responses in different nutrient conditions. If other strains have mixotrophic abilities similar to Micromonas CCMP2099, the widespread distribution and frequently high abundances of Micromonas suggest that these green algae may have significant impact on prokaryote populations in several oceanic regimes.
Gao, Pengfei; Horvatin, Matthew; Niezgoda, George; Weible, Robyn; Shaffer, Ronald
2016-12-01
Current CDC guidance for the disinfection of gloved hands during the doffing of personal protective equipment (PPE) following the care of a patient with Ebola recommends for multiple applications of alcohol-based hand rub (ABHR) on medical exam gloves. To evaluate possible effects of ABHR applications on glove integrity, thirteen brands of nitrile and latex medical exam gloves from five manufacturers and two different ABHRs were included in this study. A pair of gloves were worn by a test operator and the outside surfaces of the gloves were separately treated with an ABHR for 1-6 applications. Tensile strength and ultimate elongation of the gloves without any ABHR treatments (control gloves) and gloves after 1-6 ABHR applications were measured based on the ASTM D412 standard method. In general, tensile strength decreased with each ABHR application. ABHRs had more effect on the tensile strength of the tested nitrile than latex gloves, while ethanol-based ABHR (EBHR) resulted in lesser changes in tensile strength compared to isopropanol-based ABHR (IBHR). The results show that multiple EBHR applications on the latex gloves and some of the nitrile gloves tested should be safe for Ebola PPE doffing based on the CDC guidance. Appropriate hospital staff practice using ABHR treatment and doffing gloves is recommended to become more familiar with changes in glove properties.
Moxifloxacin pharmacokinetics and pleural fluid penetration in patients with pleural effusion.
Chatzika, Kalliopi; Manika, Katerina; Kontou, Paschalina; Pitsiou, Georgia; Papakosta, Despina; Zarogoulidis, Konstantinos; Kioumis, Ioannis
2014-01-01
The aim of this study was to evaluate the pharmacokinetics and penetration of moxifloxacin (MXF) in patients with various types of pleural effusion. Twelve patients with empyema/parapneumonic effusion (PPE) and 12 patients with malignant pleural effusion were enrolled in the study. A single-dose pharmacokinetic study was performed after intravenous administration of 400 mg MXF. Serial plasma (PL) and pleural fluid (PF) samples were collected during a 24-h time interval after drug administration. The MXF concentration in PL and PF was determined by high-performance liquid chromatography, and main pharmacokinetic parameters were estimated. Penetration of MXF in PF was determined by the ratio of the area under the concentration-time curve from time zero to 24 h (AUC24) in PF (AUC24PF) to the AUC24 in PL. No statistically significant differences in the pharmacokinetics in PL were observed between the two groups, despite the large interindividual variability in the volume of distribution, clearance, and elimination half-life. The maximum concentration in PF (CmaxPF) in patients with empyema/PPE was 2.23±1.31 mg/liter, and it was detected 7.50±2.39 h after the initiation of the infusion. In patients with malignant effusion, CmaxPF was 2.96±1.45 mg/liter, but it was observed significantly earlier, at 3.58±1.38 h (Ppleural effusion.
Acute Chemical Incidents With Injured First Responders, 2002-2012.
Melnikova, Natalia; Wu, Jennifer; Yang, Alice; Orr, Maureen
2018-04-01
IntroductionFirst responders, including firefighters, police officers, emergency medical services, and company emergency response team members, have dangerous jobs that can bring them in contact with hazardous chemicals among other dangers. Limited information is available on responder injuries that occur during hazardous chemical incidents. We analyzed 2002-2012 data on acute chemical incidents with injured responders from 2 Agency for Toxic Substances and Disease Registry chemical incident surveillance programs. To learn more about such injuries, we performed descriptive analysis and looked for trends. The percentage of responders among all injured people in chemical incidents has not changed over the years. Firefighters were the most frequently injured group of responders, followed by police officers. Respiratory system problems were the most often reported injury, and the respiratory irritants, ammonia, methamphetamine-related chemicals, and carbon monoxide were the chemicals more often associated with injuries. Most of the incidents with responder injuries were caused by human error or equipment failure. Firefighters wore personal protective equipment (PPE) most frequently and police officers did so rarely. Police officers' injuries were mostly associated with exposure to ammonia and methamphetamine-related chemicals. Most responders did not receive basic awareness-level hazardous material training. All responders should have at least basic awareness-level hazardous material training to recognize and avoid exposure. Research on improving firefighter PPE should continue. (Disaster Med Public Health Preparedness. 2018;12:211-221).
Rebmann, Terri; Loux, Travis M; Zink, Thomas K; Swick, Zachary; Wakefield, Mary
2015-03-01
Points of dispensing (PODs) are deployed for medical countermeasure mass dispensing. However, infection prevention and vaccine administration pre-event training offered and just-in-time (JIT) education planned for POD workers have not been assessed. Disaster planners were sent an online questionnaire in 2013. McNemar tests compared training offered to staff versus volunteers and pre-event training versus JIT training. In total, 301 disaster planners participated. The most frequent pre-event training included hand hygiene (59.1% and 28.0%) and personal protective equipment (PPE) selection (52.1% and 24.1%) for staff and volunteers, respectively. Few provided pre-event training on the cold chain technique (14.8% and 5.1%) or smallpox vaccine administration (4.7% and 2.3%) for staff or volunteers. For all topics except smallpox vaccine administration, more staff than volunteers received pre-event training (P training includes hand hygiene (79.8% and 73.5%) and PPE selection (79.4% and 70.0%) to staff and volunteers. For all topics, more JIT education is planned for staff than volunteers (P training is planned than has been given pre-event for all topics (P training is needed on infection prevention and vaccine administration to ensure safe and successful POD deployment. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. All rights reserved.
Evaluation of collective protection equipment in a hemodynamic room
International Nuclear Information System (INIS)
Casagrande, Saman; Silva, Ana Maria Marques da; Real, Jessica Villa; Luz, Renata Matos da
2014-01-01
Interventional radiology has high occupational dose rates. The use of personal protective equipment (PPE) and collective protection (ECP) help to reduce the dose delivered to the individuals occupationally exposed (IOE). In order to minimize the exposure of IOE's in interventionists procedures, evaluated the attenuation of the secondary radiation produced by collective protection equipment (CPE), was used a chest non-anthropomorphic phantom of polymethylmethacrylates (PMMA), with column simulator in aluminum, with variable thicknesses and kerma rate measures the air by varying the frequency tables 15 and 30 frames / s and different exposure modes. Data were acquired initially at the height of 1.25 m, using the following combinations of the ECP: (I) unshielded, (II) with plumbum display, (III) combining skirt + display. Measured at a height of 0.5 m were acquired with and without skirt. The attenuation ranged from 83.8% to 95.4% for a thickness of 25 cm. The maximum attenuation occurred with the combination of display and skirt. There was a 5 time increase in air kerma rate to be used cine display mode, when compared to the low mode. By analyzing the frequency of the frames were obtained differences up to 3 times higher for 30 frames / s, when compared with 15 frames / s. The results show the importance of using ECP in hemodynamics services, which together with the PPE, ensure adequate protection for IOEs
e-Vent näitab e-õppe ja uusmeedia tarkvaralahendusi / Krista Männa
Männa, Krista
2007-01-01
4. aprillil toimub Tallinna Ülikoolis esitluspäev e-Vent, kus tutvustatakse projekte ja tarkvaralahendusi, mille loomisele on kaasa aidanud ka üliõpilased. Projektide ja tarkvaralahenduste käivitamisel on tehtud koostööd Tiigrihüppe sihtasutuse ja Eesti Infotehnoloogia Sihtasutusega. Esitluspäeva juhatab sisse informaatikaprofessor Peeter Normak, kes tutvustab TLÜ informaatika osakonna teadus- ja arendusprojekte ning räägib kogemustest seoses eelmisel sügisel käivitunud rahvusvahelise uusmeedia magistriprogrammiga "Interaktiivne meedia ja teadmuskeskkonnad"
DEFF Research Database (Denmark)
Andersen, Maria Helena Guerra; Saber, Anne Thoustrup; Pedersen, Peter Bøgh
2017-01-01
Background: Firefighters have increased risk of cardiovascular disease and of sudden death from coronary heart disease on duty while suppressing fires. This study investigated the effect of firefighting activities, using appropriate personal protective equipment (PPE), on biomarkers...... firefighting exercises in a constructed firehouse and flashover container. The subjects were instructed to extinguish fires of either wood or wood with electrical cords and mattresses. The exposure to particulate matter ( PM) was assessed at various locations and personal exposure was assessed by portable PM...
International Nuclear Information System (INIS)
2002-01-01
Florida International University's (FIU) Hemispheric Center for Environmental Technology (HCET) evaluated five saws for their effectiveness in cutting specially prepared fiberglass-reinforced plywood crates. These crates were built as surrogates for crates that presently hold radioactively contaminated glove boxes at the Department of Energy's (DOE) Los Alamos facility. The DeWalt reciprocating saw was assessed on August 13, 2001. During the FIU test of efficacy, a team from the Operating Engineers National Hazmat Program (OENHP) evaluated the occupational safety and health issues associated with this technology. The DeWalt reciprocating saw is a hand-held industrial tool used for cutting numerous materials, including wood and various types of metals depending upon the chosen blade. Its design allows for cutting close to floors, corners, and other difficult areas. An adjustable shoe sets the cut at three separate depths. During the demonstration for the dismantling of the fiberglass-reinforced plywood crate, the saw was used for extended continuous cutting, over a period of approximately two hours. The dismantling operation involved vertical and horizontal cuts, saw blade changes, and material handling. During this process, operators experienced vibration to the hand and arm in addition to a temperature rise on the handgrip. The blade of the saw is partially exposed during handling and fully exposed during blade changes. Administrative controls, such as duty time of the operators and the machine, operator training, and personal protective equipment (PPE), such as gloves, should be considered when using the saw in this application. Personal noise sampling indicated that both workers were exposed to noise levels exceeding the Occupational Safety and Health Administration's (OSHA) Action Level of 85 decibels (dBA) with time-weighted averages (TWA's) of 88.3 and 90.6 dBA. Normally, a worker would be placed in a hearing conservation program if his TWA was greater than
DEFF Research Database (Denmark)
Andersen, Maria Helena Guerra; Saber, Anne Thoustrup; Clausen, Per Axel
2018-01-01
This study investigated a number of biomarkers, associated with systemic inflammation as well as genotoxicity, in 53 young and healthy subjects participating in a course to become firefighters, while wearing personal protective equipment (PPE). The exposure period consisted of a 3-day training...... course where the subjects participated in various live-fire training exercises. The subjects were instructed to extinguish fires of either wood or wood with electrical cords and mattresses. The personal exposure was measured as dermal polycyclic aromatic hydrocarbon (PAH) concentrations and urinary...
Sadalia, Isfenti; Saragih, Nurul Sari Syafitri
2010-01-01
The purpose of the research is to examine the influence of the profitability which is consists of the Return On Equity (ROE) and Net Profit Margin (NPM), and Investment Oppurtunity Set (IOS) which is consists of Market to Book Value of Assets (MVA/BVA), dan Property,Plant & Equipment to the Book Value of Assets(PPE/BVA) to Cash Dividend in Go Public Company as listing at Indonesian Stock Exchange. The result of research indicate that the the profitability which is consists of the Return On...
TRUE multi-annual energy planning
International Nuclear Information System (INIS)
Bringault, Anne; Cormier, Cyrille; Arditi, Maryse
2016-01-01
A multi-annual energy planning (PPE) has been introduced by the French government to transcribe the objectives of the law on energy transition into evolutions for energy consumption and production for different periods (2016-2018 and 2019-2023). This publication first indicates various assessments for these periods regarding energy consumption, electricity consumption, fossil energy consumption, renewable energy production, the share of electric renewable energies, and the decrease of the nuclear share. These objectives are then discussed with respect to different scenarios, and notably a reference scenario
Gesesew, Hailay Abrha; Woldemichael, Kifle; Massa, Desalegn; Mwanri, Lillian
2016-01-01
In Ethiopia, pesticides are widely used for a variety of purposes. The occurrence of contamination and poisoning for farmers is highly reported due to unsafe handling practices and their usage. We assessed knowledge, attitudes and experiences of previous pesticide exposure, and related health problems among farmers who use irrigation in Jimma Zone, Southwest Ethiopia. A community based cross-sectional study was conducted among farmers living in the zone. Respondents were 796 irrigation farmers from 20 kebeles (lowest administration unit) in Jimma Zone. Data were collected using a pretested and structured questionnaire via face-to-face interviews. Both descriptive and inferential statistics analysis were performed. A binary logistic regression was used to identify factors associated with attitudes of farmers towards the safe use of pesticides at P value of ≤ 0.05 in the final model. Among the participants, 54.4% (95%CI, 50.7-58%) knew at least one pesticide control method and 53.7% had positive attitudes towards safe use of pesticide. The mean score of attitudes was found to be 3.9(±0.4). Knowledge including each of the following: the names of the pesticides (AOR, 0.41; 95%CI, 0.25-0.67), methods of pest control and the use of gloves during pesticide exposure (AOR, 1.52; 95%CI, 1.07-2.16) was found to be independent predictor of the farmers' attitudes about safe use of pesticides. Past exposure of pesticide was reported by 89.6% of farmers. Participants reported ingestion (88.9%) and inhalation (90.4%) as possible mechanisms of pesticide exposure. Nearly 42% of farmers had never used any personal protective equipment (PPE) to protect themselves against pesticide exposure. Farmers reported several health complications, which were perceived as complications of pesticide exposure, including: headache, nausea and vomiting, skin rash and irritation and abdominal pain. The study exposed the existence of high probability of pesticide exposure, the low safe use of
Directory of Open Access Journals (Sweden)
Hailay Abrha Gesesew
Full Text Available In Ethiopia, pesticides are widely used for a variety of purposes. The occurrence of contamination and poisoning for farmers is highly reported due to unsafe handling practices and their usage. We assessed knowledge, attitudes and experiences of previous pesticide exposure, and related health problems among farmers who use irrigation in Jimma Zone, Southwest Ethiopia.A community based cross-sectional study was conducted among farmers living in the zone. Respondents were 796 irrigation farmers from 20 kebeles (lowest administration unit in Jimma Zone. Data were collected using a pretested and structured questionnaire via face-to-face interviews. Both descriptive and inferential statistics analysis were performed. A binary logistic regression was used to identify factors associated with attitudes of farmers towards the safe use of pesticides at P value of ≤ 0.05 in the final model.Among the participants, 54.4% (95%CI, 50.7-58% knew at least one pesticide control method and 53.7% had positive attitudes towards safe use of pesticide. The mean score of attitudes was found to be 3.9(±0.4. Knowledge including each of the following: the names of the pesticides (AOR, 0.41; 95%CI, 0.25-0.67, methods of pest control and the use of gloves during pesticide exposure (AOR, 1.52; 95%CI, 1.07-2.16 was found to be independent predictor of the farmers' attitudes about safe use of pesticides. Past exposure of pesticide was reported by 89.6% of farmers. Participants reported ingestion (88.9% and inhalation (90.4% as possible mechanisms of pesticide exposure. Nearly 42% of farmers had never used any personal protective equipment (PPE to protect themselves against pesticide exposure. Farmers reported several health complications, which were perceived as complications of pesticide exposure, including: headache, nausea and vomiting, skin rash and irritation and abdominal pain.The study exposed the existence of high probability of pesticide exposure, the low safe use
Directory of Open Access Journals (Sweden)
C. Prudhomme
2012-11-01
Full Text Available The dataset Future Flows Climate was developed as part of the project ''Future Flows and Groundwater Levels'' to provide a consistent set of climate change projections for the whole of Great Britain at both space and time resolutions appropriate for hydrological applications, and to enable climate change uncertainty and climate variability to be accounted for in the assessment of their possible impacts on the environment.
Future Flows Climate is derived from the Hadley Centre's ensemble projection HadRM3-PPE that is part of the basis of UKCP09 and includes projections in available precipitation (water available to hydrological processes after snow and ice storages have been accounted for and potential evapotranspiration. It corresponds to an 11-member ensemble of transient projections from January 1950 to December 2098, each a single realisation from a different variant of HadRM3. Data are provided on a 1-km grid over the HadRM3 land areas at a daily (available precipitation and monthly (PE time step as netCDF files.
Because systematic biases in temperature and precipitation were found between HadRM3-PPE and gridded temperature and precipitation observations for the 1962–1991 period, a monthly bias correction procedure was undertaken, based on a linear correction for temperature and a quantile-mapping correction (using the gamma distribution for precipitation followed by a spatial downscaling. Available precipitation was derived from the bias-corrected precipitation and temperature time series using a simple elevation-dependant snow-melt model. Potential evapotranspiration time series were calculated for each month using the FAO-56 Penman-Monteith equations and bias-corrected temperature, cloud cover, relative humidity and wind speed from HadRM3-PPE along with latitude of the grid and the day of the year.
Future Flows Climate is freely available for non-commercial use under certain licensing conditions. It is the
Occupational pesticide use and Parkinson's disease in the Parkinson Environment Gene (PEG) study.
Narayan, Shilpa; Liew, Zeyan; Bronstein, Jeff M; Ritz, Beate
2017-10-01
To study the influence of occupational pesticide use on Parkinson's disease (PD) in a population with information on various occupational, residential, and household sources of pesticide exposure. In a population-based case control study in Central California, we used structured interviews to collect occupational history details including pesticide use in jobs, duration of use, product names, and personal protective equipment use from 360 PD cases and 827 controls. We linked reported products to California's pesticide product label database and identified pesticide active ingredients and occupational use by chemical class including fungicides, insecticides, and herbicides. Employing unconditional logistic regression, we estimated odds ratios and 95% confidence intervals for PD and occupational pesticide use. Ever occupational use of carbamates increased risk of PD by 455%, while organophosphorus (OP) and organochlorine (OC) pesticide use doubled risk. PD risk increased 110-211% with ever occupational use of fungicides, herbicides, and insecticides. Using any pesticide occupationally for >10years doubled the risk of PD compared with no occupational pesticide use. Surprisingly, we estimated higher risks among those reporting use of personal protective equipment (PPE). Our findings provide additional evidence that occupational pesticide exposures increase PD risk. This was the case even after controlling for other sources of pesticide exposure. Specifically, risk increased with occupational use of carbamates, OPs, and OCs, as well as of fungicides, herbicides, or insecticides. Interestingly, some types of PPE use may not provide adequate protection during pesticide applications. Copyright © 2017 Elsevier Ltd. All rights reserved.
Crespo-Maraver, Mariacruz; Doval, Eduardo; Fernández-Castro, Jordi; Giménez-Salinas, Jordi; Prat, Gemma; Bonet, Pere
2018-04-04
To adapt and to validate the Experience of Caregiving Inventory (ECI) in a Spanish population, providing empirical evidence of its internal consistency, internal structure and validity. Psychometric validation of the adapted version of the ECI. One hundred and seventy-two caregivers (69.2% women), mean age 57.51 years (range: 21-89) participated. Demographic and clinical data, standardized measures (ECI, suffering scale of SCL-90-R, Zarit burden scale) were used. The two scales of negative evaluation of the ECI most related to serious mental disorders (disruptive behaviours [DB] and negative symptoms [NS]) and the two scales of positive appreciation (positive personal experiences [PPE], and good aspects of the relationship [GAR]) were analyzed. Exploratory structural equation modelling was used to analyze the internal structure. The relationship between the ECI scales and the SCL-90-R and Zarit scores was also studied. The four-factor model presented a good fit. Cronbach's alpha (DB: 0.873; NS: 0.825; PPE: 0.720; GAR: 0.578) showed a higher homogeneity in the negative scales. The SCL-90-R scores correlated with the negative ECI scales, and none of the ECI scales correlated with the Zarit scale. The Spanish version of the ECI can be considered a valid, reliable, understandable and feasible self-report measure for its administration in the health and community context. Copyright © 2018 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Bhumika.T.V.
2014-01-01
Full Text Available Background Welders have been identified as a high risk group according to ranking of occupations based on cost related injuries. Employment of safety measures and practices among welders are potential ways of preventing occupational injuries. Adherence to these precautions is nearly universal in the developed world but there is scarcity of information about the situation in developing world including India. Objectives 1 To estimate the prevalence of occupational injuries among welding workers in Udupi district; 2 To assess the perception towards occupational hazards and the safety measures adopted by the welders Material and Methods A cross- sectional study was conducted among 160 non- industrial welding workers in Udupi district. A pre-structured interviewer-administered questionnaire was used. Results The prevalence of occupational injuries was found to be 80%. Only 24.4% of the welders had undergone professional training. Though 95% of them were aware of the importance of personal protective equipments (PPE, only 37.5% of them were regularly using PPE. Majority (75% of them reported that welding profession was dangerous. Around 79% of the workers reported carelessness being the major cause of injury during work. Working hours of less than 8 hours in a day, reading of safety manual and maintenance of equipments were significantly positively associated with occupational injuries among welding workers. Conclusion Occupational injuries during welding are preventable. The level of experience, training and attitude while working can reduce the injuries to large extent.
Dukic, Kristina; Zoric, Matea; Pozaic, Petra; Starcic, Jelena; Culjak, Marija; Saracevic, Andrea; Miler, Marijana
2015-01-01
This pilot study aimed to investigate the use of personal protective equipment (PPE) and compliance to the code of conduct (rules defined in institutional, governmental and professional guidelines) among laboratory technicians in Croatian medical laboratories. In addition, we explored the differences in compliance between participants of different age groups, laboratory ownership and accreditation status. An anonymous and voluntary survey with 15 questions was conducted among Croatian medical laboratory technicians (N=217). The questions were divided into two groups: demographic characteristics and the use of PPE. The questions of the second part were graded according to the Likert scale (1-4) and an overall score, shown as median and range (min-max), was calculated for each participant. Differences between the overall scores were tested for each group of participants. The majority of participants always wear protective clothes at work, 38.7% of them always wear gloves in daily routine, more than 30.0% consume food and almost half of them drink beverages at workplace. A significantly lower overall score was found for participants working in public compared to private laboratories (36 (16-40) vs. 40 (31-40), Plaboratory accreditation status (P=0.081). A considerable percentage of laboratory technicians in Croatian medical laboratories do not comply with safety measures. Lack of compliance is observed in all personnel regardless laboratory accreditation and participants' age. However, those working in private laboratories adhere more to the code of conduct.
WASH activities at two Ebola treatment units in Sierra Leone.
Directory of Open Access Journals (Sweden)
Michaela Mallow
Full Text Available The 2014 outbreak of Ebola virus disease (EVD in West Africa was the largest in history. Starting in September 2014, International Medical Corps (IMC operated five Ebola treatment units (ETUs in Sierra Leone and Liberia. This paper explores how future infectious disease outbreak facilities in resource-limited settings can be planned, organized, and managed by analyzing data collected on water, sanitation, and hygiene (WASH and infection prevention control (IPC protocols.We conducted a retrospective cohort study by analyzing WASH/IPC activity data routinely recorded on paper forms or white boards at ETUs during the outbreak and later merged into a database from two IMC-run ETUs in Sierra Leone between December 2014 and December 2015.The IMC WASH/IPC database contains data from over 369 days. Our results highlight parameters key to designing and maintaining an ETU. High concentration chlorine solution usage was highly correlated with both daily patient occupancy and high-risk zone staff entries; low concentration chlorine usage was less well explained by these measures. There is high demand for laundering and disinfecting of personal protective equipment (PPE on a daily basis and approximately 1 (0-4 piece of PPE is damaged each day.Lack of standardization in the type and format of data collected at ETUs made constructing the WASH/IPC database difficult. However, the data presented here may help inform humanitarian response operations in future epidemics.
Parapneumonic pleural effusion: reality and strategies in an Amazon university hospital
Directory of Open Access Journals (Sweden)
CLAUDIA GISELLE SANTOS ARÊAS
Full Text Available ABSTRACT Objective: to define the profile and analyze the postoperative evolution of children with parapneumonic pleural effusion (PPE, and to evaluate strategies used in the presence of diagnostic and therapeutic limitations, emphasizing the open thoracic drainage (OTD . Methods: we conducted a cross-sectional, prospective, analytical study in which we followed children admitted in an Amazon university hospital with surgically addressed PPE, from October 2010 to October 2011. Results: we studied 46 patients, most children under three years of age (74%, with no gender predominance. A significant portion of the sample (28% had inappropriate body mass index. We found short stature in five patients (11%, which tended, in general, to a worst postoperative outcome when compared with children of normal height (p=0.039. The average duration of symptoms till admission was 16.9 days. Empyema was a common diagnosis in the first surgery (47.8%, and its bearers had longer duration of chest tube drainage (p=0.015. Most children (80.4% were operated only once. The mean length of hospital stay was 25.9 days. Thoracic drainage (water-sealed was the most common procedure (85%, with conversion to OTD in 24% of the sample, thoracotomy being rare (4%. There were no deaths. Conclusion: the studied individuals often had advanced disease and nutritional disorders, affecting outcome. OTD remains a valid option for specific situations, and further studies are needed for confirmation.
Stefanati, Armando; Boschetto, Piera; Previato, Sara; Kuhdari, Parvanè; De Paris, Paola; Nardini, Marco; Gabutti, Giovanni
2015-05-04
Biological risk is the main occupational hazard in hospitals (40-50% of the total). More than 130,000 injuries occur every year in Italy and nurses are the most affected occupational category. This study evaluated the incidence of injuries related to biological risk in nurses and nursing students in the University Hospital of Ferrara, how they occur, the knowledge on the topic and on behaviour during the department's activity. A retrospective study involving a sample of 8 departments (selected for the occurrence of more than 30 biological injuries between 1st January 2002 and 31 December 2012) recorded injuries related to biological risk; subsequently a cross-sectional survey was carried out through a questionnaire administered to nurses and nursing students. 909 biological accidents were reported (81.18% in nurses and 18.82% in students). Blood was the main biological material involved (83.72% of cases), mostly by percutaneous exposure (84.16%). According to the questionnaire, 53% of subjects reported having had at least one injury during their career, and 5.72% did not report it; 46% reported doing risky procedures (re-capping needles) and 95.45% that they had been informed about the correct use of PPE. The lower percentage of injuries in students could be linked to good university training and to less risky procedures being performed. Re-capping needles remains one of the most dangerous manoeuvers practised. Ongoing training on the correct use of PPE is essential to train prepared and aware health professionals.
Studying Disabling Occupational Accidents in the Construction Industry During Two Years
Directory of Open Access Journals (Sweden)
Ahmad Soltanzadeh
2014-06-01
Full Text Available Background & Objectives : Idnetifying causes of occupational accidents is a key issue to prevent these accidents. The present study aimed to identify and analyze debilitating accidents in the construction industry during a two-year period ( 2010 - 2011 years . Methods: This was an analytical cross-sectional study. The study data included information about all debilitating accidents occurred within two years. Data collection was performed according to the accident report forms in construction sites. Data analysis was performed using SPSS software version 16. The level of significance was considered as P=0.05. Results: The mean age and job experience of injured people were 27.95±6.95 and 2.34±2.00 years, respectively. Most injuries to people were reported in hand (35.4%, legs (28.3% and back (20.4%. Most of accident types were respectively related to slipping and falling (26.1%, throwing objects (21.7%, falls (18.6%, abrasion (16.8% and clash (16.4%. Moreover, the main causes of accidents were related to lack of housekeeping (97.3%, lack of proper training (85.8%, lack of PPE (73.0%, unsafe acts (63.3%, unsafe conditions (32.3% and equipment (22.6%. Conclusion: Analyzing causes of disabling accidents in the construction industry showed that important factors in these accidents included lack of housekeeping, failure to provide proper training, lack of suitable PPE, unsafe acts, unsafe conditions and equipment for the construction jobs
Directory of Open Access Journals (Sweden)
Puspa Dila Rohmaniar
2017-03-01
Full Text Available Background: Exposure of metals among dental technicians that come from the working environment can lead to the formation reactive oxygen species (ROS. ROS can cause mutations in the p53 gene (p53. The mutation is transversion mutation GuanineThymine. p53 mutations can lead to low expression of the wild-type p53 protein (p53. Wild-type p53 involved in many biological processes such as regulation of genes involved in cell cycle, cell growth after DNA damage, and apoptosis. However, exposure to metals among dental technicians can be prevented through the use of personal protective equipment (PPE during work. Purpose: The purpose of this study was to analyze the correlation between the use of personal protective equipment to wild-type p53 protein levels among dental technicians in Surabaya. Method: This study was observational analytic with cross sectional approach. 40 samples were taken by random sampling. Data were retrieved through interviews and observations. Wild-type p53 was analyzed from saliva with indirect ELISA method. Analysis of data used Kolmogorov Smirnov normality test and a Pearson correlation test. Value significance was p<0.05 (95% confidence level. Result: There was a significant association between the use of personal protective equipment with wild-type p53 levels with p=0.002 Conclusion: The use PPE properly is positively correlated with the wild-type p53 protein levels of dental technicians in Surabaya.
Health related quality of life and influencing factors among welders.
Directory of Open Access Journals (Sweden)
Jingxiang Qin
Full Text Available BACKGROUND: Occupational exposure to welding fumes is a serious occupational health problem all over the world. Welders are exposed to many occupational hazards; these hazards might cause some occupational diseases. The aim of the study was to assess the health related quality of life (HRQL of electric welders in Shanghai China and explore influencing factors to HRQL of welders. METHODS: 301 male welders (without pneumoconiosis and 305 non-dust male workers in Shanghai were enrolled in this study. Short Form-36 (SF-36 health survey questionnaires were applied in this cross-sectional study. Socio-demographic, working and health factors were also collected. Multiple stepwise regress analysis was used to identify significant factors related to the eight dimension scores. RESULTS: Six dimensions including role-physical (RP, bodily pain (BP, general health (GH, validity (VT, social function (SF, and mental health (MH were significantly worse in welders compared to non-dust workers. Multiple stepwise regress analysis results show that native place, monthly income, quantity of children, drinking, sleep time, welding type, use of personal protective equipment (PPE, great events in life, and some symptoms including dizziness, discomfort of cervical vertebra, low back pain, cough and insomnia may be influencing factors for HRQL of welders. Among these factors, only sleep time and the use of PPE were salutary. CONCLUSIONS: Some dimensions of HRQL of these welders have been affected. Enterprises which employ welders should take measures to protect the health of these people and improve their HRQL.
Potential biodefense model applications for portable chlorine dioxide gas production.
Stubblefield, Jeannie M; Newsome, Anthony L
2015-01-01
Development of decontamination methods and strategies to address potential infectious disease outbreaks and bioterrorism events are pertinent to this nation's biodefense strategies and general biosecurity. Chlorine dioxide (ClO2) gas has a history of use as a decontamination agent in response to an act of bioterrorism. However, the more widespread use of ClO2 gas to meet current and unforeseen decontamination needs has been hampered because the gas is too unstable for shipment and must be prepared at the application site. Newer technology allows for easy, onsite gas generation without the need for dedicated equipment, electricity, water, or personnel with advanced training. In a laboratory model system, 2 unique applications (personal protective equipment [PPE] and animal skin) were investigated in the context of potential development of decontamination protocols. Such protocols could serve to reduce human exposure to bacteria in a decontamination response effort. Chlorine dioxide gas was capable of reducing (2-7 logs of vegetative and spore-forming bacteria), and in some instances eliminating, culturable bacteria from difficult to clean areas on PPE facepieces. The gas was effective in eliminating naturally occurring bacteria on animal skin and also on skin inoculated with Bacillus spores. The culturable bacteria, including Bacillus spores, were eliminated in a time- and dose-dependent manner. Results of these studies suggested portable, easily used ClO2 gas generation systems have excellent potential for protocol development to contribute to biodefense strategies and decontamination responses to infectious disease outbreaks or other biothreat events.
Directory of Open Access Journals (Sweden)
Bhumika.T.V.
2014-09-01
Full Text Available Background Welders have been identified as a high risk group according to ranking of occupations based on cost related injuries. Employment of safety measures and practices among welders are potential ways of preventing occupational injuries. Adherence to these precautions is nearly universal in the developed world but there is scarcity of information about the situation in developing world including India. Objectives 1 To estimate the prevalence of occupational injuries among welding workers in Udupi district; 2 To assess the perception towards occupational hazards and the safety measures adopted by the welders Material and Methods A cross--‐ sectional study was conducted among 160 non--‐ industrial welding workers in Udupi district. A pre--‐structured interviewer--‐administered questionnaire was used. Results The prevalence of occupational injuries was found to be 80%. Only 24.4% of the welders had undergone professional training. Though 95% of them were aware of the importance of personal protective equipments (PPE, only 37.5% of them were regularly using PPE. Majority (75% of them reported that welding profession was dangerous. Around 79% of the workers reported carelessness being the major cause of injury during work. Working hours of less than 8 hours in a day, reading of safety manual and maintenance of equipments were significantly positively associated with occupational injuries among welding workers. Conclusion Occupational injuries during welding are preventable. The level of experience, training and attitude while working can reduce the injuries to large extent.
Directory of Open Access Journals (Sweden)
Joseph T. Costello
2015-01-01
Full Text Available This study evaluated the physiological tolerance times when wearing explosive and chemical (>35 kg personal protective equipment (PPE in simulated environmental extremes across a range of differing work intensities. Twelve healthy males undertook nine trials which involved walking on a treadmill at 2.5, 4, and 5.5 km·h−1 in the following environmental conditions, 21, 30, and 37°C wet bulb globe temperature (WBGT. Participants exercised for 60 min or until volitional fatigue, core temperature reached 39°C, or heart rate exceeded 90% of maximum. Tolerance time, core temperature, skin temperature, mean body temperature, heart rate, and body mass loss were measured. Exercise time was reduced in the higher WBGT environments (WBGT37 < WBGT30 < WBGT21; P < 0.05 and work intensities (5.5 < 4 < 2.5 km·h−1; P < 0.001. The majority of trials (85/108; 78.7% were terminated due to participant’s heart rate exceeding 90% of their maximum. A total of eight trials (7.4% lasted the full duration. Only nine (8.3% trials were terminated due to volitional fatigue and six (5.6% due to core temperatures in excess of 39°C. These results demonstrate that physiological tolerance times are influenced by the external environment and workload and that cardiovascular strain is the limiting factor to work tolerance when wearing this heavy multilayered PPE.
The effect of sport on computerized electrocardiogram measurements in college athletes.
Gademan, Maaike G J; Uberoi, Abhimanyu; Le, Vy-Van; Mandic, Sandra; van Oort, Eddy R; Myers, Jonathan; Froelicher, Victor F
2012-02-01
Broad criteria for abnormal electrocardiogram (ECG) findings, requiring additional testing, have been recommended for preparticipation exams (PPE) of athletes. As these criteria have not considered the sport in which athletes participate, we examined the effect of sports on the computerized ECG measurements obtained in college athletes. During the Stanford 2007 PPE, computerized 12-lead ECGs (Schiller AG) were obtained in 641 athletes (350 male/291 female, age 19.5 ± 2 years). Athletes were engaged in 22 different sports and were grouped into 16 categories: baseball/softball, basketball, crew, crosscountry, fencing, field events, football linemen, football other positions, golf, gymnastics, racquet sports, sailing, track/field, volleyball, water sports, and wrestling. The analysis focused on ECG leads V2, aVF and V5 which provide a three-dimensional representation of the heart's electrical activity. As marked ECG differences exist between males and females, the data are presented by gender. In males, ANOVA analysis yielded significant ECG differences between sports for heart rate, QRS duration, QTc, J-amplitude in V2 and V5, spatial vector length (SVL) of the P wave, SVL R wave, and SVL T wave, and RS(sum) (p sports were found for heart rate, QRS duration, QRS axis and SVL T wave (p sports, and these differences were more apparent in males than females. Therefore, sport-specific ECG criteria for abnormal ECG findings should be developed to obtain a more useful approach to ECG screening in athletes.
Effect of gender on computerized electrocardiogram measurements in college athletes.
Mandic, Sandra; Fonda, Holly; Dewey, Frederick; Le, Vy-van; Stein, Ricardo; Wheeler, Matt; Ashley, Euan A; Myers, Jonathan; Froelicher, Victor F
2010-06-01
Broad criteria for classifying an electrocardiogram (ECG) as abnormal and requiring additional testing prior to participating in competitive athletics have been recommended for the preparticipation examination (PPE) of athletes. Because these criteria have not considered gender differences, we examined the effect of gender on the computerized ECG measurements obtained on Stanford student athletes. Currently available computer programs require a basis for "normal" in athletes of both genders to provide reliable interpretation. During the 2007 PPE, computerized ECGs were recorded and analyzed on 658 athletes (54% male; mean age, 19 +/- 1 years) representing 22 sports. Electrocardiogram measurements included intervals and durations in all 12 leads to calculate 12-lead voltage sums, QRS amplitude and QRS area, spatial vector length (SVL), and the sum of the R wave in V5 and S wave in V2 (RSsum). By computer analysis, male athletes had significantly greater QRS duration, PR interval, Q-wave duration, J-point amplitude, and T-wave amplitude, and shorter QTc interval compared with female athletes (all P < 0.05). All ECG indicators of left ventricular electrical activity were significantly greater in males. Although gender was consistently associated with indices of atrial and ventricular electrical activity in multivariable analysis, ECG measurements correlated poorly with body dimensions. Significant gender differences exist in ECG measurements of college athletes that are not explained by differences in body size. Our tables of "normal" computerized gender-specific measurements can facilitate the development of automated ECG interpretation for screening young athletes.
Wang, Jin; Zhang, Cao; Katz, Joseph
2016-11-01
A PIV based method to reconstruct the volumetric pressure field by direct integration of the 3D material acceleration directions has been developed. Extending the 2D virtual-boundary omni-directional method (Omni2D, Liu & Katz, 2013), the new 3D parallel-line omni-directional method (Omni3D) integrates the material acceleration along parallel lines aligned in multiple directions. Their angles are set by a spherical virtual grid. The integration is parallelized on a Tesla K40c GPU, which reduced the computing time from three hours to one minute for a single realization. To validate its performance, this method is utilized to calculate the 3D pressure fields in isotropic turbulence and channel flow using the JHU DNS Databases (http://turbulence.pha.jhu.edu). Both integration of the DNS acceleration as well as acceleration from synthetic 3D particles are tested. Results are compared to other method, e.g. solution to the Pressure Poisson Equation (e.g. PPE, Ghaemi et al., 2012) with Bernoulli based Dirichlet boundary conditions, and the Omni2D method. The error in Omni3D prediction is uniformly low, and its sensitivity to acceleration errors is local. It agrees with the PPE/Bernoulli prediction away from the Dirichlet boundary. The Omni3D method is also applied to experimental data obtained using tomographic PIV, and results are correlated with deformation of a compliant wall. ONR.
Directory of Open Access Journals (Sweden)
Marlen Arnold
2009-08-01
Full Text Available Für erfolgreiche und nachhaltige Produktentwicklung reichen heute Marktbeobachtung und Kund/innenbefragungen alleine nicht mehr aus. Mit Verfahren zur partizipativen Produktentwicklung (PPE können sowohl das kreative Potenzial von Nutzer/innen für die Produktentwicklung erschlossen als auch marktfähige nachhaltige Produkte entwickelt werden. Sie ermöglichen so aktives Nachhaltigkeitsmanagement. Am Beispiel des INNOCOPE-Pilotverfahrens wird diskutiert, wie nachhaltigkeitsbezogene Lernprozesse in PPE-Prozessen initiiert werden können und welche Faktoren dabei wesentlich sind. Insgesamt zeigt sich, dass vor allem die sich wiederholende, direkte und möglichst gleichberechtigte Interaktion von Unternehmensvertreter/innen und von Konsument/innen einen themenbezogenen Wissensaustausch und wechselseitige Lernprozesse ermöglicht. Dabei sind der inhaltliche Aufbau der Treffen und der zeitlich gestaffelte Einsatz von Lernmethoden wesentlich.Today, market observation and customer surveys alone do not suffice to develop successful and sustainable products. Methods of participatory product development (PPD allow to open up the creative potential of users for product development, and to develop marketable sustainable products. Thereby, they support active sustainability management. Taking the INNOCOPE pilot process as an example, we discuss the possibilities and the relevant factors to initiate sustainability- and climate-related learning processes within PPD processes. Our findings indicate that repeated, direct and equitable interaction between company representatives and customers are fundamental for relevant knowledge exchange and mutual learning processes. Other key issues are the thematic structure of the meetings and the timing of learning methods.
Apostolico, Alexsandra A; Shendell, Derek G
2016-02-16
Injuries involving career-technical-vocational education (CTE) are reported to the New Jersey Safe Schools Program online reporting system, the only U.S. State law-based surveillance data for young workers (ages twenty-one and younger), a susceptible, vulnerable adolescent sub-population. We examined potential associations between socioeconomic status (SES) indicators and high school student injuries reported between 12/1998-12/2013, excluding injuries acquired by staff members. Associations between DFG score-a proxy for school/district SES-and variables relating to reported injuries, including severity, injury type, injury cause, body parts injured, injury treatment setting and demographics were examined with chi square test (X(2)) for independence and logistic regression. To assess potential associations between SES and personal protective equipment (PPE), data were stratified by 2003-2008 and 2008-2013, given mandated payment by employers of PPE for employees. Statistically significant associations were found between SES and injury cause [X(2) = (7, 14.74), p = 0.04] and SES and injury treatment setting [X(2) = (1, 4.76), p = 0.03]. Adjusted odds ratio suggested students from low SES schools were at a higher odds of being treated at a hospital emergency department (ED) than students from high SES schools (95 % CI 1.3-4.3, p workers and their families. With small sample sizes representing lower DFG scoring (SES) schools/districts, additional efforts should be enacted to increase injury reporting in these schools/districts.
Identification of potential hazards associated with new residential construction.
Methner, M M
2000-02-01
There were several advantages and limitations of this observational study. The most important advantage of this study was the opportunity to observe residential construction workers performing their jobs. By observing work practices, valuable information was gathered about specific trades and their potential exposure to various chemical and physical agents. This information will be useful in guiding subsequent exposure assessments. Probably the greatest limitation of this study was the lack of participation by homebuilders. Ideally, observations of construction processes would have been more objective if the study included the participation of more than one homebuilder. Aside from one worker who was observed to wear safety glasses, leather gloves, and a dust mask, virtually no personal protective equipment (PPE) was observed onsite. Often small contractors do not have the financial resources necessary to procure the appropriate PPE and issue these items to the workers. Based on hazard prevalence, professional judgement, and the degree of hazardous product use, potential exposures that warrant quantitative sampling efforts during Phase 2 of this study are: bulldozer/backhoe operators--noise, vibration, diesel exhaust; concrete workers--naphtha, mineral spirits, Portland cement; asphalt workers--petroleum hydrocarbons, asphalt, mineral spirits; plumbers--methylethyl ketone, acetone, tetrahydrofuran, cyclohexanone; drywall finishers--total and respirable dust, hexane, acetone; painters--ethylene glycol, VOCs; masons--dust (during the preparation of mortar); floor preparation technicians--total and respirable dust; and ceramic tile installers--toluene, naphtha, silica (from grout powder).
DEFF Research Database (Denmark)
Lundsgaard, Rasmus; Kontogeorgis, Georgios; Economou, Ioannis G.
2011-01-01
coefficient can be estimated for both a small hydrophilic and a hydrophobic organic molecules between squalane (used here to mimic low density poly ethylene) and water/ethanol solutes using thermodynamic integration to calculate the free energy of solvation. Molecular dynamics simulations are performed, using...... the GROMACS software, by slowly decoupling of firstly the electrostatic and then the Lennard–Jones interactions between molecules in the simulation box. These calculations depend very much on the choice of force field. Two force fields have been tested in this work, the TraPPE-UA (united-atom) and the OPLS...
A gender-based analysis of high school athletes using computerized electrocardiogram measurements.
Directory of Open Access Journals (Sweden)
Nikhil Kumar
Full Text Available BACKGROUND: The addition of the ECG to the preparticipation examination (PPE of high school athletes has been a topic for debate. Defining the difference between the high school male and female ECG is crucial to help initiate its implementation in the High School PPE. Establishing the different parameters set for the male and female ECG would help to reduce false positives. We examined the effect of gender on the high school athlete ECG by obtaining and analyzing ECG measurements of high school athletes from Henry M. Gunn High School. METHODS: In 2011 and 2012, computerized Electrocardiograms were recorded and analyzed on 181 athletes (52.5% male; mean age 16.1 ± 1.1 years who participated in 17 different sports. ECG statistics included intervals and durations in all 3 axes (X, Y, Z to calculate 12 lead voltage sums, QRS Amplitude, QT interval, QRS Duration, and the sum of the R wave in V5 and the S Wave in V2 (RS Sum. RESULTS: By computer analysis, we demonstrated that male athletes had significantly greater QRS duration, Q-wave duration, and T wave amplitude. (P<0.05. By contrast, female athletes had a significantly greater QTc interval. (P<0.05. CONCLUSION: The differences in ECG measurements in high school athletes are strongly associated with gender. However, body size does not correlate with the aforementioned ECG measurements. Our tables of the gender-specific parameters can help facilitate the development of a more large scale and in-depth ECG analysis for screening high school athletes in the future.
Training of occupational safety and health: knowledge among healthcare professionals in Malaysia.
Lugah, V; Ganesh, B; Darus, A; Retneswari, M; Rosnawati, M R; Sujatha, D
2010-07-01
Awareness of occupational safety and health (OSH) plays an important role in the prevention of occupational injuries and diseases. Following the enactment of the Occupational Safety and Health Act (OSHA) in 1994, various programmes have been implemented by different agencies to increase awareness and knowledge of OSH in the workplace, including among healthcare workers. The objective of this study was to determine the level of OSH awareness and knowledge among healthcare professionals in Malaysia. A cross-sectional study was conducted using a 21-item self-administered questionnaire addressing information on demographics, general OSH issues, OSH legislations, occupational hazards in the healthcare setting and personal protective equipment (PPE). The response rate was 93.1 percent (284 healthcare professionals). The overall level of knowledge on OSH was moderate, with a mean score of 62.0 percent. A larger proportion of doctors showed good OSH knowledge compared to other categories of healthcare workers, with administrative staff scoring the poorest marks. Participants were most knowledgeable about PPE, with a mean score of 72.0 percent (95 percent confidence interval [CI] 68.3, 75.6), compared to other sections such as general OSH, legislations and occupational hazards, with mean scores of 58.0 percent (95 percent CI 56.1, 60.1), 57.0 percent (95 percent CI 54.1, 60.8) and 64.0 percent (95 percent CI 61.7, 66.2), respectively. Although the OSHA 1994 has existed in Malaysia for more than ten years, awareness of OSH remains relatively poor. This warrants a greater effort to promote OSH knowledge and principles among the professionals.
Radiation effects-prevalence of contributory risk factors a pilot study in Visakhapthnam steel plant
International Nuclear Information System (INIS)
Lakshman rao, K. V.
2004-01-01
Integrated Steel Plants contribute significant air pollution, water pollution and solid waste generation. Diverse occupational health hazards present is steel industry pose ill effects to the industrial workers. Occupational health services and research center (OHS and RC) of this plant established in the year 1992 to protect the health and well-being of all the employees working in different occupations. the primary role OHS and RC is to conduct periodical medical examinations, monitoring of the working environments, suggest the suitable personal protective equipment to the workers, evaluate risk factors, work practices, risk management and industrial toxicological studies. Dissemination of information related to occupational health and safety to the working population through regular educational sessions at the workplaces as at training and development center (T and DC) is also part of our services. The proneness for effects of exposure to ionizing radiation is enhanced by various factors related to the family history of chronic diseases, nutritional status of the individuals, the lifestyle factors apart from psycho-social factors like illiteracy, ignorance, negligence and inadequate utilization of personal protective equipment (PPE) at workplace. To evaluate the prevalence of such contributory risk factors, a pilot study has been conducted in Visakhapatnam Steel Plant. The data is obtained through routine periodical medical examination of workers at the Occupational Health Services Center through standard format. The study revealed statistically high prevalence of the risk factors and indicated the necessity of intensifying primary prevention methods in addition to environmental control and usage of PPE. (Author)
Directory of Open Access Journals (Sweden)
Taylor D. Canady
2011-07-01
Full Text Available The interactions of poly(phenylene ethynylene (PPE-based cationic conjugated polyelectrolytes (CPEs and oligo-phenylene ethynylenes (OPEs with E. coli cells are investigated to gain insights into the differences in the dark killing mechanisms between CPEs and OPEs. A laboratory strain of E. coli with antibiotic resistance is included in this work to study the influence of antibiotic resistance on the antimicrobial activity of the CPEs and OPEs. In agreement with our previous findings, these compounds can efficiently perturb the bacterial cell wall and cytoplasmic membrane, resulting in bacterial cell death. Electron microscopy imaging and cytoplasmic membrane permeability assays reveal that the oligomeric OPEs penetrate the bacterial outer membrane and interact efficiently with the bacterial cytoplasmic membrane. In contrast, the polymeric CPEs cause serious damage to the cell surface. In addition, the minimum inhibitory concentration (MIC and hemolytic concentration (HC of the CPEs and OPEs are also measured to compare their antimicrobial activities against two different strains of E. coli with the compounds’ toxicity levels against human red blood cells (RBC. MIC and HC measurements are in good agreement with our previous model membrane perturbation study, which reveals that the different membrane perturbation abilities of the CPEs and OPEs are in part responsible for their selectivity towards bacteria compared to mammalian cells. Our study gives insight to several structural features of the PPE-based CPEs and OPEs that modulate their antimicrobial properties and that these features can serve as a basis for further tuning their structures to optimize antimicrobial properties.
Directory of Open Access Journals (Sweden)
Martin Carlsen
Full Text Available Knowledge-based potentials are energy functions derived from the analysis of databases of protein structures and sequences. They can be divided into two classes. Potentials from the first class are based on a direct conversion of the distributions of some geometric properties observed in native protein structures into energy values, while potentials from the second class are trained to mimic quantitatively the geometric differences between incorrectly folded models and native structures. In this paper, we focus on the relationship between energy and geometry when training the second class of knowledge-based potentials. We assume that the difference in energy between a decoy structure and the corresponding native structure is linearly related to the distance between the two structures. We trained two distance-based knowledge-based potentials accordingly, one based on all inter-residue distances (PPD, while the other had the set of all distances filtered to reflect consistency in an ensemble of decoys (PPE. We tested four types of metric to characterize the distance between the decoy and the native structure, two based on extrinsic geometry (RMSD and GTD-TS*, and two based on intrinsic geometry (Q* and MT. The corresponding eight potentials were tested on a large collection of decoy sets. We found that it is usually better to train a potential using an intrinsic distance measure. We also found that PPE outperforms PPD, emphasizing the benefits of capturing consistent information in an ensemble. The relevance of these results for the design of knowledge-based potentials is discussed.
Oesterlund, Anna H; Thomsen, Jane F; Sekimpi, Deogratias K; Maziina, James; Racheal, Apio; Jørs, Erik
2014-06-01
Over the past years there has been an increase in the use of pesticides in developing countries. This study describes pesticide use among small-scale farmers in Uganda and analyses predictors of pesticide poisoning (intoxication) symptoms. A cross-sectional study was conducted using a standardized questionnaire. Some 317 small-scale farmers in two districts in Uganda were interviewed about pesticide use, knowledge and attitude, symptoms of intoxication, personal protective equipment (PPE) and hygiene. The risk of reporting symptoms was analysed using logistic regression analysis. The most frequently used pesticides belonged to WHO class II. The farmers had poor knowledge about pesticide toxicity, and the majority did not use appropriate PPE nor good hygiene when handling pesticides. There was no significant association between the number of times of spraying with pesticides and self-reported symptoms of pesticide poisoning. The only significant association was between blowing and sucking the nozzle of the knapsack sprayer and self-reported symptoms of pesticide intoxication (OR: 2.13. 95% CI: 1.09 - 4.18). Unlike the practice in several other developing countries, small-scale farmers in Uganda do not use the most hazardous pesticides (WHO class 1a and 1b). However use of WHO class II pesticides and those of lower toxicity is seen in combination with inadequate knowledge and practice among the farmers. This poses a danger of acute intoxications, chronic health problems and environmental pollution. Training of farmers in Integrated Pest Management (IPM) methods, use of proper hygiene and personal protective equipment when handling pesticides should be promoted.
Automobile Accidents Attended by Mobile Emergency Care Service
Directory of Open Access Journals (Sweden)
Ana Virgínia Gomes Barros
2017-05-01
Full Text Available Background: Automobile accidents are increasing every day and are becoming a serious public health problem due to the high morbidity and mortality rate. The goal of the current study was to characterise the traffic accidents attended by the Mobile Emergency Care Service (MECS in Ibiara, PB. Methods: This exploratory, descriptive, documentary study adopted a quantitative approach and analysis of data. The population consisted of all victims of traffic accidents attended by MECS in the city of Ibiara, PB, from June 2015 to June 2016. The following variables were studied: age, gender, time and day of the week the accident occurred, nature of the incident, substance ingested by the victim, wearing personal protective equipment (PPE or not, the anatomical lesions on the victim and the body regions hit during the accident. Results: The sample consisted of 49 accident victims, and the majority (81.6% were male, predominately 30 to 59 years. Events occurring at night (63.3% and during the week (65.3% predominated. The most frequent type of accident was motorcycle fall (71.4%, with almost half having consumed alcohol (46.9% and most not wearing PPE (77.6%. The regions of the body most affected were the lower limbs (67.3% and upper limbs (53.1%. Conclusion: The main factor/cause of these accidents was due to imprudence and violation of traffic laws, highlighting the need to invest in traffic education policies, to direct campaigns for the prevention of traffic accidents, as well as expand the surveillance of traffic laws by authorities.
International Nuclear Information System (INIS)
Dolez, Patricia; Vinches, Ludwig; Vu-Khanh, Toan; Wilkinson, Kevin; Plamondon, Philippe
2011-01-01
Nanoparticle manufacture and use are in full expansion. The associated risks of occupational exposure raise large concerns due to their potential toxicity. Even if they stand as a last resort in the traditional occupational Health and Safety (H and S) risk management strategy, personal protective equipment (PPE) against nanoparticles are an absolute need in the context of precautionary principle advocated by H and S organizations worldwide. However no standard test method is currently available for evaluating the efficiency of PPE against nanoparticles, in particular in the case of gloves. A project is thus underway to develop a test method for measuring nanoparticle penetration through protective gloves in conditions simulating glove-nanoparticle occupational interaction. The test setup includes an exposure and a sampling chamber separated by a circular glove sample. A system of cylinders is used to deform the sample while it is exposed to nanoparticles. The whole system is enclosed in a glove box to ensure the operator safety during assembly, dismounting and clean-up operations as well as during the tests. Appropriate nanoparticle detection techniques were also identified. Results are reported here for commercial 15nm TiO2 nanoparticles - powder and colloidal solutions in 1,2-propanediol, ethylene glycol and water - and four types of protective gloves: disposable nitrile and latex as well as unsupported neoprene and butyl rubber gloves. They show that mechanical deformations and contact with colloidal solution liquid carriers may affect glove materials. Preliminary results obtained with TiO2 powder indicate a possible penetration of nanoparticles through gloves following mechanical deformations.
Energy Technology Data Exchange (ETDEWEB)
Egbe, Daniel A.M.; Adam, Getachew; Pivrikas, Almantas; Ulbricht, Christoph; Ramil, Alberto M.; Sariciftci, Niyazi Serdar [Johannes Kepler Univ., Linz (AT). Linz Inst. for Organic Solar Cells (LIOS); Hoppe, Harald [Technische Univ. Ilmenau (Germany). Inst. of Physics and Inst. of Micro- and Nanotechnologies; Rathgeber, Silke [Mainz Univ. (Germany). Inst. of Physics
2010-07-01
The random distribution of segments of linear octyloxy side chains and of branched 2-ethylhexyloxy side chains, on the backbone of anthracene containing poly(p-phenylene-ethynylene)-alt-poly(p-phenylene-vinylene) (PPE-PPV) has resulted in a side chain based statistical copolymer, denoted AnE-PVstat, showing optimized features as compared to the well defined homologues AnE-PVaa, -ab, -ba and -bb, whose constitutional units are incorporated into its backbone. WAXS studies on AnE-P's demonstrate the highest degree of order at the self-assembly state of AnE-PVstat, which is confirmed by its highly structured thin film absorption band. Electric field independent charge carrier mobility ({mu}{sub hole}) for AnE-PVstat was demonstrated by CELIV and OFET measurements, both methods resulting in similar {mu}{sub hole} values of up to 5.43 x 10{sup -4} cm{sup 2}/Vs. Upon comparison, our results show that charge carrier mobility as measured by CELIV technique is predominantly an intrachain process and less an interchain one, which is in line with past photoconductivity results from PPE-PPV based materials. The present side chain distribution favors efficient solar cell active layer phase separation. As a result, a smaller amount of PC{sub 60}BM is needed to achieve relatively high energy conversion efficiencies above 3 %. The efficiency of {eta}{sub AM1.5} {approx} 3.8 % obtained for AnE-PVstat:PC{sub 60}BM blend is presently the state-of-art value for PPV-based materials. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Dolez, Patricia; Vinches, Ludwig; Vu-Khanh, Toan [Ecole de technologie superieure, 1100 rue Notre-Dame Ouest, Montreal QC H3C 1K3 (Canada); Wilkinson, Kevin [Universite de Montreal, C.P. 6128, succ. Centre-ville Montreal QC H3C 3J7 (Canada); Plamondon, Philippe, E-mail: patricia.dolez@etsmtl.ca [Ecole polytechnique, C.P. 6079, succ. Centre-ville, Montreal QC H3C 3A7 (Canada)
2011-07-06
Nanoparticle manufacture and use are in full expansion. The associated risks of occupational exposure raise large concerns due to their potential toxicity. Even if they stand as a last resort in the traditional occupational Health and Safety (H and S) risk management strategy, personal protective equipment (PPE) against nanoparticles are an absolute need in the context of precautionary principle advocated by H and S organizations worldwide. However no standard test method is currently available for evaluating the efficiency of PPE against nanoparticles, in particular in the case of gloves. A project is thus underway to develop a test method for measuring nanoparticle penetration through protective gloves in conditions simulating glove-nanoparticle occupational interaction. The test setup includes an exposure and a sampling chamber separated by a circular glove sample. A system of cylinders is used to deform the sample while it is exposed to nanoparticles. The whole system is enclosed in a glove box to ensure the operator safety during assembly, dismounting and clean-up operations as well as during the tests. Appropriate nanoparticle detection techniques were also identified. Results are reported here for commercial 15nm TiO2 nanoparticles - powder and colloidal solutions in 1,2-propanediol, ethylene glycol and water - and four types of protective gloves: disposable nitrile and latex as well as unsupported neoprene and butyl rubber gloves. They show that mechanical deformations and contact with colloidal solution liquid carriers may affect glove materials. Preliminary results obtained with TiO2 powder indicate a possible penetration of nanoparticles through gloves following mechanical deformations.
Alvarez-Corrales, Nancy; Ahmed, Raija K; Rodriguez, Carol A; Balaji, Kithiganahalli N; Rivera, Rebeca; Sompallae, Ramakrishna; Vudattu, Nalini K; Hoffner, Sven E; Zumla, Alimuddin; Pineda-Garcia, Lelany; Maeurer, Markus
2013-03-06
A better understanding of the quality of cellular immune responses directed against molecularly defined targets will guide the development of TB diagnostics and identification of molecularly defined, clinically relevant M.tb vaccine candidates. Recombinant proteins (n = 8) and peptide pools (n = 14) from M. tuberculosis (M.tb) targets were used to compare cellular immune responses defined by IFN-γ and IL-17 production using a Whole Blood Assay (WBA) in a cohort of 148 individuals, i.e. patients with TB + (n = 38), TB- individuals with other pulmonary diseases (n = 81) and individuals exposed to TB without evidence of clinical TB (health care workers, n = 29). M.tb antigens Rv2958c (glycosyltransferase), Rv2962c (mycolyltransferase), Rv1886c (Ag85B), Rv3804c (Ag85A), and the PPE family member Rv3347c were frequently recognized, defined by IFN-γ production, in blood from healthy individuals exposed to M.tb (health care workers). A different recognition pattern was found for IL-17 production in blood from M.tb exposed individuals responding to TB10.4 (Rv0288), Ag85B (Rv1886c) and the PPE family members Rv0978c and Rv1917c. The pattern of immune target recognition is different in regard to IFN-γ and IL-17 production to defined molecular M.tb targets in PBMCs from individuals frequently exposed to M.tb. The data represent the first mapping of cellular immune responses against M.tb targets in TB patients from Honduras.
Dolez, Patricia; Vinches, Ludwig; Wilkinson, Kevin; Plamondon, Philippe; Vu-Khanh, Toan
2011-07-01
Nanoparticle manufacture and use are in full expansion. The associated risks of occupational exposure raise large concerns due to their potential toxicity. Even if they stand as a last resort in the traditional occupational Health & Safety (H&S) risk management strategy, personal protective equipment (PPE) against nanoparticles are an absolute need in the context of precautionary principle advocated by H&S organizations worldwide. However no standard test method is currently available for evaluating the efficiency of PPE against nanoparticles, in particular in the case of gloves. A project is thus underway to develop a test method for measuring nanoparticle penetration through protective gloves in conditions simulating glove-nanoparticle occupational interaction. The test setup includes an exposure and a sampling chamber separated by a circular glove sample. A system of cylinders is used to deform the sample while it is exposed to nanoparticles. The whole system is enclosed in a glove box to ensure the operator safety during assembly, dismounting and clean-up operations as well as during the tests. Appropriate nanoparticle detection techniques were also identified. Results are reported here for commercial 15nm TiO2 nanoparticles - powder and colloidal solutions in 1,2-propanediol, ethylene glycol and water - and four types of protective gloves: disposable nitrile and latex as well as unsupported neoprene and butyl rubber gloves. They show that mechanical deformations and contact with colloidal solution liquid carriers may affect glove materials. Preliminary results obtained with TiO2 powder indicate a possible penetration of nanoparticles through gloves following mechanical deformations.
Radiation effects-prevalence of contributory risk factors a pilot study in Visakhapthnam steel plant
Energy Technology Data Exchange (ETDEWEB)
Lakshman rao, K. V.
2004-07-01
Integrated Steel Plants contribute significant air pollution, water pollution and solid waste generation. Diverse occupational health hazards present is steel industry pose ill effects to the industrial workers. Occupational health services and research center (OHS and RC) of this plant established in the year 1992 to protect the health and well-being of all the employees working in different occupations. the primary role OHS and RC is to conduct periodical medical examinations, monitoring of the working environments, suggest the suitable personal protective equipment to the workers, evaluate risk factors, work practices, risk management and industrial toxicological studies. Dissemination of information related to occupational health and safety to the working population through regular educational sessions at the workplaces as at training and development center (T and DC) is also part of our services. The proneness for effects of exposure to ionizing radiation is enhanced by various factors related to the family history of chronic diseases, nutritional status of the individuals, the lifestyle factors apart from psycho-social factors like illiteracy, ignorance, negligence and inadequate utilization of personal protective equipment (PPE) at workplace. To evaluate the prevalence of such contributory risk factors, a pilot study has been conducted in Visakhapatnam Steel Plant. The data is obtained through routine periodical medical examination of workers at the Occupational Health Services Center through standard format. The study revealed statistically high prevalence of the risk factors and indicated the necessity of intensifying primary prevention methods in addition to environmental control and usage of PPE. (Author)
Seo, Yongsuk; DiLeo, Travis; Powell, Jeffrey B; Kim, Jung-Hyun; Roberge, Raymond J; Coca, Aitor
2016-08-01
Monitoring and measuring core body temperature is important to prevent or minimize physiological strain and cognitive dysfunction for workers such as first responders (e.g., firefighters) and military personnel. The purpose of this study is to compare estimated core body temperature (Tco-est), determined by heart rate (HR) data from a wearable chest strap physiology monitor, to standard rectal thermometry (Tre) under different conditions. Tco-est and Tre measurements were obtained in thermoneutral and heat stress conditions (high temperature and relative humidity) during four different experiments including treadmill exercise, cycling exercise, passive heat stress, and treadmill exercise while wearing personal protective equipment (PPE). Overall, the mean Tco-est did not differ significantly from Tre across the four conditions. During exercise at low-moderate work rates under heat stress conditions, Tco-est was consistently higher than Tre at all-time points. Tco-est underestimated temperature compared to Tre at rest in heat stress conditions and at a low work rate under heat stress while wearing PPE. The mean differences between the two measurements ranged from -0.1 ± 0.4 to 0.3 ± 0.4°C and Tco-est correlated well with HR (r = 0.795 - 0.849) and mean body temperature (r = 0.637 - 0.861). These results indicate that, the comparison of Tco-est to Tre may result in over- or underestimation which could possibly lead to heat-related illness during monitoring in certain conditions. Modifications to the current algorithm should be considered to address such issues.
2013-01-01
Background A better understanding of the quality of cellular immune responses directed against molecularly defined targets will guide the development of TB diagnostics and identification of molecularly defined, clinically relevant M.tb vaccine candidates. Methods Recombinant proteins (n = 8) and peptide pools (n = 14) from M. tuberculosis (M.tb) targets were used to compare cellular immune responses defined by IFN-γ and IL-17 production using a Whole Blood Assay (WBA) in a cohort of 148 individuals, i.e. patients with TB + (n = 38), TB- individuals with other pulmonary diseases (n = 81) and individuals exposed to TB without evidence of clinical TB (health care workers, n = 29). Results M.tb antigens Rv2958c (glycosyltransferase), Rv2962c (mycolyltransferase), Rv1886c (Ag85B), Rv3804c (Ag85A), and the PPE family member Rv3347c were frequently recognized, defined by IFN-γ production, in blood from healthy individuals exposed to M.tb (health care workers). A different recognition pattern was found for IL-17 production in blood from M.tb exposed individuals responding to TB10.4 (Rv0288), Ag85B (Rv1886c) and the PPE family members Rv0978c and Rv1917c. Conclusions The pattern of immune target recognition is different in regard to IFN-γ and IL-17 production to defined molecular M.tb targets in PBMCs from individuals frequently exposed to M.tb. The data represent the first mapping of cellular immune responses against M.tb targets in TB patients from Honduras. PMID:23497342
Gunite and associated tanks remediation project recycling and waste minimization effort
International Nuclear Information System (INIS)
Van Hoesen, S.D.; Saunders, A.D.
1998-05-01
The Department of Energy's Environmental Management Program at Oak Ridge National Laboratory has initiated clean up of legacy waste resulting from the Manhattan Project. The gunite and associated tanks project has taken an active pollution prevention role by successfully recycling eight tons of scrap metal, reusing contaminated soil in the Area of Contamination, using existing water (supernate) to aid in sludge transfer, and by minimizing and reusing personal protective equipment (PPE) and on-site equipment as much as possible. Total cost savings for Fiscal Year 1997 activities from these efforts are estimated at $4.2 million dollars
Sustainability and evidence-based design in the healthcare estate
Phiri, Michael
2014-01-01
This work aims to deepen our understanding of the role played by technical guidelines and tools for the design, construction and operation of healthcare facilities, ultimately establishing the impact of the physical environment on staff and patient outcomes. Using case studies largely drawn from the UK, Europe, China and Australasia, design approaches such as sustainability (e.g. targets for energy efficiency, carbon neutrality, reduction of waste), evidence-based design (EBD), and Post-Project Evaluation (PPE) are examined in order to identify policies, mechanisms and strategies that can promote an integrated learning environment that in turn supports innovation in healthcare.
Directory of Open Access Journals (Sweden)
J.Janeček
2007-09-01
Full Text Available The inhomogeneous Monte Carlo technique is used in studying the vapor-liquid interface of benzene in a broad range of temperatures using the TraPPE potential field. The obtained values of the VLE parameters are in good agreement with the experimental values as well as with the results from GEMC simulations. In contrast to the GEMC, within one simulation box the inhomogeneous MC technique also yields information on the structural properties of the interphase between the two phases. The values of the vaporization enthalpy and the vapor pressure very well satisfy the Clausius-Clapeyron equation.
Directory of Open Access Journals (Sweden)
Jimena E. Díaz
2016-09-01
Full Text Available The first general procedure for the synthesis of 5 to 7-membered 1-aryl-2-iminoazacycloalkanes is presented, by microwave-assisted ring closure of ω-arylaminonitriles promoted by polyphosphoric acid (PPA esters. 1-Aryl-2-iminopyrrolidines were easily prepared from the acyclic precursors employing a chloroformic solution of ethyl polyphosphate (PPE. The use of trimethylsilyl polyphosphate (PPSE in solvent-free conditions allowed for the synthesis of 1-aryl-2-iminopiperidines and hitherto unreported 1-aryl-2-iminoazepanes. The cyclization reaction involves good to high yields and short reaction times, and represents a novel application of PPA esters in heterocyclic synthesis.
2011-08-01
1.0’!1. cardboard 7.5% "" PS 1.5% Paper 22.5% Pll {loams) 0,5% Ruhber 2.5% ABS (eledlonics) 0.5% Wet food waste (slop) 22.5% Wood (6%) Oils and...nanoparticles--ZnO, TiO2 , and CeO2, were studied for personal protective equipment (PPE) efficiency, initial uptake by cell lines, and downstream cytotoxic...8217olehicle/aW’crart Additional factors: Fixed lOcation vs. port~blc ’" I c th crccf· to powoo’nctwork vs. stalld- olo"" user-opcrn~ed vs. autonomous
Solidaritet– skitse til en dialogisk fundamentalontologi
DEFF Research Database (Denmark)
Ydesen, Christian
2006-01-01
Historisk har solidaritetsbegrebet været anvendt i mange forskellige sammenhænge og i dag vil det næppe være for meget at sige, at begrebet ikke kan betegnes som en entydig størrelse. Hensigten med denne artikel er imidlertid at afdække, hvad der nærmere konstituerer fænomenet solidaritet. Begreb...... af solidaritet som et uomgængeligt fænomen i den menneskelige eksistens. En underliggende intention med artiklen er således at udfordre nuværende forståelser af solidaritet ud fra en analyse af begrebets fundamentalontologi....
International Nuclear Information System (INIS)
Damm, Andreas
2011-01-01
This thesis consists of two main parts. The first one reports about recent investigations of the electron dynamics on the Si(111) 7 x 7 surface employing time- and angle-resolved two-photon photoemission (2PPE). The second part describes the construction and demonstration of the capabilities of a new electron time-of-flight spectrometer. It is shown that the electron dynamics of this surface are governed by adatom and bulk states. Variation of different experimental parameters leads to the suggestion that electrons scatter from the adatom states into the conduction band of Silicon. The localization in real space can be estimated from the distribution of the photoemission intensity in momentum space to be within one 7 x 7 unit cell. The electron population in the conduction band as well as those in the adatom band show a very long-living component. In addition to recombination through defect states, these electrons can undergo radiative recombination with holes in the valence band. The second part of this thesis reports about the design, construction and demonstration of the capabilities of a new electron time-of-flight spectrometer for applications in time- and angle-resolved 2PPE experiments. The new spectrometer is designed in a flexible manner to maximize either the energy resolution or the acceptance angle, respectively. By employing a position-sensitive electron detector it is possible for the first time to measure the energy as well as all components of the parallel momentum of the photoemitted electrons and thereby to fully characterize electrons from surface states. The time-resolution can be estimated from the width of a peak induced by photons scattered from the sample to be better than 150 ps. At the minimum of about 40 mm of the adjustable drift distance this leads to a energy resolution below 5 meV for electrons with kinetic energies of 1 eV. Thereby, the parallel momentum resolution is below 5 mA -1 for parallel momentum values k parallel ≤1A -1
Directory of Open Access Journals (Sweden)
Matheus Bellini Tácio
2008-03-01
Full Text Available Os objetivos do trabalho foram: quantificar as exposições dérmicas e respiratórias potenciais proporcionadas ao tratorista em pulverizações de agrotóxicos, na cultura de goiaba, com o turbopulverizador; avaliar a eficiência de duas vestimentas de proteção individual; avaliar a segurança e classificar estas condições de trabalho em seguras ou inseguras para cada agrotóxico considerado. A exposição dérmica potencial proporcionada ao tratorista pela condição de trabalho foi de 3.807,3 mL de calda/7h. A eficiência do conjunto de proteção individual Agro Light foi de 96,7 %, e a do Azeredo, 96,2 %. A exposição dérmica potencial nas regiões do corpo mais expostas do tratorista à pulverização, em ordem decrescente, foram os pés, os braços, as coxas+pernas-frente e o tronco-atrás. A exposição dérmica não-controlada pelos conjuntos de proteção individual foi igualmente distribuída em todas as regiões do corpo do tratorista devido aos controles das exposições dérmicas que proporcionaram às regiões mais expostas do corpo. Foram classificadas como seguras as pulverizações de três dos 17 agrotóxicos considerados e sete com o uso das vestimentas de proteção individual. As demais foram classificadas como inseguras.The objectives were to quantify potential dermal and respiratory exposure of the tractor-driver during spraying in guava orchards with the air-assisted sprayer, to evaluate the efficiency of two types of personal protective equipment (PPE, and to classify these working conditions as safe or unsafe for each pesticide studied. The potential dermal exposure of the tractor driver was 3,807.349 mL of spray/6h. The efficiency in the control of dermal exposure was 96.7% for the Agro Light set and 96.2% for the Azeredo set. The feet, arms, thighs front legs and back trunk were the areas most exposed in the absence of protective measures, while exposure was generalized over the body when the PPE was used. The
Intraosseous vascular access in disasters and mass casualty events: A review of the literature.
Burgert, James M
2016-01-01
The intraosseous (IO) route of vascular access has been increasingly used to administer resuscitative fluids and drugs to patients in whom reliable intravenous (IV) access could not be rapidly or easily obtained. It is unknown that to what extent the IO route has been used to gain vascular access during disasters and mass casualty events. The purpose of this review was to examine the existing literature to answer the research question, "What is the utility of the IO route compared to other routes for establishing vascular access in patients resulting from disasters and mass casualty events?" Keyword-based online database search of PubMed, CINAHL, and the Cochrane Database of Systematic Reviews. University-based academic research cell. Included evidence were randomized and nonrandomized trials, systematic reviews with and without meta-analysis, case series, and case reports. Excluded evidence included narrative reviews and expert opinion. Not applicable. Of 297 evidence sources located, 22 met inclusion criteria. Located evidence was organized into four categories including chemical agent poisoning, IO placement, while wearing chemical protective clothing (PPE), military trauma, and infectious disease outbreak. Evidence indicates that the IO route of infusion is pharmacokinetically equal to the IV route and superior to the intramuscular (IM) and endotracheal routes for the administration of antidotal drugs in animal models of chemical agent poisoning while wearing full chemical PPE. The IO route is superior to the IM route for antidote administration during hypovolemic shock. Civilian casualties of explosive attacks and mass shootings would likely benefit from expanded use of the IO route and military resuscitation strategies. The IO route is useful for fluid resuscitation in the management of diarrheal and hemorrhagic infectious disease outbreaks.
Rezaei, Rohollah; Damalas, Christos A; Abdollahzadeh, Gholamhossein
2018-03-01
Preventive interventions for reducing occupational risks and health problems among farmers require the identification of factors contributing to unsafe behaviour, but research on this topic is rather limited. A theoretical model for studying factors affecting farmers' use of occupational safety and health (OSH) practices in Iran was developed. The model was empirically tested using data collected from a survey of 301 tomato farmers of Zanjan Province of Iran. The examined OSH practices encompassed a wide range of behaviours, grouped in four categories, i.e., use of pesticides, use of machinery, use of personal protective equipment (PPE), and applying ergonomic principles (i.e., fitting the task to the individual, designing the workplace based on human factors, taking into account the interaction between the workplace and the workers, exercising during work or rest). Almost half of the farmers (49.5%) showed unsafe behaviour in the use of PPE. Moreover, significant proportions of the farmers showed potentially unsafe behaviour in the use of pesticides (42.2%), in applying ergonomic principles (40.2%) and in the use of machinery (35.9%). Attitude towards OSH practices, knowledge on OSH practices, and self-efficacy in safety had a direct positive effect on farmers' use of OSH practices, explaining 73% of the variance in farmers' safety behaviour. Overall, findings contribute to a better understanding of the use of OSH practices among farmers, providing empirical evidence in the cognitive processing of farmers' with respect to safety behaviour in farming and offering practical information that can be incorporated into OSH intervention programs in Iran and other developing countries. Copyright © 2017 Elsevier B.V. All rights reserved.