Snyder, Donna L.; Miller, Andrea L.
2009-01-01
What is the relative importance of current and emerging technologies in school library media programs? In order to answer this question, in Fall 2007 the authors administered a survey to 1,053 school library media specialists (SLMSs) throughout the state of Pennsylvania. As a part of the MSLS degree with Library Science K-12 certification, Clarion…
... Releases Speeches and Testimony Major Operations Multi-Media Library Micrograms Legislative & Legal Resources Events Social Media Directory ... Envío de información confidencial Press Room » Multi-Media Library IMAGE GALLERY Drug Photos Amphetamines/Stimulants K2/Spice ...
Perspectives on...Special Collections at ARL Libraries and K-12 Outreach: Current Trends
Visser, Michelle
2006-01-01
This article examines the results of a survey sent to Association of Research Libraries (ARL) Special Collections requesting information on outreach to K-12 students. Over half of the respondents work with K-12 and many of those who currently do not are planning to. New pressures and changing philosophies contribute to this trend.
Regazzi, John J.
2012-01-01
This study compares the overall spending trends and patterns of growth of Academic Libraries with Public Libraries, K-12 schools, higher education institutions, and hospitals in the period of 1998 to 2008. Academic Libraries, while showing a growth of 13% over inflation for the period, far underperformed the growth of the other public institutions…
Media Magic: Automating a K-12 Library Program in a Rural District.
Adams, Helen
1994-01-01
Describes the automation process in a library resources center in a small rural school district. Topics discussed include long-range planning; retrospective conversion for an online catalog; library automation software vendors; finances; training; time savings; CD-ROM products; telecomputing; computer literacy skills; professional development…
Using social media in libraries best practices
Harmon, Charles
2013-01-01
The eight best practices presented here will help your library both actually do social media in a way that matters and do it well. The successful strategies presented here range from the Vancouver Public Library's innovative use of Twitter to the United Nations Library's adoption of a social media policy to the Farmington, Connecticut Public Library's fantastic work using social media to reach teens who weren't using the library.
Foster, J.; Connolly, R.
2017-12-01
WGBH's "Bringing the Universe to America's Classrooms" project is a 5-year effort to design, produce and evaluate digital media tools and resources that support scientific practice skills in diverse K-12 learners. Resources leverage data and content from NASA and WGBH signature programs, like NOVA, into sound instructional experiences that provide K-12 STEM teachers with free, quality resources for teaching topics in the Earth and Space Sciences. Resources address the content and practices in the new K-12 Framework for Science Education and are aligned with the NGSS. Participants will learn about design strategies, findings from our evaluation efforts, and how to access free resources on PBS LearningMedia.
LIBRARIES, SOCIAL MEDIA AND METRICS
Directory of Open Access Journals (Sweden)
Nieves González Fernández-Villavicencio
2016-02-01
Full Text Available This paper is an abstract of the dissertation Profitability of a library using social media and highlights research carried out in order to demonstrate the profitability of libraries that make use of social media both to offer products and services to the users in line with their expectations and needs and to deliver different types of ROI. A set of social media indicators to measure the evolution and results has also been established.
Management Matters: The Library Media Specialist's Management Toolbox
Pappas, Marjorie L.
2004-01-01
Library media specialists need tools to help them manage the school library media program. The Internet includes a vast array of tools that a library media specialist might find useful. The websites and electronic resources included in this article are only a representative sample and future columns may explore additional tools. All the tools are…
An Analysis of User Satisfaction of K University’s Library Service
Directory of Open Access Journals (Sweden)
Younghee Noh
2011-06-01
Full Text Available This study purposed to discover whether or not academic libraries reflect these changing roles. We selected K University as the research target and surveyed user satisfaction of materials, staff services, facilities, electronic devices, media, and so on. The research findings are as follows: 1 the frequency of library visits of University K was on the high side, 2 the primary purpose of using the academic library was associated with learning or reading, therefore, the most used library spaces were related to that, 3 the most used library materials were 'general books', the most unused were 'reference books', 4 the most preferred way to obtain needed materials when failing to find wanted materials was 'Contact librarian'. A similar phenomenon occurred in terms of facility use, 5 university K's users were usually satisfied with the loan policy, 6 the rate of users who don't know whether there is user education was very high, the rate of users who have no experience with user education was extremely low. These research findings can be referenced by library management to improve libraries' service quality and take advantage of complex spatial configurations.
K-12 Local Network (LAN) Design Guide
National Research Council Canada - National Science Library
Horton, Cody
1998-01-01
...) educators preparing to design and implement LANs in K-12 schools and libraries. Data was collected during the implementation of LANs in K-12 schools of the Monterey Peninsula Uniform School District (MPUSD...
Libraries Protecting Privacy on Social Media: Sharing without "Oversharing"
Directory of Open Access Journals (Sweden)
Kelley Cotter
2016-11-01
Full Text Available Libraries have increasingly adopted social media as an integral means of connecting with their users. However, social media presents many potential concerns regarding library patron privacy. This article presents the findings from a study of how librarians and library staff perceive and handle issues of patron privacy related to social media marketing in libraries. The study reports the results from a mixed-methods online survey, which used a nonprobability self-selection sampling method to collect responses from individuals employed by libraries, without restrictions on position or library type. Nearly three-quarters of respondents reported working in libraries that have either an official or unofficial social media policy. Approximately 53% of those policies mention patron privacy. The findings suggest that many respondents’ views and practices are influenced by the perception of the library’s physical space and social media presence as public places. The findings also suggest a lack of consensus regarding the extent of the library’s obligation to protect patron privacy on library social media sites and what would constitute a violation of privacy.
Branch, B. D.; Wegner, K.; Smith, S.; Schulze, D. G.; Merwade, V.; Jung, J.; Bessenbacher, A.
2013-12-01
It has been the tradition of the libraries to support literacy. Now in the realm of Executive Order, Making Open and Machine Readable the New Default for Government Information, May 9, 2013, the library has the responsibility to support geospatial data, big data, earth science data or cyber infrastructure data that may support STEM for educational pipeline stimulation. (Such information can be found at http://www.whitehouse.gov/the-press-office/2013/05/09/executive-order-making-open-and-machine-readable-new-default-government-.) Provided is an Educational Data Curation Framework (EDCF) that has been initiated in Purdue research, geospatial data service engagement and outreach endeavors for future consideration and application to augment such data science and climate literacy needs of future global citizens. In addition, this endorsement of this framework by the GLOBE program may facilitate further EDCF implementations, discussion points and prototypes for libraries. In addition, the ECDF will support teacher-led, placed-based and large scale climate or earth science learning systems where such knowledge transfer of climate or earth science data is effectively transferred from higher education research of cyberinfrastructure use such as, NOAA or NASA, to K-12 teachers and school systems. The purpose of this effort is to establish best practices for sustainable K-12 data science delivery system or GLOBE-provided system (http://vis.globe.gov/GLOBE/) where libraries manage the data curation and data appropriateness as data reference experts for such digital data. Here, the Purdue University Libraries' GIS department works to support soils, LIDAR and water science data experiences to support teacher training for an EDCF development effort. Lastly, it should be noted that the interdisciplinary collaboration and demonstration of library supported outreach partners and national organizations such the GLOBE program may best foster EDCF development. This trend in data
Application of social media to library service delivery: Perception of ...
African Journals Online (AJOL)
The study revealed that few of the social media identified are rarely relevant to library service delivery. Reference services, current awareness services, and library news postings were the types of library services that social media are applied. Results also indicated that there were benefits derived from using social media in ...
Making social media work: finding a library voice
Directory of Open Access Journals (Sweden)
Zelda Chatten
2017-11-01
Full Text Available The social media team at the University of Liverpool Library runs a popular verified Twitter account with over 9,000 followers and is enthusiastically involved in a variety of social media platforms. Since starting a period of sustained improvement, our use of social media has progressed from being a passive channel used to broadcast news and service changes to being an active method of communication in a digital space our users already inhabit. Working collaboratively, the social media team has established a cohesive and clear library voice with a consistent style and tone. This article looks at the development of the library voice with a particular focus on the use of creative, interactive and fun methods to cultivate the library personality. It also covers some of the challenges associated with this type of relaxed and experimental approach to social media and gives examples of special events used to engage and interact with students. 'Based on a lightning talk and poster session presented at the 40th UKSG Annual Conference, Harrogate, April 2017 '
School Library Media Specialist-Teacher Collaboration: Characteristics, Challenges, Opportunities
Cooper, O. P.; Bray, Marty
2011-01-01
The most successful school library media specialists are those who collaborate with teachers as full partners in the instructional process. Without assertive action by the school library media specialist, however, school administrators and teachers are likely to be more aware of the media specialist's administrative role than the roles of teacher,…
Digital media labs in libraries
Goodman, Amanda L
2014-01-01
Families share stories with each other and veterans reconnect with their comrades, while teens edit music videos and then upload them to the web: all this and more can happen in the digital media lab (DML), a gathering of equipment with which people create digital content or convert content that is in analog formats. Enabling community members to create digital content was identified by The Edge Initiative, a national coalition of leading library and local government organizations, as a library technology benchmark. Surveying academic and public libraries in a variety of settings and sharing a
Building Library Community Through Social Media
Directory of Open Access Journals (Sweden)
Scott Woodward Hazard Young
2015-03-01
Full Text Available In this article academic librarians present and analyze a model for community building through social media. Findings demonstrate the importance of strategy and interactivity via social media for generating new connections with library users. Details of this research include successful guidelines for building community and developing engagement online with social media. By applying intentional social media practices, the researchers’ Twitter user community grew 100 percent in one year, with a corresponding 275 percent increase in user interactions. Using a community analysis approach, this research demonstrates that the principles of personality and interactivity can lead to community formation for targeted user groups. Discussion includes the strategies and research approaches that were employed to build, study, and understand user community, including user type analysis and action-object mapping. From this research a picture of the library as a member of an active academic community comes into focus.
Developing a Multicultural Library Media Program.
Houff, Suzanne G.
1994-01-01
Describes the development of a multicultural library media program based on experiences at a Virginia middle school. Highlights include the media center as a cultural and curricular resource; establishing philosophies and goals; reviewing current materials and establishing guidelines for new material selection; staff development; and an integrated…
Current Technology Trends for School Library Media Specialists
Leticia Ekhaml; Joan Hubbard
2003-01-01
An overview of some of the current technology trends used in classroom instruction and school library media centers in provided in this article such as the use of handheld electronic organizers, CD recorders, digital video cameras, and interactive whiteboards. The article offers some suggestions or ideas on how to acquire new technologies to school library media centers that are low in budgetary funds.
Promoting media and information literacy in libraries
Huysmans, F.; Franke, M.
2016-01-01
Librarians and (public) libraries are active in promoting information literacy and (more recently) media literacy. After a brief historical sketch, this document describes how public libraries assist patrons and educational institutions in enhancing knowledge, skills and attitudes needed to
Current Technology Trends for School Library Media Specialists
Directory of Open Access Journals (Sweden)
Leticia Ekhaml
2003-03-01
Full Text Available An overview of some of the current technology trends used in classroom instruction and school library media centers in provided in this article such as the use of handheld electronic organizers, CD recorders, digital video cameras, and interactive whiteboards. The article offers some suggestions or ideas on how to acquire new technologies to school library media centers that are low in budgetary funds.
Directory of Open Access Journals (Sweden)
Di Pierro F
2015-09-01
Full Text Available Francesco Di Pierro,1 Daniele Di Pasquale,2 Maurizio Di Cicco2 1Velleja Research, Milan, Italy; 2ORL Department, Ospedale Maggiore Policlinico Ca’ Grande IRCCS, Milan, Italy Abstract: Secretory otitis media (SOM remains a common disease among children. Although its cause is not yet perfectly established, the pathology, often a sequel of acute otitis media (AOM, is mainly characterized by persistent fluid in the middle ear cavity. Twenty-two children with a diagnosis of SOM were treated daily for 90 days with an oral formulation containing the oral probiotic Streptococcus salivarius K12 (Bactoblis®. After treatment, the children were evaluated for AOM episodes and subjected to tone audiometry, tympanometry, endonasal endoscopy, otoscopy, and tonsillar examination. Subject compliance and probiotic tolerability and side effects have also been evaluated. Our results indicate a good safety profile, a substantial reduction of AOM episodes, and a positive outcome from the treatment for all of the clinical outcomes tested. We conclude that strain K12 may have a role in reducing the occurrence and/or severity of SOM in children. From our perspective, this study constitutes a starting point toward the organization of a more extensive placebo-controlled study aimed at critically appraising our preliminary observations. Keywords: BLIS K12, Bactoblis®, acute otitis media, exudative otitis media
Library Media Services. Multicultural Nonsexist Education in Iowa Schools.
Iowa State Dept. of Public Instruction, Des Moines.
Intended as an aid for Iowa school library media specialists, this pamphlet identifies resources and provides guidelines for the development of multicultural, nonsexist (MC-NS) school library media programs. Definitions of terms used in the pamphlet are given. The rationale and philosophy underlying elementary and secondary curricula design are…
Multicultural Aspects of Library Media Programs.
Latrobe, Kathy Howard, Comp.; Laughlin, Mildred Knight, Comp.
Designed to help library media specialists, as well as administrators, teachers, and parents, develop a greater sensitivity to the multicultural problems and issues that young people face in schools, this collection of essays offers diverse perspectives on multicultural issues in the media program. The four main sections of the book and the essays…
The Perception of Teachers and School Library Media Specialist on ...
African Journals Online (AJOL)
The Perception of Teachers and School Library Media Specialist on the Role of School Library Media Specialists in Selected Secondary Schools in Ogun State. ... Journal Home > Vol 9, No 1 (2012) >. Log in or Register to get access to full text ...
Brewer, Sally; Milam, Peggy
2006-01-01
This article presents findings from the School Library Journal's 2006 national technology survey that investigated the trend in today's library media centers. As this study demonstrates, technology continues to be a significant aspect of K-12 media centers. Despite restricted funding and schedules stretched to the limit, media specialists have…
Brookbank, Elizabeth
2015-01-01
The majority of college students use social media of some kind, and academic libraries are increasingly using social media to reach them. Although studies have analyzed which platforms academic libraries most commonly use and case studies have provided examples of how libraries use specific platforms, there are few examinations of the usage habits…
Y2K Resources for Public Libraries.
Foster, Janet
1999-01-01
Presents information for public libraries on computer-related vulnerabilities as the century turns from 1999 to 2000. Highlights include: general Y2K information; the Y2K Bug and PCs; Y2K sites for librarians; Online Computer Library Center (OCLC) and USMARC; technological developments in cyberspace; and a list of Web sites and Y2K resources. (AEF)
Management Matters. Display and Promotion Ideas for Library Media Centers
Pappas, Marjorie L.
2005-01-01
School library media centers should be warm and inviting places where the environment entices children to read and explore. Creative bulletin board and case displays along with other exhibits help to make the library media center an exciting place. Bulletin board displays that promote authors, books, and exciting ideas motivate children to find…
Copyright Updates for K-12 Librarians
Johnson, Wendell G.
2016-01-01
Copyright concerns continue to bedevil K-12 librarians, who are often called upon to act as the copyright officers in public schools. This article describes recent copyright developments of concern to these librarians in three areas: a recent court case involving a university library, pending legislation supported by ALA, and a regulatory update.…
Di Pierro, F; Colombo, M; Giuliani, M G; Danza, M L; Basile, I; Bollani, T; Conti, A M; Zanvit, A; Rottoli, A S
2016-11-01
Streptococcus salivarius K12 (BLIS K12) is a probiotic strain strongly antagonistic to the growth of Streptococcus pyogenes, the most important bacterial cause of pharyngeal infections in humans. Shown to colonize the oral cavity and to be safe for human use, BLIS K12 has previously been reported to reduce pharyngo-tonsillitis episodes in children or adults known to have experienced recurrent streptococcal infection. The present study was focussed upon evaluating the role of BLIS K12 in the control of streptococcal disease and acute otitis media in children attending the first year of kindergarten. By randomization, 222 enrolled children attending the first year of kindergarten were divided into a treated group (N = 111) receiving for 6 months a daily treatment with BLIS K12 (Bactoblis®) and a control group (N = 111) who were monitored as untreated controls. During the 6 months of treatment and 3 months of follow-up, the children were evaluated for treatment tolerance, and for episodes of streptococcal pharyngo-tonsillitis, scarlet fever and acute otitis media. During the 6-month trial (N = 111 per group) the incidence of streptococcal pharyngo-tonsillitis, scarlet fever and acute otitis media was approximately 16%, 9% and 44% respectively in the treated group and 48%, 4% and 80% in the control group. During the 3-months follow-up (N = 29 per group) the corresponding rates of infection were 15%, 0% and 12% in the treated group and 26%, 6% and 36% in the controls. No apparent side effects were detected in the treated group either during treatment or follow-up. All of the enrolled children completed the study. The daily administration of BLIS K12 to children attending their first year of kindergarten was associated with a significant reduction in episodes of streptococcal pharyngitis and acute otitis media. No protection against scarlet fever was detected.
Karpisek, Marian; And Others
1995-01-01
Presents five articles and a company resource directory to help librarians successfully incorporate technology into school libraries. Discusses actual situations, examines student needs, and gives advice to help librarians with library automation systems, videodiscs, library security systems, media retrieval, networking CD-ROMs, and locating…
Flowers, Helen F.
This informative how-to guide explains public relations strategies and the audiences they target, with tips for customizing these tactics for particular libraries. Helpful techniques are recommended for promoting the use of library media services by students, faculty, building administrators, and school support staff. Readers will also learn how…
Administrative Perceptions on the Role of the School Library Media Specialist
Page, Kayla
2013-01-01
Despite the efforts of local school library media specialists to promote their programming, many administrators do not understand the roles and responsibilities of the school library media specialist. Using a constructivist theoretical framework, this study was designed to examine the local school administrators' perceptions of the role of the…
Making social media work: finding a library voice
Chatten, Zelda
2017-01-01
The social media team at the University of Liverpool Library runs a popular verified Twitter account with over 9,000 followers and is enthusiastically involved in a variety of social media platforms. Since starting a period of sustained improvement, our use of social media has progressed from being a passive channel used to broadcast news and service changes to being an active method of communication in a digital space our users already inhabit. Working collaboratively, the social media team ...
Technostress in Libraries and Media Centers: Case Studies and Coping Strategies.
Hickey, Kate D., Ed.
1992-01-01
Discusses technostress--i.e., stress brought on by changes in technology--in libraries and media centers. Case studies are presented that show stress in community college libraries caused by the rapid implementation of new technologies; coping strategies for librarians and media specialists are discussed; and strategies for managers are suggested.…
Nigerian School Library Journal - Vol 12 (2013)
African Journals Online (AJOL)
Staff development strategies for school library media centres: a case study of selected ... bibliotherapy concept by school counselors for challenging students in some belected ... and supportive learning media utilisation in Nigerian educational system ... Awareneness and usage of web 2.0 tools among lecturers in Nigerian ...
A Comparative Study on New Media Marketing in Domestic and Foreign Public Libraries
Directory of Open Access Journals (Sweden)
Xu Yan
2017-01-01
Full Text Available Currently, new media has become the popular platform for brand marketing and services promoting of public libraries. Using the method of online survey, literature analysis and comparative analysis, this paper chooses 4 foreign public libraries and 4 domestic public libraries as the research samples and compares the differences in new media marketing between them from new media marketing tools, marketing content and marketing strategies, then makes some proposals and measures to perfect domestic public libraries’ new media marketing, so as to provide references to improve the libraries’ social awareness and benefits.
Information Literacy: An Online Course for Student Library Assistants
Lincoln, Margaret
2009-01-01
As technology advances continue to impact K-12 schools, online education options offer alternative choices for both teaching and learning. Library media specialists, long committed to providing physical and intellectual access to instructional materials, have responded to changing needs in this online world. They had previously created a virtual…
Empowering Learners: Guidelines for School Library Media Programs
American Association of School Librarians (NJ3), 2009
2009-01-01
As we approach the second decade of the twenty-first century, school library media programs continue to undergo momentous changes that have heightened the importance of technology and evidence-based learning. The focus has moved from the library as a confined place to one with fluid boundaries that is layered by diverse needs and influenced by an…
100 Library Lifesavers: A Survival Guide for School Library Media Specialists.
Bacon, Pamela S.
This book contains tips (author's suggestions), tools (ready-to-use lifesavers), and talk (quotes from practicing media specialists) for school librarians at all grade levels. A total of 100 lifesavers are included, covering areas such as inventory, motivation strategies, disciplinary approaches, library checkout, Internet searching, the traveling…
Trying To Reduce Your Technostress?: Helpful Activities for Teachers and Library Media Specialists.
McKenzie, Barbara K.; And Others
1997-01-01
As pressure increases to integrate technology into instruction, many teachers and library media specialists are having difficulty coping with "technostress." Presents suggestions and activities for teachers and library media specialists designed to reduce "technostress." (PEN)
Designing a School Library Media Center for the Future.
Erikson, Rolf; Markuson, Carolyn
This booklet presents guidance on building superior school library media centers by outlining conceptual plans from actual school libraries and explaining how to address specific planning and operational issues. The booklet discusses how to address the unique ergonomic and technology needs of children; how to control costs using proven bidding and…
Management Matters. Virtual School Library Media Center Management Manual
Pappas, Marjorie L.
2005-01-01
In this article, the author describes a management manual she maintained while working as a school library media specialist. She started the manual when she was a student in the organization and administration course in the library science program and kept it current with information gleaned from conferences, workshops, and networking with other…
Planning for the Automation of School Library Media Centers.
Caffarella, Edward P.
1996-01-01
Geared for school library media specialists whose centers are in the early stages of automation or conversion to a new system, this article focuses on major components of media center automation: circulation control; online public access catalogs; machine readable cataloging; retrospective conversion of print catalog cards; and computer networks…
The Oprah Revolution: Book Clubs in Library Media Centers
Littlejohn, Carol
2006-01-01
When Oprah Winfrey began her successful book club in 1996, she continued a tradition that public libraries have provided for decades. Oprah placed a spotlight on reading that encouraged many women who had never read a book "to read." Book clubs sprang up in neighborhoods, bookstores, and on Web sites. Library media centers began offering book…
Multicultural Education: An Action Plan for School Library Media Specialists.
Skeele, Rosemary W.; Schall, Patricia L.
1994-01-01
Offers a definition of and a rationale for multicultural education based on changing demographics and suggests ways for school library media specialists to bring a multicultural perspective to collection development, evaluation of multicultural materials, library services, curriculum integration, and curriculum activities. (Contains 21…
Research into Learning Resulting from Quality School Library Media Service.
Marchant, Maurice P.; And Others
1984-01-01
This annotated bibliography of 20 research reports identifies what has been determined about the effects of library media services on learning and suggests methodologies available for similar studies. Organization is according to area of learning affected--academic achievement; language, reading, and library skills; mathematics; science; social…
Maximising the potential of social media to deliver academic library ...
African Journals Online (AJOL)
The findings revealed that academic libraries in Kenya are currently using Facebook, WhatsApp, YouTube and Twitter to facilitate the sharing of information resources, provision of reference services, formation of professional networks, and promotion of library services. The findings also indicate that the use of social media ...
Alphabet Soup: School Library Media Education in the United States
Underwood, Linda
2007-01-01
Universities offering school library media programs seek accreditation from various regional and national organizations. This accreditation makes the programs valid and marketable. School media programs within a college of education seek accreditation from specialized accrediting bodies. The National Council for Accreditation of Teacher Education…
School Library Media Certification Requirements: 1990 Update.
Perritt, Patsy H.
1990-01-01
Presents a compilation of school library media certification requirements taken from responses to a national survey. For each state, existing certificates or endorsements are listed, along with credit hours and/or experience required, whether it is an accredited or approved program, and required subject areas or competencies. A directory of…
Transforming the Hidden Curriculum: Gender and the Library Media Center.
Crew, Hilary S.
1998-01-01
Library media specialists are critically positioned to make a significant contribution to instituting gender-fair practices within a school. This article discusses instructional materials, curriculum, and collection development; gender culture and the media center; sports, gender, and different ways of knowing; and science, gender, and different…
Developing Social Media to Engage and Connect at the University of Liverpool Library
Chatten, Zelda; Roughley, Sarah
2016-01-01
This case study presents the Liverpool experience of using social media as an academic library to enhance audience engagement and create a community of users. It looks at the development of social media in the library, focusing on the concerted effort to grow followers and develop a meaningful use of these tools. It considers the value of taking a…
Directory of Open Access Journals (Sweden)
Di Pierro F
2012-11-01
Full Text Available Francesco Di Pierro,1 Guido Donato,2 Federico Fomia,3 Teresa Adami,4 Domenico Careddu,5 Claudia Cassandro,6 Roberto Albera61Scientific Department, Velleja Research, Milano, 2ASL 1, Cuneo, 3ASL 3, Brescia, 4Infective Diseases, Verona, 5ASL 13, Novara, 6Surgical Science Department, Università degli Studi, Torino, ItalyBackground: The oral probiotic Streptococcus salivarius K12 has been shown clearly to antagonize the growth of Streptococcus pyogenes, the most important bacterial cause of pharyngeal infections in humans, by releasing two bacteriocins named salivaricin A2 and salivaricin B. Unpublished observations indicate that it can also antagonize the growth of other bacteria involved in acute otitis media. Because of its ability to colonize the oral cavity and its safety profile, we have tested its efficacy in reducing the incidence of streptococcal pharyngitis and/or tonsillitis and episodes of acute otitis media.Methods: We enrolled 82 children, including 65 with and 17 without a recent diagnosis of recurrent oral streptococcal pathology. Of those with recurrent pathology, 45 were treated daily for 90 days with an oral slow-release tablet containing five billion colony-forming units of S. salivarius K12 (Bactoblis®, and the remaining 20 served as an untreated control group. The 17 children without a recent diagnosis of recurrent oral pathology were used as an additional control group. After 90 days of treatment, a 6-month follow-up period without treatment was included to evaluate a possible persistent protective role for the previously administered product.Results: The 41 children who completed the 90-day course of Bactoblis showed a reduction in their episodes of streptococcal pharyngeal infection (about 90% and/or acute otitis media (about 40%, calculated by comparing infection rates in the previous year. The 90-day treatment also reduced the reported incidence of pharyngeal and ear infections by about 65% in the 6-month follow-up period
Public relations and marketing of Nigerian School Library Media ...
African Journals Online (AJOL)
Public relations and marketing of Nigerian School Library Media Centre ... the prevailing group of users in their environment would determine the price range. ... need a very good knowledge of the marketing mix to achieve huge results.
Library/Media Centers in U.S. Public Schools: Growth, Staffing, and Resources. Full Report
Tuck, Kathy D.; Holmes, Dwight R.
2016-01-01
At the request of New Business Item: 89 (NBI: 89) adopted at the 2015 NEA Representative Assembly, this study examines the extent to which students have access to public school library/media centers with qualified staff and up-to-date resources. The study explores trends in library/media center openings and closings as well as staffing patterns…
Teaching Electronic Literacy A Concepts-Based Approach for School Library Media Specialists
Craver, Kathleen W
1997-01-01
School library media specialists will find this concepts-based approach to teaching electronic literacy an indispensable basic tool for instructing students and teachers. It provides step-by-step instruction on how to find and evaluate needed information from electronic databases and the Internet, how to formulate successful electronic search strategies and retrieve relevant results, and how to interpret and critically analyze search results. The chapters contain a suggested lesson plan and sample assignments for the school library media specialist to use in teaching electronic literacy skills
Social Media And Libraries In View Of Sabancı University Information Center
Directory of Open Access Journals (Sweden)
Cem Özel
2018-03-01
Full Text Available This paper focuses on how a university library / information center should use social media tools. The importance of sharing in social media with users has been expressed in the example of Sabancı University Information Center.
1994-01-01
The NASA-OAI High Performance Communication and Computing K- 12 School Partnership program has been completed. Cleveland School of the Arts, Empire Computech Center, Grafton Local Schools and the Bug O Nay Ge Shig School have all received network equipment and connections. Each school is working toward integrating computer and communications technology into their classroom curriculum. Cleveland School of the Arts students are creating computer software. Empire Computech Center is a magnet school for technology education at the elementary school level. Grafton Local schools is located in a rural community and is using communications technology to bring to their students some of the same benefits students from suburban and urban areas receive. The Bug O Nay Ge Shig School is located on an Indian Reservation in Cass Lake, MN. The students at this school are using the computer to help them with geological studies. A grant has been issued to the friends of the Nashville Library. Nashville is a small township in Holmes County, Ohio. A community organization has been formed to turn their library into a state of the art Media Center. Their goal is to have a place where rural students can learn about different career options and how to go about pursuing those careers. Taylor High School in Cincinnati, Ohio was added to the schools involved in the Wind Tunnel Project. A mini grant has been awarded to Taylor High School for computer equipment. The computer equipment is utilized in the school's geometry class to computationally design objects which will be tested for their aerodynamic properties in the Barberton Wind Tunnel. The students who create the models can view the test in the wind tunnel via desk top conferencing. Two teachers received stipends for helping with the Regional Summer Computer Workshop. Both teachers were brought in to teach a session within the workshop. They were selected to teach the session based on their expertise in particular software applications.
The Utilization of Instagram as a Media Promotion : the Case Study of Library in Indonesia
Directory of Open Access Journals (Sweden)
Muhammad Azwar
2018-05-01
Full Text Available This paper aims to explore the Instagram utilization and its obstacles as a media promotion of Pustakalana’s library in Bandung, West Java. The research uses qualitative approach. The informants of this research are Pustakalana’s Instagram administrator and Pustakalana’s coordinator, while data collection techniques consist of observation, interview, literature study, and documentation. Triangulation method is used to test data validity and credibility. Technical data analysis involves of data reduction, data presentation, and conclusion. The results of this study indicate that Pustakalana’s library has been utilized the Instagram to promote its library, such as various activities and services growing children’s creativity and imagination, events and workshops for parents, photographs of popular and recommended book collection, quotes to motivate children to read, and the atmospheres of the library and bookstore which are convenient and exciting, and another library services information. Instagram of Pustakalana’s library is not only used for promoting its activities, but also for sharing information and communication by its followers in media. Instagram features are almost entirely utilized by the library on promotions and interactions in other social media. The promoted content in Instagram account contains all information that relate to the library. Nevertheless, they are obstacles emerge in Pustakalana’s Library such as the incompatibility between the number of followers with the number of likers who are obtained on each uploaded post, and the lack of human resources. DOI: 10.15408/insaniyat.v2i2.7320
School Library Media Specialists and the Internet: Road Kill or Road Warriors?
Barron, Daniel D.
1994-01-01
Discusses use of the Internet by school library media specialists and its importance in the development of the library profession. Highlights include how to access the Internet and resources about the Internet, including information about networks as well as three sources that provide introductions to the general concepts of the Internet. (LRW)
Jangid, Kamlesh; Kao, Ming-Hung; Lahamge, Aishwarya; Williams, Mark A; Rathbun, Stephen L; Whitman, William B
2016-01-01
K-shuff is a new algorithm for comparing the similarity of gene sequence libraries, providing measures of the structural and compositional diversity as well as the significance of the differences between these measures. Inspired by Ripley's K-function for spatial point pattern analysis, the Intra K-function or IKF measures the structural diversity, including both the richness and overall similarity of the sequences, within a library. The Cross K-function or CKF measures the compositional diversity between gene libraries, reflecting both the number of OTUs shared as well as the overall similarity in OTUs. A Monte Carlo testing procedure then enables statistical evaluation of both the structural and compositional diversity between gene libraries. For 16S rRNA gene libraries from complex bacterial communities such as those found in seawater, salt marsh sediments, and soils, K-shuff yields reproducible estimates of structural and compositional diversity with libraries greater than 50 sequences. Similarly, for pyrosequencing libraries generated from a glacial retreat chronosequence and Illumina® libraries generated from US homes, K-shuff required >300 and 100 sequences per sample, respectively. Power analyses demonstrated that K-shuff is sensitive to small differences in Sanger or Illumina® libraries. This extra sensitivity of K-shuff enabled examination of compositional differences at much deeper taxonomic levels, such as within abundant OTUs. This is especially useful when comparing communities that are compositionally very similar but functionally different. K-shuff will therefore prove beneficial for conventional microbiome analysis as well as specific hypothesis testing.
Keeping Current: Emotional Intelligence and the School Library Media Specialist.
Barron, Daniel D.
1997-01-01
Discusses emotional intelligence and its importance for school library media specialists, based on a book by Daniel Goleman called "Emotional Intelligence." Highlights include managing emotions and relationships; self-motivation; and how emotional intelligence fits in with Standards for Information Literacy. (LRW)
E-Everything and the School Library Media Specialist: Grist for the Mill (Part 2).
Barron, Daniel D.
2001-01-01
Discusses electronic books and the need for school library media specialists to merge information literacy and library skills with technology skills. Highlights include advancing technology for electronic books; helpful Web sites, including Project Gutenburg; and reader software. (LRW)
A Travel Agent in Cyber School: The Internet and the Library Media Program.
LeBaron, John F.; And Others
The global computing networks that are revolutionizing our society have created an opportunity for school libraries and librarians. Taking the position that librarians occupy key positions in the educational technology revolution, this book explores how technology-enhanced education improvements fit together with the library media program and how…
K-pop, Indonesian fandom, and social media
Directory of Open Access Journals (Sweden)
Sun Jung
2011-11-01
Full Text Available Around the world, pop consumers are increasingly accessing popular products through social media. Online fan groups of Korean popular music (K-pop in Asia have dynamically and transculturally circulated their product through social media such as Facebook and Twitter. In October 2010, Super Junior, a K-pop idol boy band, was ranked as the number one worldwide trending topic on Twitter—ranking even higher than a sensational news story about trapped Chilean miners. Regional fans in Indonesia in particular have been identified as the source of a spike in tweets on this topic. Such a phenomenon illustrates how social media–empowered online fandom enhances cultural flow and affects transcultural pop circulation dynamics. I examine these dynamics by means of the specific case study of K-pop fandom in Indonesia. By focusing on three specific aspects of new media circulation of K-pop in Indonesia—performing immediate transculturations, embodying K-pop, and building intimacies—I contextualize transnationally focused, newly emerging, and social media–deployed cultural circulation driven by online fan practices.
Who Wants To Win a Million? A Library Media Game.
Singleterry, Jolene
2000-01-01
Describes a library media game for grades four and five that is centered around books and is based on the television show "Who Wants To Be a Millionaire?". Procedures for the game are explained, and examples of questions from simple to more difficult, with answers, are presented. (LRW)
Science and Math in the Library Media Center Using GLOBE.
Aquino, Teresa L.; Levine, Elissa R.
2003-01-01
Describes the Global Learning and Observations to Benefit the Environment (GLOBE) program which helps school library media specialists and science and math teachers bring earth science, math, information literacy, information technology, and student inquiry into the classroom. Discusses use of the Internet to create a global network to study the…
Makerspaces: The Next Iteration for Educational Technology in K-12 Schools
Strycker, Jesse
2015-01-01
With the continually growing number of computers and mobile devices available in K-12 schools, the need is dwindling for dedicated computer labs and media centers. Some schools are starting to repurpose those facilities into different kinds of exploratory learning environments known as "makerspaces". This article discusses this next…
Directory of Open Access Journals (Sweden)
Wang Junyu
2017-12-01
Full Text Available [Purpose/significance] Technology new media are the products of the combination of the technological information and new media communication tools. The innovation of contents, models and carriers are worth all kinds of knowledge service platforms’ reference. [Method/process] This paper selected the top ten new media of “Chinese Technology New Media Ranking in 2016” and combed the contents, communication channels, online and offline activities and profit models of the top ten media to analyze the characteristics of technology new media and the existing problems. [Result/conclusion] Library mobile knowledge service platforms should learn from these technology new media. In the future, library mobile knowledge service platforms should attract more users to take part in contributing knowledge on the basis of ensuring the content quality and form a model of information dissemination, online services and offline activities to make their own market competitiveness.
Mardis, Marcia A.; Dickinson, Gail K.
2009-01-01
Preservice school library media specialists will implement the AASL Standards for the "21st Century Learner" in their new roles. Drafted in 2007, the Standards reflect principles which school library media specialist must impart to learners to prepare them to be knowledge consumers, producers, and communicators in global environments.…
products laboratories publications nisee b.i.p. members education FAQs links education Education Program Internships K-12 Education Contact the PEER Education Program PEER's Educational Affiliates Student Design Competition Student Leadership Council Classes and Other Educational Activities Site Map Search K-12 Education
Collection Development for the School Library Media Program: A Beginner's Guide
Kerby, Mona
2006-01-01
A valuable resource for new or experienced school librarians, "Collection Development for the School Library Media Program: A Beginner's Guide" is an easy-to-use guide to collection development. It provides practical and relevant information about collection development issues such as: the school users, policies, selection criteria and sources,…
Media discourse on Split reading rooms and libraries in Dalmatian periodicals (1862 - 1918
Directory of Open Access Journals (Sweden)
Ivanka Kuić
2013-03-01
Full Text Available The paper focuses on the media discourse on reading rooms and libraries as a historical phenomenon that describes the role and place of reading rooms and libraries in Dalmatia in the 60ties of the 19th century and World War I. The papers in Dalmatian newspapers from that period, as materialized forms of discourse, answer many important questions related to the history of Croatian librarianship: how were the reading rooms and libraries established and what crucial concept determined their role and place in a particular period in history. The paper presents the historical concept, conditions in which the discourse occurred, discourse types and functions, conceptual structure, and transformation processes towards new discourse practices. The discourse analysis has shown that the reading rooms and libraries are cultural artifacts strongly influenced by the social context. Two stages in the development of discourse have been identified: in the first stage the discourse takes a considerable role in metaphorical games and construction of mythical structures - ethnic identity, national unity and language community. On the conceptual level the role of reading rooms and libraries is recognized in the deconstruction of traditional relations - they are a territorially separate, exclusive place of symbolic production, creation of new social structures and cultural values. In that context, the activities of libraries are underrepresented compared to other activities of reading rooms. The second stage, which started in the 90ies of the 19th century, is marked by discourse multiplication, differentiation of library organization structure and function from other functions of culture, and the strong influence of new discourse. The media discourse presents the change of conceptual structures, in which the role and place of libraries is interpreted in the context of the role of knowledge and education in meeting society goals in the situation of social
Soil Science Society of America - K-12 Outreach
Lindbo, David L.; Loynachan, Tom; Mblia, Monday; Robinson, Clay; Chapman, Susan
2013-04-01
The Soil Science Society of America created its K12 Committee in 2006 in part to compliment the Dig It! The Secrets of Soil exhibit that opened in July 2008 at the Smithsonian's Institution's Nation Museum of Natural History (of which SSS was a founding sponsor). The committee's work began quickly with a website designed to provide resources for K12 teachers. The first accomplishments included reviewing and posting links to web based information already available to teachers. These links were sorted by subject and grade level to make it easier for teachers to navigate the web and find what they needed quickly. Several presentations and lessons designed for K12 teachers were also posted at this time. Concurrent with this effort a subcommittee review and organized the national teaching standards to show where soils could fit into the overall K12 curriculum. As the website was being developed another subcommittee developed a soils book (Soil! Get the Inside Scoop, 2008) to further compliment the Dig It! exhibit. This was a new endeavor for SSSA having never worked with the non-academic audience in developing a book. Peer-reviews of this book included not only scientist but also students in order to make sure the book was attractive to them. Once the book was published and the website developed it became clear more outreach was needed. SSSA K12 Committee has attended both the National Science Teachers Association (since 2008) the USA Science and Engineering Festival (since 2010) with exhibits and workshops. It has cooperated and contributed to the American Geologic Institutes' Earth Science Week materials with brochures and lesson plans and with National Association of Conservation Districts by providing peer-review and distribution of materials. The most recent developments from the committee include a web redesign that is more student and teacher friendly, the development of a peer-review system to publish K12 Lesson Plans, and finally the publication of a new soils
Wesson, Caren L., Ed.; Keefe, Margaret J., Ed.
This collection of papers considers how the school library media specialist serves special needs students and classroom teachers in multiple roles as teacher, information specialist, and instructional consultant or collaborator. Included are the following papers: "Teaching Library and Information Skills to Special Needs Students" (Caren…
Continuing Education Needs and the Professional Reading of School Library Media Specialists.
Latrobe, Kathy
1992-01-01
Reports results of a survey of school library media specialists in Oklahoma regarding continuing education activities and topics. Data are presented on the relative importance of several continuing education activities, percentage of respondents regularly reading specific journals, and continuing education topics ranked by respondents' prioritized…
Social Media Analysis For Organizations: Us Northeastern Public And State Libraries Case Study
Collins, Matthew; Karami, Amir
2018-01-01
Social networking sites such as Twitter have provided a great opportunity for organizations such as public libraries to disseminate information for public relations purposes. However, there is a need to analyze vast amounts of social media data. This study presents a computational approach to explore the content of tweets posted by nine public libraries in the northeastern United States of America. In December 2017, this study extracted more than 19,000 tweets from the Twitter accounts of sev...
Gretz, Marianne; And Others
1996-01-01
The Boehringer Mannheim Library (Germany) switched its loose-leaf pharmacopoeias from printed versions to electronic media. Discusses the decision-making and implementation process, and considers costs, technical requirements, availability of databases, user acceptance, installation, maintenance, and skills needed. Found that electronic media…
International recognition of the Chronic Otitis Media Questionnaire 12.
Kosyakov, S I; Minavnina, J V; Phillips, J S; Yung, M W
2017-06-01
The Chronic Otitis Media Questionnaire 12 was developed initially in the UK to assess patient-reported health-related quality of life associated with chronic otitis media. This study aimed to determine whether this tool is applicable to the Russian population, which has a materially different healthcare system. A total of 108 patients with different forms of chronic otitis media completed the Russian Chronic Otitis Media Questionnaire 12. The average Russian Chronic Otitis Media Questionnaire 12 score was 19.4 (standard deviation = 8.3). The internal consistency of the Russian Chronic Otitis Media Questionnaire 12 was high, with a Cronbach's alpha value of 0.860. The Russian version of the Chronic Otitis Media Questionnaire 12 was found to be a reliable tool for the assessment of health-related quality of life in patients with chronic otitis media. This sets the scene for international collaboration, using this tool to assess the effectiveness of surgical treatments even amongst countries with different healthcare systems.
The Usage of Web 2.0 as a Media Promotion in Indonesia University Libraries
Directory of Open Access Journals (Sweden)
Nove E. Variant Anna
2015-04-01
Full Text Available The usage of web 2.0 has become popular among young people in Indonesia. One of the purpose of using web 2.0 is for promotion in some university libraries. The emerging of the web 2.0 as promotional media is corelating with the development of digital library. The paper aims are (1 to describe the usage of web 2.0 for academic libraries promotion. (2 to describe the information / content of those web 2.0. (3 to describe the promotion activity through web 2.0. This research population is all university libraries in Indonesia, but only 40 university libraries that conduct promotion through web 2.0. The website observation is done between May-July 2013. The research results are (1 the university libraries in Indonesia are use facebook, twitter, and flicker to promote library programs and interaction with users. The web 2.0 consist of information about new book release, user education, general information about library services, and information literacy. (3 some of univerity libraries taking seriously and actively promote their library services, but some of them are don’t use the web 2.0.
The Usage of Web 2.0 as a Media Promotion in Indonesia University Libraries
Directory of Open Access Journals (Sweden)
Nove E. Variant Anna
2018-01-01
Full Text Available The usage of web 2.0 has become popular among young people in Indonesia. One of the purpose of using web 2.0 is for promotion in some university libraries. The emerging of the web 2.0 as promotional media is corelating with the development of digital library. The paper aims are (1 to describe the usage of web 2.0 for academic libraries promotion. (2 to describe the information / content of those web 2.0. (3 to describe the promotion activity through web 2.0. This research population is all university libraries in Indonesia, but only 40 university librraries that conduct promotion through web 2.0. The website observation is done between May-July 2013. The research results are (1 the university libraries in Indonesia are use facebook, twitter, and flikr to promote library programs and interaction with users. The web 2.0 consist of information about new book release, user education, general information about library services, and information literacy. (3 some of univerity libraries taking seriously and actively promote their library services, but some of them are don’t use the web 2.0.
Automation and Its Funding in the Library Media Centers in Secondary Schools in Georgia: A Survey.
Baggett, Ann Utsey
This report presents the results of a study whose purpose was to determine what automation is present in the library media centers in Georgia secondary schools and how it has been funded. A three-part questionnaire was sent to the media specialists in 50% of the secondary schools in Georgia, which were randomly selected. The analysis of the…
Vanwynsberghe, Hadewijch; Boudry, Elke; Vanderlinde, Ruben; Verdegem, Pieter
2014-01-01
Purpose – Based on the social capital theory, we assume that personal and professional experts are both relevant to people’s competence development. However, to date, there is little empirical evidence of how professional experts can support, or impede, people in learning how to deal with social media. The goal of this study is to examine the role and position of social media experts in the distribution of information on social media within the library as organization. Design/ methodology/...
Directory of Open Access Journals (Sweden)
Ann Medaille
2011-03-01
Full Text Available Objective – To determine whether a significant, positive relationship exists between flexible scheduling in elementary school library media centers and per-pupil circulation statistics.Design – Online survey.Setting – Library media centers in public elementary schools in two states of the United States.Subjects – A total of 88 elementary school library media specialists completed the survey.Methods – A 22-question online survey was created using Inquisite software. A link to the survey was sent via e-mail to a 600-person random sample of public school library media specialists whose names were drawn from the memberships of the North Carolina School Library Media Association and the Virginia Educational Media Association, with combined memberships totalling approximately 2,000. A random sample of 600 was chosen to provide a 95% confidence level with a confidence interval of plus or minus three points. The survey included questions about school schedules (flexible, partially flexible, or fixed, collection size, circulation statistics, total student enrolment, school type (elementary, middle, or high, school location (urban, rural, or suburban, percentage of students eligible for free and reduced price lunch, numbers of full-time professional library media specialists employed at the school, access procedures, and library closure information. The survey response rate was 29.3% (176 respondents. Because fixed versus flexible scheduling is an issue that primarily affects elementary schools, the authors further narrowed their subject pool to 88 elementary school respondents. Data were analyzed using SPSS 16.0 statistical software. Correlation analysis, including the analysis of covariance (ANCOVA, was used to compare differences in the three scheduling types and to control for other variables (such as location, socioeconomic status, collection size, staffing, days closed, and others that may affect circulation.Main Results – Of the 88
Commercial Social Media and the Erosion of the Commons: Implications for Academic Libraries
Lilburn, Jeff
2012-01-01
Recent scholarship challenges the celebratory discourse surrounding Web 2.0. This paper engages with this scholarship to examine critically the implications of academic libraries' presence within commercially owned social media spaces. It considers the apparent contradiction between work to promote the principles of open access and the idea of the…
Pan, Tony; Flick, Patrick; Jain, Chirag; Liu, Yongchao; Aluru, Srinivas
2017-10-09
Counting and indexing fixed length substrings, or k-mers, in biological sequences is a key step in many bioinformatics tasks including genome alignment and mapping, genome assembly, and error correction. While advances in next generation sequencing technologies have dramatically reduced the cost and improved latency and throughput, few bioinformatics tools can efficiently process the datasets at the current generation rate of 1.8 terabases every 3 days. We present Kmerind, a high performance parallel k-mer indexing library for distributed memory environments. The Kmerind library provides a set of simple and consistent APIs with sequential semantics and parallel implementations that are designed to be flexible and extensible. Kmerind's k-mer counter performs similarly or better than the best existing k-mer counting tools even on shared memory systems. In a distributed memory environment, Kmerind counts k-mers in a 120 GB sequence read dataset in less than 13 seconds on 1024 Xeon CPU cores, and fully indexes their positions in approximately 17 seconds. Querying for 1% of the k-mers in these indices can be completed in 0.23 seconds and 28 seconds, respectively. Kmerind is the first k-mer indexing library for distributed memory environments, and the first extensible library for general k-mer indexing and counting. Kmerind is available at https://github.com/ParBLiSS/kmerind.
Snyder, Timothy
The purpose of this book is to help professional librarians gain administrator support for the library media center. The book is divided into three sections. Part 1, "Setting the Stage," explores the challenge and aspects of accountability that can be lost in the pressures of daily accomplishment. It details the personality characteristics found…
A Computer Library for Ray Tracing in Analytical Media
International Nuclear Information System (INIS)
Miqueles, Eduardo; Coimbra, Tiago A; Figueiredo, J J S de
2013-01-01
Ray tracing technique is an important tool not only for forward but also for inverse problems in Geophysics, which most of the seismic processing steps depends on. However, implementing ray tracing codes can be very time consuming. This article presents a computer library to trace rays in 2.5D media composed by stack of layers. The velocity profile inside each layer is such that the eikonal equation can be analitically solved. Therefore, the ray tracing within such profile is made fast and accurately. The great advantage of an analytical ray tracing library is the numerical precision of the quantities computed and the fast execution of the implemented codes. Although ray tracing programs already exist for a long time, for example the seis package by Cervený, with a numerical approach to compute the ray. Regardless of the fact that numerical methods can solve more general problems, the analytical ones could be part of a more sofisticated simulation process, where the ray tracing time is completely relevant. We demonstrate the feasibility of our codes using numerical examples.
Pappas, Marjorie L.
2004-01-01
Virtual libraries are becoming more and more common. Most states have a virtual library. A growing number of public libraries have a virtual presence on the Web. Virtual libraries are a growing addition to school library media collections. The next logical step would be personal virtual libraries. A personal virtual library (PVL) is a collection…
Creating a Lean, Green, Library Machine: Easy Eco-Friendly Habits for Your Library
Blaine, Amy S.
2010-01-01
For some library media specialists, implementing the three Rs of recycling, reducing, and reusing comes easily; they've been environmentally conscious well before the concept of going green made its way into the vernacular. Yet for some of library media specialists, the thought of greening their library, let alone the entire school, can seem…
Purcell, Melissa
2010-01-01
Media centers have been transformed from warehouses for books and equipment into the hub of the learning community. Media specialists keep the hub functioning properly. If school library media specialists are doing their job well, they are making a difference in the ways teachers teach and in the ways students learn. On any given day, a media…
Immroth, Barbara; Lukenbill, W. Bernard
2007-01-01
This research was supported in part though an IMLS Kent State University Grant supporting Information Literacy. Based on the importance of teacher-school library media specialist collaboration, this study seeks to advance knowledge involving the dynamics of this special relationship. The subjects were a group of student librarians--themselves…
Progress on Nuclear Data Covariances: AFCI-1.2 Covariance Library
International Nuclear Information System (INIS)
Oblozinsky, P.; Oblozinsky, P.; Mattoon, C.M.; Herman, M.; Mughabghab, S.F.; Pigni, M.T.; Talou, P.; Hale, G.M.; Kahler, A.C.; Kawano, T.; Little, R.C.; Young, P.G
2009-01-01
Improved neutron cross section covariances were produced for 110 materials including 12 light nuclei (coolants and moderators), 78 structural materials and fission products, and 20 actinides. Improved covariances were organized into AFCI-1.2 covariance library in 33-energy groups, from 10 -5 eV to 19.6 MeV. BNL contributed improved covariance data for the following materials: 23 Na and 55 Mn where more detailed evaluation was done; improvements in major structural materials 52 Cr, 56 Fe and 58 Ni; improved estimates for remaining structural materials and fission products; improved covariances for 14 minor actinides, and estimates of mubar covariances for 23 Na and 56 Fe. LANL contributed improved covariance data for 235 U and 239 Pu including prompt neutron fission spectra and completely new evaluation for 240 Pu. New R-matrix evaluation for 16 O including mubar covariances is under completion. BNL assembled the library and performed basic testing using improved procedures including inspection of uncertainty and correlation plots for each material. The AFCI-1.2 library was released to ANL and INL in August 2009.
GenoBase: comprehensive resource database of Escherichia coli K-12.
Otsuka, Yuta; Muto, Ai; Takeuchi, Rikiya; Okada, Chihiro; Ishikawa, Motokazu; Nakamura, Koichiro; Yamamoto, Natsuko; Dose, Hitomi; Nakahigashi, Kenji; Tanishima, Shigeki; Suharnan, Sivasundaram; Nomura, Wataru; Nakayashiki, Toru; Aref, Walid G; Bochner, Barry R; Conway, Tyrrell; Gribskov, Michael; Kihara, Daisuke; Rudd, Kenneth E; Tohsato, Yukako; Wanner, Barry L; Mori, Hirotada
2015-01-01
Comprehensive experimental resources, such as ORFeome clone libraries and deletion mutant collections, are fundamental tools for elucidation of gene function. Data sets by omics analysis using these resources provide key information for functional analysis, modeling and simulation both in individual and systematic approaches. With the long-term goal of complete understanding of a cell, we have over the past decade created a variety of clone and mutant sets for functional genomics studies of Escherichia coli K-12. We have made these experimental resources freely available to the academic community worldwide. Accordingly, these resources have now been used in numerous investigations of a multitude of cell processes. Quality control is extremely important for evaluating results generated by these resources. Because the annotation has been changed since 2005, which we originally used for the construction, we have updated these genomic resources accordingly. Here, we describe GenoBase (http://ecoli.naist.jp/GB/), which contains key information about comprehensive experimental resources of E. coli K-12, their quality control and several omics data sets generated using these resources. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.
Student Library Pages: Valuable Resource for the Library Media Center.
Crowther, Eleanor
1993-01-01
Describes the use of students as library pages at the Loudoun Country Day School (Virginia). Highlights include student selection procedures, including interviews; parental consent form; library page duties; benefits to students; benefits to the library; and parent attitudes. Copies of the student interview form and parental consent form are…
Moreillon, Judi
2008-01-01
Two Heads Are Better than One: The Factors Influencing the Understanding and Practice of Classroom-Library Collaboration proposed to identify the factors involved in educating future K-8 classroom teachers about collaboration for instruction with school library media specialists (SLMSs). This longitudinal study monitored the growth of teacher…
Teaching Web 2.0 beyond the library: adventures in social media, the class.
Farrell, Ann M; Mayer, Susan H; Rethlefsen, Melissa L
2011-01-01
Librarians at the Mayo Clinic developed customized Web 2.0 courses for library staff, health science faculty, and nurse educators. As demand for this type of training spread across the institution, a single, self-paced class was developed for all employees. The content covered the typical Web 2.0 and social media tools (e.g., blogs, really simple syndication [RSS], wikis, social networking tools) emphasizing the organization's social media guidelines. The team consulted with the public affairs department to develop the class and coordinate marketing and advertising. The eight-module, blog-based course was introduced to all employees in 2010. Employees completing each module and passing a brief assessment receive credit on their employee transcript. Libraries staff provided support to participants throughout the duration of the course through chat widgets, e-mail, and blog comments. The results show that even though a high number of learners accessed the course, the completion percentage was low since there was no requirement to complete the course. Deploying a single, self-paced course for a large institution is an enormous undertaking, requiring the support of high level administration, managers, and employees.
A Survey of K-12 Teachers' Utilization of Social Networks as a Professional Resource
Hunter, Leah J.; Hall, Cristin M.
2018-01-01
Teachers are increasingly using social networks, including social media and other Internet applications, to look for educational resources. This study shares results from a survey examining patterns of social network application use among K-12 teachers in the United States. A sample of 154 teachers (18 males, 136 females) in the United States…
Beyond Concern: K-12 Faculty and Staff's Perspectives on Privacy Topics and Cybersafety
Hipsky, Shellie; Younes, Wiam
2015-01-01
In a time when discussions about information privacy dominate the media, research on Cybersafety education reveals that K-12 teachers and staff are concerned about information privacy in schools and they seek to learn more about the protection of their students' and own personal information online. Privacy topics are typically introduced to the…
The Impact of Electronic Media on Research and Education. Role of Libraries in Information Service
Evstigneeva, Galina; Wegner, Bernd
The paper gives a short survey how electronic media have changed the working conditions at research institutions, universities and higher schools, which new possibilities in research and education emerge from this, and which problems will have to be solved with respect to this in the future. We shall concentrate our attention on the role of the libraries as information brokers in such an environment. In this context archiving of electronic documents, software and access systems will be addressed as one of the challenging future tasks of libraries. Each of these themes may serve as a subject for a seminar on its own. Hence the paper only can highlight some of these features referring to more detailed work elsewhere. At the beginning the main classes of electronic offers providing infrastructure for research and education are introduced. The role of editors, publishers, software producers and web managers is shortly discussed. Information gateways and information brokers are important for the distribution of these offers. The impact of electronic media on research and education is described by representative examples of different types. Some final conclusions deal with the problems to be solved in the future when electronic media will occupy the central place in the daily work of professionals, researchers and teachers.
Directory of Open Access Journals (Sweden)
Tina M Adams
2018-02-01
Full Text Available As VCRs and DVD players become obsolete, online course offerings increase, and flipped pedagogy becomes ubiquitous, academic librarians are frequently confronted with requests from instructors for streaming media. The authors of this article describe the reasoning for and process by which a policy and best practices to manage streaming media requests were developed at a large public university. This policy is guided by the principles set forth in U.S. Copyright Act’s fair use doctrine (17 U.S.C. § 107 and ARL’s Code of Best Practices in Fair Use for Academic and Research Libraries (2012. The policy also includes a workflow for delivering streaming, ADA-compliant video content that cannot be licensed via conventional library means. Moreover, the comparative costs of purchasing subscription video collections versus licensing individual streaming videos at George Mason University are provided for the fiscal years 2013 through 2016.
Growth study of radio-mutant saccharomyce cerevisiae K 1,5 on irradiated molases media
International Nuclear Information System (INIS)
Siagian, E.G.; Lina, M.R.; Sisiana.
1988-01-01
The application of the radiopasteurization method for alcoholic fermentation of molases media have been studied which compared to heat pasteurization. The molases samples were obtained from sugar industry in Cirebon, Yogyakarta, and Lawang, used as a samples for gamma irradiation, doses of 3 kGy, 6 kGy and heat pasteurization 80 Celcius centigrade for 30 minutes, which compared to untreated molases. Innculum yeast was S. Cerevisiae K 1.5 which was resulted by irradiation mutation. The results showed that gamma irradiation dose of 3 kGy have pasteurization effect better than 6 kGy and heat pasteurization 80 Celcius centigrade, 30 minutes. Total cells count of microflora per gram samples (% survivors) on molasses media which has been heat pasteurized, decreased to be 70%, 10% for irradiated molasses 3 kGy; and 1% for molasses irradiated 6 kGy, but it did not have significant effect on the growth capacity of S. cerevisiae K 1.5 on that molasses media. Microflora isolated from molasses samples obtained from Cirebon, Yogyakarta, and Lawang, generally from Bacillus subtilis, Lactobacillus sp., Corynebacterium sp., and Rhizopus oligosporus, although was detected but not grows well on molasses media. The growth of S. cerevisiae K 1.5 on fermentation media suplemented with trace elements nitrogen and phosphor resulted difference on fermentation rate i.e.: in irradiated molasses 3 kGy and 6 kGy showed a higher rate, which compared to heat pasteurization and controle. In the environment condition study on molasses media shows the yeast S. cerevisiae K 1.5 have optimal growth at the pH 5.5, specific growth rate 0.3-0.5 per hour, the saturation constant 0.5 - 0.60 g/l, temperature 30 +/- 2 Celcius centigrade with sugar : nitrogen : phosphor ratio = 100 : 5 : 1. The nitrogen and phosphor sources are ammonium sulphate and sodium hidrogen phosphate respectively. (author). 6 refs, 2 figs, 2 tabs
The Ideas of Henry Jenkins and Libraries
Anderson, Byron
2008-01-01
Henry Jenkins, director of the Comparative Media Studies Program at the Massachusetts Institute of Technology and keynote speaker at the 2007 American Library Association's "Gaming, Learning and Libraries Symposium" in Chicago is a visionary leader in the areas of new media and media convergence. In a white paper on digital media and learning…
Torrise, Michelle L.
2010-01-01
Some of the author's most valuable experiences as a library media specialist (LMS) were not in a school library. Rather, they were on the streets of Chicago, in community gardens, and on the rooftops of buildings in Humboldt Park, where she was hired by the University of Illinois Community Informatics Initiative as a graduate assistant and LMS in…
Quadri, Ganiyu Oluwaseyi; Adebayo Idowu, Oluwafemi
2016-01-01
This study investigated social media use for information dissemination by librarians in federal university libraries in Southwest Nigeria. A descriptive survey method was adopted for the study, while the sample consisted of all 82 librarians in the selected universities. A questionnaire was the instrument used for data collection, while the data…
Building a Digital Library for Multibeam Data, Images and Documents
Miller, S. P.; Staudigel, H.; Koppers, A.; Johnson, C.; Cande, S.; Sandwell, D.; Peckman, U.; Becker, J. J.; Helly, J.; Zaslavsky, I.; Schottlaender, B. E.; Starr, S.; Montoya, G.
2001-12-01
The Scripps Institution of Oceanography, the UCSD Libraries and the San Diego Supercomputing Center have joined forces to establish a digital library for accessing a wide range of multibeam and marine geophysical data, to a community that ranges from the MGG researcher to K-12 outreach clients. This digital library collection will include 233 multibeam cruises with grids, plots, photographs, station data, technical reports, planning documents and publications, drawn from the holdings of the Geological Data Center and the SIO Archives. Inquiries will be made through an Ocean Exploration Console, reminiscent of a cockpit display where a multitude of data may be displayed individually or in two or three-dimensional projections. These displays will provide access to cruise data as well as global databases such as Global Topography, crustal age, and sediment thickness, thus meeting the day-to-day needs of researchers as well as educators, students, and the public. The prototype contains a few selected expeditions, and a review of the initial approach will be solicited from the user community during the poster session. The search process can be focused by a variety of constraints: geospatial (lat-lon box), temporal (e.g., since 1996), keyword (e.g., cruise, place name, PI, etc.), or expert-level (e.g., K-6 or researcher). The Storage Resource Broker (SRB) software from the SDSC manages the evolving collection as a series of distributed but related archives in various media, from shipboard data through processing and final archiving. The latest version of MB-System provides for the systematic creation of standard metadata, and for the harvesting of metadata from multibeam files. Automated scripts will be used to load the metadata catalog to enable queries with an Oracle database management system. These new efforts to bridge the gap between libraries and data archives are supported by the NSF Information Technology and National Science Digital Library (NSDL) programs
Validation of the 172 group ENDFB7GX library
International Nuclear Information System (INIS)
Khan, Suhail Ahmad; Raj, Devesh; Karthikeyan, R.; Jagannathan, V.
2007-01-01
Full text: Five 172 group libraries, viz., IAEAGX, ENDFB6GX, JENDL3GX, JEFF31GX, and LWRPSGX were obtained as a part of the IAEA WIMS Library Update Project (WLUP). The first four libraries have data available for 173 nuclides up to 244 Cm. The LWRPSGX library based on JEFF3.1 point dataset is an extended library up to 252 Cf. Data for 12 more actinides and the related burnup chain were added. The five libraries were validated against known experiments in an earlier work. In general the LWRPSGX was found to be giving better results. Recently another version of 172 group library 'ENDFB7GX' has been released. In the present work we provide the results of validation of the ENDFB7GX library against the same set of experimental data and a comparison with results of other libraries. The experimental configuration data include a variety of uniform lattices with enriched UO 2 , U- metal, mixed oxide (UO 2 -PuO 2 ) fuels with H 2 O and D 2 O moderators for a wide range of enrichment, fuel diameter and ratio of moderator to fuel volume (V m /V f ). The calculations have been done using the code LATTEST which solves the single pin lattice cell problem by 1-D multi-group transport theory after cylindricalising the square or hexagonal cell boundary. The LATTEST code is an improved version of the MURLI code and is capable of providing a ready testing of any new cross section library against a set of experimental benchmark lattices collected from various sources. The calculated k eff values and certain spectral indices, where available, have been compared for all the libraries for more than hundred critical lattices. There is a general under prediction of k eff values by all libraries. The maximum under prediction is for ENDFB6GX library and the least is for JENDL3GX library. The ENDFB7GX library, in general, is found to over predict in comparison to the k eff values obtained using LWRPSGX library. While scrutinizing the basic nuclear data it was noted that the slowing down cross
Harvey, John F.
1979-01-01
Discusses the state of Iranian libraries since the revolution: the printing industry flourishes because of obsolete copyright laws, and the government is attempting to dewesternize media and education. Also considered are budget cuts, the revolution's cost to libraries, and its effect on individual librarians. (SW)
Using Scientific Visualizations to Enhance Scientific Thinking In K-12 Geoscience Education
Robeck, E.
2016-12-01
The same scientific visualizations, animations, and images that are powerful tools for geoscientists can serve an important role in K-12 geoscience education by encouraging students to communicate in ways that help them develop habits of thought that are similar to those used by scientists. Resources such as those created by NASA's Scientific Visualization Studio (SVS), which are intended to inform researchers and the public about NASA missions, can be used in classrooms to promote thoughtful, engaged learning. Instructional materials that make use of those visualizations have been developed and are being used in K-12 classrooms in ways that demonstrate the vitality of the geosciences. For example, the Center for Geoscience and Society at the American Geosciences Institute (AGI) helped to develop a publication that outlines an inquiry-based approach to introducing students to the interpretation of scientific visualizations, even when they have had little to no prior experience with such media. To facilitate these uses, the SVS team worked with Center staff and others to adapt the visualizations, primarily by removing most of the labels and annotations. Engaging with these visually compelling resources serves as an invitation for students to ask questions, interpret data, draw conclusions, and make use of other processes that are key components of scientific thought. This presentation will share specific resources for K-12 teaching (all of which are available online, from NASA, and/or from AGI), as well as the instructional principles that they incorporate.
Xu, S.; Walczak, J. J.; Wang, L.; Bardy, S. L.; Li, J.
2010-12-01
In this research, we investigate the effects of starvation on the transport of E. coli K12 in saturated porous media. Particularly, we examine the relationship between such effects and the pH and ionic strength of the electrolyte solutions that were used to suspend bacterial cells. E. coli K12 (ATCC 10798) cells were cultured using either Luria-Bertani Miller (LB-Miller) broth (10 g trypton, 5 g yeast extract and 10 g NaCl in 1 L of deionized water) or LB-Luria broth (10 g tryptone, 5 g yeast extract and 0.5 g NaCl in 1 L of deionized water). Both broths had similar pH (~7.1) but differed in ionic strength (LB-Miller: ~170 mM, LB-Luria: ~ 8 mM). The bacterial cells were then harvested and suspended using one of the following electrolyte solutions: phosphate buffered saline (PBS) (pH ~7.2; ionic strength ~170 mM), 168 mM NaCl (pH ~5.7), 5% of PBS (pH ~ 7.2; ionic strength ~ 8 mM) and 8 mM NaCl (pH ~ 5.7). Column transport experiments were performed at 0, 21 and 48 hours following cell harvesting to evaluate the change in cell mobility over time under “starvation” conditions. Our results showed that 1) starvation increased the mobility of E. coli K12 cells; 2) the most significant change in mobility occurred when bacterial cells were suspended in an electrolyte solution that had different pH and ionic strength (i.e., LB-Miller culture suspended in 8 mM NaCl and LB-Luria culture suspended in 168 mM Nacl); and 3) the change in cell mobility primarily occurred within the first 21 hours. The size of the bacterial cells was measured and the surface properties (e.g., zeta potential, hydrophobicity, cell-bound protein, LPS sugar content, outer membrane protein profiles) of the bacterial cells were characterized. We found that the measured cell surface properties could not fully explain the observed changes in cell mobility caused by starvation.
Naidoo, Jamie Campbell; Sweeney, Miriam E.
2015-01-01
Library and Information Science (LIS) as a discipline is guided by core values that emphasize equal access to information, freedom of expression, democracy, and education. Importantly, diversity and social responsibility are specifically called out as foundations of the profession (American Library Association, 2004). Following from this, there…
Research Libraries and the internet
DEFF Research Database (Denmark)
Finnemann, Niels Ole
2014-01-01
The paper argues that digital media have a disruptive potential, but path dependency is often a modifying component in the historical development. This is demonstrated in different stages of the development of the interrelationship between digitization, digital media and research libraries. Today...... the historical dynamic has reached a point where all institutions concerned with knowledge handling will have to redefine themselves. Research libraries are gradually incorporated into a number of new “research infrastructures” which are being built around different kinds of data materials, and each research...... library may specialize according to some sort of coordinated criteria....
Nucleoli in human early erythroblasts (K2, K1, K1/2 cells).
Smetana, K; Jirásková, I; Klamová, H
2005-01-01
Human early erythroid precursors classified according to the nuclear size were studied to provide information on nucleoli in these cells using simple cytochemical procedures for demonstration of RNA and proteins of silver-stained nucleolar organizers. K2 cells with nuclear diameter larger than 13 microm and K1 cells with nuclear diameter larger than 9 microm corresponding to proerythroblasts and macroblasts (large basophilic erythroblasts) mostly possessed large irregularly shaped nucleoli with multiple fibrillar centres representing "active nucleoli". K1/2 cells with nuclear diameter smaller than 9 microm corresponding to small basophilic erythroblasts were usually characterized by the presence of micronucleoli representing "inactive nucleolar types". On the other hand, a few K1/2 cells contained large nucleoli with multiple fibrillar centres similar to those present in K2 cells and thus appeared as "microproerythroblasts". The nucleolar asynchrony expressed by the presence of large irregularly shaped nucleoli with multiple nucleoli (active nucleoli) and ring-shaped nucleoli (resting nucleoli) in one and the same nucleus of K2 or K1 cells was not exceptional and might reflect a larger resistance of these cells to negative factors influencing the erythropoiesis. The intranucleolar translocation of silver-stained nucleolus organized regions was noted in K2 cells and might indicate the premature aging of these cells without further differentiation. More studies, however, are required in this direction.
Hakulinen, Erkki
1974-01-01
A survey at the Karolinska Institutet Bibliotek in Sweden, and a comparison with an earlier survey at the National Lending Library, showed that conventional bibliographical information media are still responsible for the major part of information about biomedical literature. (Author/LS)
Directory of Open Access Journals (Sweden)
Gayle Bogel
2006-12-01
Full Text Available Objective – This study explored links between school libraries and student learning outcomes that were defined in a multidimensional context, using data provided by the students themselves. The researchers examined learning outcomes that reached beyond the existing correlations of school library services and standardized test scores. Insight was provided into the interactions between students and school libraries that affect student learning. An overarching goal of the study was to establish ongoing dialogue to focus on evidence based practices that may lead to continuous improvement in school library services and to provide the basis for further research.Design – Web based survey.Subjects – Participants were 13,123 students in grades 3‐12 and 879 faculty at 39 schools across the state.Setting – Ohio Public school libraries.Methods – Thirty‐nine effective school libraries, staffed by credentialed school librarians, were chosen through a judgment sampling process, using criteria based on Ohio Guidelines for Effective School Library Media Programs. The guidelines are aligned to academic content standards, assessments, resources, and professional development. Two web based surveys were used to collect quantitative and qualitative data from students and faculty: 1. The Impacts on Learning Survey, composed of Likert scale responses to 48 statements and an open‐ended critical incident question for students. 2. The Perceptions of Learning Impacts Survey was a similar survey for faculty. Survey questions were based on Dervin’s theory of information seeking that advances the idea of ‘helps’ as the constructive process of bridging gaps in information use that lead to new knowledge or making sense (sense‐making in relation to a perceived information need (Todd and Kuhlthau. The term ‘helps’ includes both inputs (help that the school library provides in engaging students in learning and outputs (learning outcomes of academic
Lea, Mark Keith
2013-01-01
During this period of radical change in the field of information technology there is evidence of confusion about the role of school library media specialists in the implementation, and the administration of emerging information technologies in Wisconsin public schools. This study sought to answer the question what is the role of the school library…
Directory of Open Access Journals (Sweden)
Gheorghe Buluţă
2011-01-01
Full Text Available The psycho-social phenomena generated by mass-media and the new information and communication technologies at the level of the young generations have led to new communication practices that bypass libraries and revolutionized the intellectual labor practices, with texts being rather used than read. In this context, our article examines the need to increase the library's role in developing the quality of education and research and brings to attention a few possible solutions which include a partnership between various types of libraries and between librarians' associations and NGOs to facilitate education through library and safeguard reading.
The Library as Consumer: Problems and Prospects of Libraries as Institutional Consumers.
Penchansky, Mimi; And Others
The Library Association of the City University of New York provides a bibliography of information sources, books, and articles to aid the library in its role as a consumer of materials and equipment. Some subjects covered include furniture, product evaluations, book selection and acquisition, media materials and equipment, periodicals, book costs,…
36 CFR 701.1 - Information about the Library.
2010-07-01
... § 701.1 Information about the Library. (a) Information about the Library. It is the Library's policy to... contacts with media representatives about the Library and its policies or activities. ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Information about the Library...
Quasi-free K+ photo-production in 12C
International Nuclear Information System (INIS)
Maeda, K.; Yamazaki, H.; Asano, S.; Emura, T.; Endo, I.; Endo, S.; Ito, S.; Itoh, H.; Ifuku, K.; Konno, O.; Koike, M.; Maruyama, K.; Niki, K.; Niwa, K.; Okuno, H.; Sakaguchi, A.; Sasaki, T.; Suda, T.; Sumi, Y.; Takeya, M.; Terasawa, T.; Uchida, H.; Yamashita, H.; Yoshida, K.
1994-01-01
Quasi-free K + photo-production in the 12 C(γ,K + ) reaction has been investigated in a photon energy range of 0.7-1.1GeV. Differential cross sections for the quasi-free process of the 12 C(γ,K + ) reaction have been obtained and they are compared with a calculation of a quasi-free K + photo-production. The effective proton number Z eff =4.2±0.6 obtained from the experiment was in good agreement with a calculation of a semi-classical attenuation model. ((orig.))
The virtual library: Coming of age
Hunter, Judy F.; Cotter, Gladys A.
1994-01-01
With the high speed networking capabilities, multiple media options, and massive amounts of information that exist in electronic format today, the concept of a 'virtual' library or 'library without walls' is becoming viable. In virtual library environment, the information processed goes beyond the traditional definition of documents to include the results of scientific and technical research and development (reports, software, data) recorded in any format or media: electronic, audio, video, or scanned images. Network access to information must include tools to help locate information sources and navigate the networks to connect to the sources, as well as methods to extract the relevant information. Graphical User Interfaces (GUI's) that are intuitive and navigational tools such as Intelligent Gateway Processors (IGP) will provide users with seamless and transparent use of high speed networks to access, organize, and manage information. Traditional libraries will become points of electronic access to information on multiple medias. The emphasis will be towards unique collections of information at each library rather than entire collections at every library. It is no longer a question of whether there is enough information available; it is more a question of how to manage the vast volumes of information. The future equation will involve being able to organize knowledge, manage information, and provide access at the point of origin.
Laboratory Safety Guide for Arkansas K-12 Schools.
Arkansas State Dept. of Education, Little Rock.
This document presents laboratory safety rules for Arkansas K-12 schools which were developed by the Arkansas Science Teachers Association (ASTA) and the Arkansas Department of Education (ADE). Contents include: (1) "Laboratory Safety Guide for Arkansas K-12 Schools"; (2) "Safety Considerations"; (3) "Safety Standards for Science Laboratories";…
School Libraries...Unfinished Business: A Report on New York City's Elementary School Libraries.
Fund for New York City Public Education.
Effective school library media centers are a cost-efficient way for schools to provide children with the sophisticated knowledge, research, and computer skills they will need for the growing demands of work and citizenship in the 21st century. The libraries' cultivation of literacy, research, and thinking skills is particularly crucial in…
Careers in focus library and information science
2011-01-01
Careers in Focus: Library and Information Science, Second Edition profiles 19 careers for professionals interested in this field. Job profiles include:. -Acquisitions librarians. -Book conservators. -Children's librarians. -Corporate librarians. -Film and video librarians. -Law librarians. -Library assistants. -Library media specialists. -Medical librarians. -Research assistants.
Keeping Pace with K-12 Online Learning, 2016
Gemin, Butch; Pape, Larry
2017-01-01
"Keeping Pace with K-12 Online Learning 2016" marks the thirteenth consecutive year Evergreen has published its annual research of the K-12 education online learning market. The thirteen years of researching, writing and publishing this report represents a time of remarkable change. There has been a constant presence that has become the…
Marketing Your Library Program--More than a PR Campaign.
Brown, Gerald R.
In this workshop, the concept of marketing was applied to school library media programs by examining the relationship between library media programs, the marketing plan, public relations (PR), and promotion. Reachable goals, targeting the audience, advertising, and motivation and commitment of the staff were also considered, and successful…
Retaining K-12 Online Teachers: A Predictive Model for K-12 Online Teacher Turnover
Larkin, Ingle M.; Lokey-Vega, Anissa; Brantley-Dias, Laurie
2018-01-01
The purpose of this study was to measure and explore factors influencing K-12 online teachers' turnover intentions, with job satisfaction and organizational commitment serving as moderating variables. Using Fishbein and Ajzen's Theory of Reasoned Action and Planned Behavior (1975), this study was conducted in public, private, charter, for-profit,…
Participative Teaching with Mobile Devices and Social Networks for K-12 Children
Directory of Open Access Journals (Sweden)
Livia Stefan
2016-08-01
Full Text Available This article details a set of participatory pedagogical experiments conducted within a research grant PN II IDEI (”Time Maps. Real communities, virtual worlds, experimented pasts” performed with the purpose of helping rural communities in identifying their cultural heritage andtransmitting it to the younger generations by means of modern IT technologies, including web 2.0. In a Danubian rural community, several points of archaeological interest (POIs were identified, which were then included in a geographic Augmented Reality application for smartphones and tablets. Subsequently, the geographic data were collected from the archaeological site by the K-12 children, under the coordination of an academic staff member of the National University of Arts in Bucharest, and stored on their devices using Google Maps. The augmented information provided onthe site was annotated and shared with other K-12 children, through different social networks sites (SNS and content postings. This first stage experiment was extended to the development of a social learning environment complementary to the educational site (www.timemaps.net to support thetransmission of several traditional technologies (textile, ceramic, glass in a collaborative manner. We consider that our experiments can significantly increase the visibility of the information pertaining to the identity of target places and communities among the younger generation. A mobile-learning paradigm, in combination with web 2.0 technologies, was the support for a distributed and low-cost platform for communication and collaboration. Social networks linked thearchaeological heritage and the academic research with the larger community of rural K-12 children. The article analyzes this platform as a solution for creating, collecting and sharingeducational content, and presents conclusions on using social media for effective blended learning and transmittal of the cultural heritage.
LIB LAB the Library Laboratory: hands-on multimedia science communication
Fillo, Aaron; Niemeyer, Kyle
2017-11-01
Teaching scientific research topics to K-12 audiences in an engaging and meaningful way does not need to be hard; with the right insight and techniques it can be fun to encourage self-guided STEAM (science, technology, engineering, arts, and mathematics) exploration. LIB LAB, short for Library Laboratory, is an educational video series produced by Aaron J. Fillo at Oregon State University in partnership with the Corvallis-Benton County Public Library targeted at K-12 students. Each episode explores a variety of scientific fundamentals with playful experiments and demonstrations. The video lessons are developed using evidence-based practices such as dispelling misconceptions, and language immersion. Each video includes directions for a related experiment that young viewers can conduct at home. In addition, science kits for these at-home experiments are distributed for free to students through the public library network in Benton County, Oregon. This talk will focus on the development of multimedia science education tools and several techniques that scientists can use to engage with a broad audience more effectively. Using examples from the LIB LAB YouTube Channel and collection of hands-on science demonstrations and take-home kits, this talk will present STEAM education in action. Corvallis-Benton County Public Library.
Hurst, Susan; Marsh, Dominic; Brown, Dean; Forbes, Shona
2017-01-01
This case study describes the creation of a leisure reading collection in the Clifford Whitworth library at the University of Salford. It briefly surveys existing literature on leisure reading collections and looks at the growing interest among U.K. academic libraries in recreational reading. It considers the reasons for promoting reading as a…
Directory of Open Access Journals (Sweden)
Haryanto Haryanto
2016-07-01
The purpose of this analysis is the creation of a homogeneous communication between librarians between universities so that they can support each other to provide of collection. In the world of libraries, collection limitations faced by almost all libraries, so that the necessary efforts such as sharing collections (resources sharing, for it is needed of a comunication medium that can be used as a medium of communication that connect these libraries. And social media is facebook With social media may be possible to create communities of similar or homogeneous so that they can communicate quickly for sharing collections. In utilizing social media for sharing resources the college library, in order to effectively take a few things in common among communities majors / homogeneous, the main admin control, resources sharing deal, admin list each library, freight forwarding services, as well as the MoU.
International Nuclear Information System (INIS)
Pelloni, S.; Stepanek, J.
1987-01-01
The cell code WIMSD4 is used for the analysis of PROTEUS-LWHCR experiments. A library for this code which is based on the European evaluation JEF-1 was produced at EIR using the Los Alamos NJOY system with its module WIMSR and the Canadian management code WILMA. In general, this library delivered more accurate eigenvalues and reaction rates than the WIMS-Standard and WIMS81 libraries did in comparison to experimental values from PROTEUS-LWHCR Cores 1-3. However, large discrepancies (up to about 10%) occured between calculated migration areas (M 2 ). Additional investigations have been undertaken to clarify this problem, since theoretical M 2 -values are needed for deducing k-infinity in the experiments. This has been done in the context of calculations for a reference LWHCR test lattice. The following major reasons for these deviations were found. First, the self-scattering term in non-moderators (P 0 matrix) in the JEF-1 library was not transport corrected. Second, Standard and JEF-1 libraries use infinite dilute cross sections for 238 U, whereas the WIMS81 library uses fully shielded cross sections. Third, the standard library uses the 'row' formula for the transport correction, whereas the 'inflow' formula is applied in the case of JEF-1 and WIMS81 libraries. Lastly, oxygen and 238 U scattering cross sections in the fast energy range are smaller in the case of the WIMS81 library. Differences in calculated k-infinity values between the currently used library and WIMS81 (up to 3%) come (in order of importance for the reference LWHCR lattice) mainly from resonance cross sections for 240 Pu capture, 238 U capture and 239 Pu fission. Recommendations have been made for generating a new JEF-1 library using updated versions of WIMSR and WILMA. (author)
Hopkins, Dianne McAfee; Zweizig, Douglas L.
The Library Power program is a school improvement initiative of the DeWitt-Wallace Reader's Digest Fund that began in 1988, designed to promote the full integration of the school library media program into the school curriculum in public elementary and junior high/middle schools. With a total investment exceeding $45 million, Library Power is the…
An All-School Library Challenge
Quirk, Connie
2005-01-01
The library media center is hosting an all-school team challenge, designed to celebrate reading and library skills. Students could choose from the contest categories like "Lord of the Rings", "Harry Potter", Author Facts Challenge and Opening Lines Challenge for the competition and those students who read more challenging books show their…
NSF GK-12 Fellows as Mentors for K-12 Teachers Participating in Field Research Experiences
Ellins, K.; Perry, E.
2005-12-01
The University of Texas Institute for Geophysics (UTIG) recognizes the value of providing educational opportunities to K-12 teachers who play a critical role in shaping the minds of young people who are the future of our science. To that end, UTIG established the "Texas Teachers in the Field" program in 2000 to formalize the participation of K-12 teachers in field programs that included UTIG scientists. In 2002, "Texas Teachers in the Field" evolved through UTIG's involvement in a University of Texas at Austin GK-12 project led by the Environmental Sciences Institute, which enabled UTIG to partner a subset of GK-12 Fellows with teachers participating in geophysical field programs. During the three years of the GK-12 project, UTIG successfully partnered four GK-12 Fellows with five K-12 teachers. The Fellows served as mentors to the teachers, as liaisons between UTIG scientists leading field programs and teachers and their students, and as resources in science, mathematics, and technology instruction. Specifically, Fellows prepared teachers and their students for the field investigations, supervised the design of individual Teacher Research Experience (TRE) projects, and helped teachers to develop standards-aligned curriculum resources related to the field program for use in their own classrooms, as well as broader distribution. Although all but one TRE occurred during the school year, Texas school districts and principals were willing to release teachers to participate because the experience and destinations were so extraordinary (i.e., a land-based program in Tierra del Fuego, Argentina; and research cruises to the Southeast Caribbean Sea and Hess Deep in the Pacific Ocean) and carried opportunities to work with scientists from around the world. This exceptional collaboration of GK-12 Fellows, K-12 teachers and research scientists enriches K-12 student learning and promotes greater enthusiasm for science. The level of mentoring, preparation and follow-up provided
A Study of How We Study: Methodologies of School Library Research 2007 through July 2015
Morris, Rebecca J.; Cahill, Maria
2017-01-01
In this study we investigated the research designs employed to study the interdisciplinary profession of school librarianship during a time period of notable changes across both the Pre-K-12 and school library domains. To conduct this work, we analyzed all 217 articles published in "School Library Research" (SLR) and "School…
Classifying K-12 Blended Learning
Staker, Heather; Horn, Michael B.
2012-01-01
The growth of online learning in the K-12 sector is occurring both remotely through virtual schools and on campuses through blended learning. In emerging fields, definitions are important because they create a shared language that enables people to talk about the new phenomena. The blended-learning taxonomy and definitions presented in this paper…
Interstellar Molecules in K-12 Education
Kuiper, T. B. H.; Hofstadter, M. D.; Levin, S. M.; MacLaren, D.
2006-12-01
The Lewis Center for Educational Research (LCER) and the Jet Propulsion Laboratory (JPL) collaborate in a K-12 educational project in which students conduct observations for several research programs led by radio astronomers. The Goldstone-Apple Valley Radio Telescope (GAVRT) program provides participating teachers with curriculum elements, based on the students' observing experiences, which support national and state academic standards. The current program is based on 2.2-GHz and 8.4-GHz radiometric observations of variable sources. The research programs monitor Jupiter, Uranus, and a selected set of quasars. The telescope is a decommissioned NASA Deep Space Network antenna at Goldstone, California. In the next three years, a second telescope will be added. This telescope will at least operate at the above frequencies as well as 6 GHz and 12 GHz. Possibly, it will operate in a continuous band from 1.2 GHz to 14 GHz. In either case, the telescope will be able to observe at least the 6.6-GHz and 12.2-GHz methanol maser lines. The success of the GAVRT program depends critically on the participation of scientists committed to the research who have the ability and enthusiasm for interacting with K-12 students, typically through teleconferences. The scientists will initially work with the LCER staff to create curriculum elements around their observing program.
K-12 Technology Accessibility: The Message from State Governments
Shaheen, Natalie L.; Lazar, Jonathan
2018-01-01
This study examined state education technology plans and technology accessibility statutes to attempt to answer the question--is K-12 instructional technology accessibility discussed in state-level technology accessibility statutes and education technology plans across the 50 United States? When a K-12 school district is planning the construction…
Resonance Phenomena in Goupillaud-type Media
2010-10-01
layered structures (7), anisotropic elastic bodies (8), anisotropic layered crystals (9, 10), elastic plates (11, 12), periodic media (13), laminated and...sandwich plates (14), composite laminates (15), piezoelectric composites (16), locally resonant acoustic metamaterials (17, 18), and acoustic wave...bm 2 c∑ k=1 ai,k cos (nθk) + bi,k sin (nθk) ] , (20) where operation ∗ means convolution , i = 1, 2, . . .m, and n ≥ 0. The stress representation
School Library Journal's Spending Survey
Farmer, Lesley; Shontz, Marilyn
2009-01-01
This year's "School Library Journal's" spending survey showed that, despite the recession, the vast majority of media centers around the country have retained their credentialed media specialists. For example, almost 85% of elementary schools and more than 95% of middle and high schools have a full-time certified librarian. In addition, salaries…
Business planning for digital libraries international approaches
Collier, Mel
2010-01-01
This book brings together international experience of business planning for digital libraries: the business case, the planning processes involved, the costs and benefi ts, practice and standards, and comparison with the traditional library where appropriate. Although there is a vast literature already on other aspects of digital libraries, business planning is a subject that until now has not been systematically integrated in a book.Digital libraries are being created not only by traditional libraries, but by museums, archives, media organizations, and indeed any organization concerned with ma
Wei HUANG; Ming LV; Zhong-gao GAO; Ming-ji JIN; Fei-fei YANG; Yu-li WANG
2011-01-01
Objective To construct(mPEG5k-PCL1.2k)1.4-g-PEI10k,a copolymer designed as delivery vector for non-viral gene therapy,and explore its cytotoxicity and efficacy in delivery of plasmid DNA(pDNA).Methods The copolymer,mPEG5k-PCL1.2k-OH,was prepared by ring-opening polymerization and then followed by a conversion of hydroxyl terminal(-OH) into N-hydroxysuccinimide(NHS) to prepare mPEG5k-PCL1.2k-NHS.One of the branches,PEI10k,was then reacted with mPEG5k-PCL1.2k-NHS to synthesize a ternary copolym...
The Impact of New York's School Libraries on Student Achievement and Motivation: Phase I
Small, Ruth V.; Snyder, Jaime; Parker, Katie
2009-01-01
In recent years, a number of statewide research studies have been conducted to determine the impact of school library media centers and their school library media specialists (SLMSs) on student achievement. Research studies in eighteen states have clearly established the relationship between well-staffed, well-funded school libraries on student…
Harnessing Technology to Improve K-12 Education. Discussion Paper 2012-05
Chatterji, Aaron; Jones, Benjamin
2012-01-01
Technological progress has consistently driven remarkable advances in the U.S. economy, yet K-12 education sees little technological change compared to other sectors, even as U.S. K-12 students increasingly lag behind students in other nations. This proposal considers how we can take a signature American strength--innovation--and apply it to K-12…
Xu, Beijie; Recker, Mimi; Qi, Xiaojun; Flann, Nicholas; Ye, Lei
2013-01-01
This article examines clustering as an educational data mining method. In particular, two clustering algorithms, the widely used K-means and the model-based Latent Class Analysis, are compared, using usage data from an educational digital library service, the Instructional Architect (IA.usu.edu). Using a multi-faceted approach and multiple data…
CERN Bulletin
2012-01-01
In the last issue of the Bulletin we reported on the first run of the new NA62 experiment. In this issue, we go behind the scenes to take a look at the production of the experiment's new kaon beam. The start of the K12 beam line as seen during the installation of the shielding. 10-2, 10-3, 10-4, 10-5, 10-6 mbar… send in the protons! Since Thursday 1 November, the P42 beam line of the SPS has once again been sending protons to the beryllium target to produce the K12 kaon beam line eagerly awaited by the NA62 collaboration. This was no trivial matter! The first step was to clear the decks by dismantling the entire H10 beam line and NA60 experiment, as well as most of the NA48 experiment - representing some 1000 tonnes of equipment in total! Next came the complete renovation of the infrastructure, which dated back to 1979. The operation called on the expertise of virtually all branches of the EN and GS departments, as well as the Radiation Protection group: from ...
Teaching social media the can-do guide
Kirchhoff, Liz
2014-01-01
Sharing social media expertise with library clientele is a natural way for libraries to support their communities-and increase their relevance. This book provides a roadmap for librarians who wish to offer this service but need to brush up on their own social media skills or learn how to cover the topics in a classroom situation. Although there are many books on social media, this volume is unique because it presents complete teaching scripts that can be adapted for various classroom situations along with general guidelines and tips. You'll find general advice on social media as well as su
Precision Stellar Characterization of FGKM Stars using an Empirical Spectral Library
Yee, Samuel W.; Petigura, Erik A.; von Braun, Kaspar
2017-02-01
Classification of stars, by comparing their optical spectra to a few dozen spectral standards, has been a workhorse of observational astronomy for more than a century. Here, we extend this technique by compiling a library of optical spectra of 404 touchstone stars observed with Keck/HIRES by the California Planet Search. The spectra have high resolution (R ≈ 60,000), high signal-to-noise ratio (S/N ≈ 150/pixel), and are registered onto a common wavelength scale. The library stars have properties derived from interferometry, asteroseismology, LTE spectral synthesis, and spectrophotometry. To address a lack of well-characterized late-K dwarfs in the literature, we measure stellar radii and temperatures for 23 nearby K dwarfs, using modeling of the spectral energy distribution and Gaia parallaxes. This library represents a uniform data set spanning the spectral types ˜M5-F1 (T eff ≈ 3000-7000 K, R ⋆ ≈ 0.1-16 R ⊙). We also present “Empirical SpecMatch” (SpecMatch-Emp), a tool for parameterizing unknown spectra by comparing them against our spectral library. For FGKM stars, SpecMatch-Emp achieves accuracies of 100 K in effective temperature (T eff), 15% in stellar radius (R ⋆), and 0.09 dex in metallicity ([Fe/H]). Because the code relies on empirical spectra it performs particularly well for stars ˜K4 and later, which are challenging to model with existing spectral synthesizers, reaching accuracies of 70 K in T eff, 10% in R ⋆, and 0.12 dex in [Fe/H]. We also validate the performance of SpecMatch-Emp, finding it to be robust at lower spectral resolution and S/N, enabling the characterization of faint late-type stars. Both the library and stellar characterization code are publicly available.
Precision Stellar Characterization of FGKM Stars using an Empirical Spectral Library
Energy Technology Data Exchange (ETDEWEB)
Yee, Samuel W.; Petigura, Erik A. [California Institute of Technology (United States); Von Braun, Kaspar, E-mail: syee@caltech.edu [Lowell Observatory, 1400 W. Mars Hill Road, Flagstaff, AZ 86001 (United States)
2017-02-10
Classification of stars, by comparing their optical spectra to a few dozen spectral standards, has been a workhorse of observational astronomy for more than a century. Here, we extend this technique by compiling a library of optical spectra of 404 touchstone stars observed with Keck/HIRES by the California Planet Search. The spectra have high resolution ( R ≈ 60,000), high signal-to-noise ratio (S/N ≈ 150/pixel), and are registered onto a common wavelength scale. The library stars have properties derived from interferometry, asteroseismology, LTE spectral synthesis, and spectrophotometry. To address a lack of well-characterized late-K dwarfs in the literature, we measure stellar radii and temperatures for 23 nearby K dwarfs, using modeling of the spectral energy distribution and Gaia parallaxes. This library represents a uniform data set spanning the spectral types ∼M5–F1 ( T {sub eff} ≈ 3000–7000 K, R {sub ⋆} ≈ 0.1–16 R {sub ⊙}). We also present “Empirical SpecMatch” (SpecMatch-Emp), a tool for parameterizing unknown spectra by comparing them against our spectral library. For FGKM stars, SpecMatch-Emp achieves accuracies of 100 K in effective temperature ( T {sub eff}), 15% in stellar radius ( R {sub ⋆}), and 0.09 dex in metallicity ([Fe/H]). Because the code relies on empirical spectra it performs particularly well for stars ∼K4 and later, which are challenging to model with existing spectral synthesizers, reaching accuracies of 70 K in T {sub eff}, 10% in R {sub ⋆}, and 0.12 dex in [Fe/H]. We also validate the performance of SpecMatch-Emp, finding it to be robust at lower spectral resolution and S/N, enabling the characterization of faint late-type stars. Both the library and stellar characterization code are publicly available.
School Communications 2.0: A Social Media Strategy for K-12 Principals and Superintendents
Cox, Daniel Dean
2012-01-01
The purpose of this qualitative, multiple-case study was two-fold: 1) to describe, analyze, and interpret the experiences of school principals and superintendents who use multiple social media tools such as blogs, microblogs, social networking sites, podcasts, and online videos with stakeholders as part of their comprehensive communications…
Nigerian School Library Journal
African Journals Online (AJOL)
The Nigerian School Library Journal is a scholarly publication of the Nigerian ... media resources management, reading development, e-learning/m-learning, and other ... Team management in the 21 century: A human relations theory angle ...
New York State's School Library Evaluation
Jaeger, Paige
2012-01-01
The New York State's School Library Media Program Evaluation (SLMPE) rubric provides a window of opportunity for a librarian to talk with his/her administrators about library program elements that may be out of the librarian's control. There are three areas of focus on the SLMPE Rubric: (1) Teaching and Learning; (2) Building and Learning…
Libraries' Place in Virtual Social Networks
Mathews, Brian S.
2007-01-01
Do libraries belong in the virtual world of social networking? With more than 100 million users, this environment is impossible to ignore. A rising philosophy for libraries, particularly in blog-land, involves the concept of being where the users are. Simply using new media to deliver an old message is not progress. Instead, librarians should…
Glazer, Evan
2005-01-01
The Web offers numerous learning resources and opportunities for K-12 mathematics education. This paper discusses those resources and opportunities. Discussion includes (a) asynchronous and synchronous communication tools, (b) the use of data sets to make connections between mathematics concepts and real-world applications, and (c) interactive…
ZZ ANSLV, Multigroup Cross Sections Library for ANS Reactor Design Studies
International Nuclear Information System (INIS)
2000-01-01
A - Description of program or function: - Format: AMPX Master Interface Library format. Number of groups: Fine Group (99 energy groups) General Purpose Neutron Library. Materials: H, He, Be, B, Graphite, N, O, Na, Mg, Al, Si, K, Ti, V, Cr, Mn, Fe, Co, Ni, Kr, Zr, Mo, Tc, Ru, Ag, Cd, Cs, Ce, Pr, Pm, Sm, Eu, Hf, Ta, U, C, F, Cu, Sn, Pb, Rh, I, Xe, Nd, Th, Np, Pu, Am, Cm, Bk, Cf, Es, MAFP, WAFP. Origin: ENDF/B-V. - Format: AMPX Master Interface Library format. Number of groups: Broad Group (39 energy groups) General Purpose Neutron Library. Materials: H, He, Be, B, Graphite, N, O, Na, Mg, Al, Si, K, Ti, V, Cr, Mn, Fe, Co, Ni, Kr, Zr, Mo, Tc, Ru, Ag, Cd, Cs, Ce, Pr, Pm, Sm, Eu, Hf, Ta, U, C, F, Cu, Sn, Pb, Rh, I, Xe, Nd, Th, Np, Pu, Am, Cm, Bk, Cf, Es, MAFP, WAFP. Origin: ENDF/B-V. - Format: AMPX Master Interface Library format. Number of groups: Gamma-Ray Interaction (GRI) Library in 44-groups. Materials: H, He, Be, B, C, N, O, Na, Mg, Al, Si, K, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zr, Mo, Ag, Cd, Xe, Sm, Eu, Hf, Ta, Ir, Pb, Th, U, Pu. Origin: ENDF/B-V; LENDL-V evaluations for 12 materials. - Format: AMPX Master Interface Library format. Number of groups: Coupled Library containing (CNG) 99-group neutron and 44-group gamma-ray data. Materials: H, Be, B, C, N, O, Na, Mg, Al, Si, K, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zr, Mo, Ag, Cd, Eu, Hf, Ta, Pb, Th, U, Pu. Origin: ENDF/B-V. - Format: AMPX Master Interface Library format. Number of groups: Coupled neutron-gamma (CNG) Library containing 39-group, and 44-group gamma-ray data. Materials: H, Be, B, C, N, O, Na, Mg, Al, Si, K, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zr, Mo, Ag, Cd, Eu, Hf, Ta, Pb, Th, U, Pu. Origin: ENDF/B-V. Weighting spectrum: Maxwellian 300 K + 1/(E*sigma-total) + fission spectrum4 types of boundaries have been used depending isotope and library type (see report). Pseudo-problem-independent, multigroup cross section libraries were generated to support the Advanced Neutron source (ANS) reactor design studies. The ANS was
Characteristics of the process K+p→K+anti ppp at 12 GeV/c
International Nuclear Information System (INIS)
Armstrong, T.A.; Frame, D.; Hughes, I.S.; Kumar, B.R.; Lewis, G.M.; Macallister, J.B.; Stewart, D.T.; Turnbull, R.M.
1979-01-01
Data are presented on the reaction K + p→K + anti ppp at 12 GeV/c from an experiment using the OMEGA spectrometer at CERN. A clear Λ(1520) signal is observed in the process K + p→anti Λ(1520)pp and angular distributions and correlations are presented for this process. The angular distributions for the reaction in which anti Λ(1520) is not produced show an appreciable backward K + peak. (Auth.)
Updating and test on 12 kA HTSCL for Russia JINR
International Nuclear Information System (INIS)
Zhou, Tingzhi; Ding, K; Liu, C; Xu, C; Feng, H; Wu, H; Liu, X; Song, Y
2014-01-01
The Joint Institute for Nuclear Research (JINR) started manufacture and test of superconducting magnets for the new accelerator complex Nuclotron-based Ion Collider fAcility (NICA). A pair of current leads rated 12 kA was developed for cold testing of the magnets in 2012. The operation of the facility needs ∼350 leads rated from 100 A to 12 kA to convey current for the magnets. After the test of the pair of 12 kA leads in JINR a contract of supplying 3 pairs of 12 kA high temperature superconducting current leads (HTSCLs) were signed to ASIPP this year. In this paper the design updating and test of the current leads are introduced.
Fennell, T.; Ellins, K. K.; Morris, M.; Christeson, G.
2003-12-01
The K-12 science teacher is always seeking ways of improving and updating their curriculum by integrating the latest research into their most effective classroom activities. However, the daily demands of delivering instruction to large numbers of students coupled with the rapid advances in some fields of science can often overwhelm this effort. The NSF-sponsored Cataclysms and Catastrophes curriculum, developed by scientists from the The University of Texas at Austin Institute for Geophysics (UTIG) and Bureau of Economic Geology (BEG), middle and high school teachers, and UT graduate students (NSF GK-12 fellows) working together through the GK-12 program, is a textbook example of how universities can facilitate this quest, benefiting education at both K-12 and university levels. In 1992, "The Great K-T Extinction Debate" was developed as an activity in the Planet Earth class at the Liberal Arts and Science Academy of Austin as an interdisciplinary approach to science. Taking advantage of the media attention generated by the impact scenario for the K-T extinction, the activity consists of students participating in a simulated senate hearing on the potential causes of the K-T extinction and their implications for society today. This activity not only exposes students to the wide range of science involved in understanding mass extinctions, but also to the social, political and economic implications when this science is brought into the public arena and the corresponding use of data in decision making and disaster preparedness. While "The Great K-T Extinction Debate" was always a popular and effective activity with students, it was in desperate need of updating to keep pace with the evolving scientific debate over the cause of the K-T extinction and the growing body of impact evidence discovered over the past decade. By adding two inquiry-based learning activities that use real geophysical data collected by scientists studying the buried Chicxulub feature as a
Chesick, Curtis W.
2015-01-01
The digital revolution has created a new ways for society to interact. As technology continues to evolve so does the way culture begins to use it as a channel for communication. Social media has developed as a two way communication tool used by both corporate America as well as individuals. This research begins to look at how Missouri school…
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
On 12 July 94, The Institute for Science and Society received the above titled grant for $300,000 with an additional $323,000 awarded 14 August 95. The Institute completed the programs provided by the Department of Energy grant on 28 February 97. These programs for teachers, public officials, news media and the public will continue through 31 December 97 with funding from other sources. The Institute is a non-profit 501-c-3 corporation. It was organized {open_quotes}... to help increase science literacy in all segments of the population and contribute to a more rational atmosphere than now exists for the public consideration of societal issues involving science and technology, both regional and national.{close_quotes} Institute personnel include the Honorable Mike McCormack, Director; Joan Harris, Associate Director; Kim Freier, Ed.D, Program Manager; and Sharon Hunt, Executive Secretary.
Information Needs of Media Practitioners in Karachi, Pakistan
Directory of Open Access Journals (Sweden)
Munira Nasreen Ansari
2012-06-01
Full Text Available This study explores the kind of information generally needed by media practitioners (MPs in Karachi, Pakistan to perform the duties. 185 MPs from three types of media (TV, radio and newspaper were surveyed. Reports of various organizations are the most used source of information. MPs need selective, rather than exhaustive, information on a daily basis. The findings of this study could help design library services and need-based collection development in media libraries.
An Overview of the History of Library Science Teaching Materials.
Metzger, Philip A.
1986-01-01
This introduction to, and overview of, history of library science instructional materials covers the Williamson Report, teaching materials from early Columbia days onward, American Library Association book publishing activity, media in curricula and library school publication of syllabi, commercial publishing of textbooks, and periodicals in…
Staff Development Strategies for School Library and Media Centres ...
African Journals Online (AJOL)
Staff Development is a sine-qua non to the provision of efficient library services at any level. The study sets to investigate staff development strategies in school libraries and Information centres in Owerri, Imo State Nigeria. Selfdesigned questionnaires were used in eliciting data for the study. Ten schools were used with 10 ...
Directory of Open Access Journals (Sweden)
Elizabeth Margaret Stovold
2017-09-01
Full Text Available A Review of: Swab, M., & Romme, K. (2016. Scholarly sharing via Twitter: #icanhazpdf requests for health sciences literature. Journal of the Canadian Health Libraries Association, 37(1, 6-11. http://dx.doi.org/10.5596/c16-009 Abstract Objective – To analyze article sharing requests for health sciences literature on Twitter, received through the #icanhazpdf protocol. Design – Social media content analysis. Setting – Twitter. Subjects – 302 tweets requesting health sciences articles with the #icanhazpdf tag. Methods – The authors used a subscription service called RowFeeder to collect public tweets posted with the hashtag #icanhazpdf between February and April 2015. Rowfeeder recorded the Twitter user name, location, date and time, URL, and content of the tweet. The authors excluded all retweets and then each reviewed one of two sets. They recorded the geographic region and affiliation of the requestor, whether the tweet was a request or comment, type of material requested, how the item was identified, and if the subject of the request was health or non-health. Health requests were further classified using the Scopus subject category of the journal. A journal could be classified with more than one category. Any uncertainties during the coding process were resolved by both authors reviewing the tweet and reaching a consensus. Main results – After excluding all the retweets and comments, 1079 tweets were coded as heath or non-health related. A final set of 302 health related requests were further analyzed. Almost all the requests were for journal articles (99%, n=300. The highest-ranking subject was medicine (64.9%, n=196, and the lowest was dentistry (0.3%, n=1. The most common article identifier was a link to the publisher’s website (50%, n=152, followed by a link to the PubMed record (22%, n=67. Articles were also identified by citation information (11%, n=32, DOI (5%, n=14, a direct request to an individual (3%, n=9, another method
Readiness of librarians in public libraries towards integration of ...
African Journals Online (AJOL)
The study is designed to x-ray the level of preparedness of librarians in Nigerian Public libraries towards integrating social media to the provision of library and information services (LIS). The survey research method was adopted using public libraries in south-east geo-political zone of Nigeria. The population of study ...
Library Automation Report, 1996. Multimedia Computers in U.S. Public Schools, 1995-96.
Quality Education Data, Inc., Denver, CO.
District library media directors face dual demands including competition for limited educational dollars and the need to meet increasingly sophisticated student research requests. To solve these dilemmas, many districts are automating their schools' library media centers. Quality Education Data (QED) is an education research firm providing…
Multimedia technologies in university libraries: opportunities and tasks
Directory of Open Access Journals (Sweden)
Tavalbekh Serkhan Ali
2010-03-01
Full Text Available Multimedia technologies (MMT are considered as a factor of qualitative changes of informational environment of education. Leading role of libraries in the process of integration of MMT environment of university is determined. Influence of libraries experience in usage of informational technologies both traditional and computer-aided, Internet in particular is observed. Determined that introduction of MMT noticeable improving the importance of library in MMT environment organization of universities, improvement of library informational service. Tasks of university libraries with integration into united media space are defining.
Digital Learning in California's K-12 Schools. Just the Facts
Gao, Niu
2015-01-01
This fact page briefly discusses the following facts on digital learning in California's K-12: (1) As California implements new tests in its K-12 schools, technology infrastructure is a key concern; (2) Many districts are confident that they had enough bandwidth for online field tests; (3) Digital learning will require significantly greater…
Systematic study of K+ and K- charge exchange at 8.36 and 12.8 GeV/c
International Nuclear Information System (INIS)
Gilchriese, M.G.D.
1977-08-01
The results of a wire chamber spectrometer experiment at the Stanford Linear Accelerator Center to study kaon charge exchange reactions are reported. The salient experimental features include good relative normalization between the K + and K - charge exchange reactions and a large increase, with respect to previous experiments, in the number of events obtained for K + n charge exchange at the higher energy. Approximately 1500 events at 12.8 GeV/c and 250 events at 8.36 GeV/c were obtained for each of the reactions K + n → K 0 p, K - p → anti K 0 n, K + p → K 0 Δ 2+ and K - n → anti K 0 Δ - . The results of the experiment show that the K + charge exchange cross sections are larger than the K - cross sections at both energies. In particular it is found that sigma/sub tot/ (K + n → K 0 p)/sigma/sub tot/ (K - p → anti K 0 n) is 1.37 +- 0.22 at 8.36 GeV/c and 1.38 +- 0.09 at 12.8 GeV/c. The ratio of these two reactions is also consistent with no momentum transfer dependence at either beam energy. Similarly it was determined that sigma/sub tot/ (K + p → K 0 Δ 2+ )/sigma/sub tot/ (K - n → anti K 0 Δ - ) is 1.05 +- 0.16 at 8.36 GeV/c and 1.56 +- 0.08 at 12.8 GeV/c. The ratio of these two reactions is also consistent with momentum transfer independence for both beam energies. These results are in clear conflict with the predictions of exchange degenerate Regge pole models
Promoting Books and Media: A Native American Indian Web.
Brodie, Carolyn S.
1991-01-01
Discusses children's literature on Native American Indians and suggests ideas for using the literature in the school library media center or classroom by the library media specialist or by the classroom teacher. Activities and appropriate materials are suggested for the topics of housing, poetry, food, biography, crafts and music, and traditional…
International Nuclear Information System (INIS)
Horvatic, V.; Vadla, C.; Movre, M.
1993-01-01
The collisional excitation transfer for the processes Rb * (5P 3/2 ) + K(4S 1/2 ) → Rb(5S 1/2 ) + K * (4P J ), J = 1/2, 3/2, was investigated using two-photon laser excitation techniques with a thermionic heat-pipe diode as a detector. The population densities of the K 4P J levels induced by collisions with excited Rb atoms as well as those produced by direct laser excitation of the potassium atoms were probed through the measurement of the thermionic signals generated due to the ionization of the potassium atoms emerging from the K(4P J ) → K(7S 1/2 ) excitation channel. (orig./WL)
Gautreaux, Michelle; Delgado, Sandra
2016-01-01
This article employs narrative analysis to examine how the media in 12 different countries characterize the "Teach for All" (TFA) teacher. Examining mass media narratives in these 12 countries illustrates that there are some remarkable commonalities in the narratives and character portraits co-constructed and propagated by the media. At…
Attending National Library Legislative Day: Why Is It Important?
Young, Robyn
2009-01-01
Prior to this year, the National Library Legislative Day never really held much importance for the author as a school library media specialist. However, this feeling changed after she attended her first National Library Legislative Day in May of 2008. The goal of this day is to allow everyday practicing professionals to speak with their national…
Investigating the Potential of MOOCs in K-12 Teaching and Learning Environments
Nigh, Jennifer; Pytash, Kristine E.; Ferdig, Richard E.; Merchant, William
2015-01-01
The massive open online course (MOOC) is a relatively new concept in K-12 teaching and learning environments. Although significant work has been done with MOOCs since 2008, it has only been recently that MOOCs have been studied with K-12 populations. The purpose of this study was to further examine the motivation of K-12 students enrolled in a…
Problem-Based Learning in the Life Science Classroom, K-12
McConnell, Tom; Parker, Joyce; Eberhardt, Janet
2016-01-01
"Problem-Based Learning in the Life Science Classroom, K-12" offers a great new way to ignite your creativity. Authors Tom McConnell, Joyce Parker, and Janet Eberhardt show you how to engage students with scenarios that represent real-world science in all its messy, thought-provoking glory. The scenarios prompt K-12 learners to immerse…
Kumagai, Shinichiro
This article overviews the situations of damage and reconstruction of mainly public libraries in Miyagi Prefecture about 9 months after the Great East Japan Earthquake. Serious damage of library buildings was due not only to the tsunami or seismic sea wave but to violent shaking, the latter less reported by the media. We at the Miyagi Prefectural Library implemented reconstruction assistance for regional public libraries in both direct and indirect ways. Among them, we report in detail on the support we offered until the Minami-sanriku Town Library reopened its service. We highlight a prefectural library's role, acting between supporters and those supportees, to consider the necessity of middle organizations. We clarify what challenges we face and examine how best to provide assistance in case of large-scale disasters.
Towards Implementing Library 2.0 Model in Nigerian University ...
African Journals Online (AJOL)
It presents the key features of library 2.0, such as user centered, multi-media ... blogs and wikis, instant messaging (IM), podcasts, social networking, streaming media, ... Recommendations were therefore proffered to include; the partnership of ...
A Vision in Aeronautics: The K-12 Wind Tunnel Project
1997-01-01
A Vision in Aeronautics, a project within the NASA Lewis Research Center's Information Infrastructure Technologies and Applications (IITA) K-12 Program, employs small-scale, subsonic wind tunnels to inspire students to explore the world of aeronautics and computers. Recently, two educational K-12 wind tunnels were built in the Cleveland area. During the 1995-1996 school year, preliminary testing occurred in both tunnels.
Dielectric polarization in random media
International Nuclear Information System (INIS)
Ramshaw, J.D.
1984-01-01
The theory of dielectric polarization in random media is systematically formulated in terms of response kernels. The primary response kernel K(12) governs the mean dielectric response at the point r 1 to the external electric field at the point r 2 in an infinite system. The inverse of K(12) is denoted by L(12);. it is simpler and more fundamental than K(12) itself. Rigorous expressions are obtained for the effective dielectric constant epsilon( in terms of L(12) and K(12). The latter expression involves the Onsger-Kirkwood function (epsilon(-epsilon 0 (2epsilon(+epsilon 0 )/epsilon 0 epsilon( (where epsilon 0 is an arbitrary reference value), and appears to be new to the random medium context. A wide variety of series representations for epsilon( are generated by means of general perturbation expansions for K(12) and L(12). A discussion is given of certain pitfalls in the theory, most of which are related to the fact that the response kernels are long ranged. It is shown how the dielectric behavior of nonpolar molecular fluids may be treated as a special case of the general theory. The present results for epsilon( apply equally well to other effective phenomenological coefficients of the same generic type, such as thermal and electrical conductivity, magnetic susceptibility, and diffusion coefficients
Expenditures for Resources in School Library Media Centers, FY 1991-92.
Miller, Marilyn L.; Shontz, Marilyn
1993-01-01
The sixth in a series of "School Library Journal" reports on trends in school library expenditures for program development shows that commitment to the teaching and motivating of reading is in conflict with fascination with technology and that access to books is being seriously curtailed by the deteriorating state of school library collections.…
Pemanfaatan Media Sosial dalam Pelayanan Rerefensi 2.0 di Indonesia
Directory of Open Access Journals (Sweden)
Ahmad Anwar
2016-06-01
Full Text Available In today era, there is a change of paradigm in organizing library in which a library is supposed to provide Web 2.0. In fact, its kind of service is used only for a medium to inform and promote library in general. To optimilize its Web 2.0 within the library, it is therefore the library needs to think of library services innovation. Reference service as a part of library must be playing an important role to optimize its service, or in the other words, they might think innovatively. With the growing rapid of usage os sosial media, the service should be worked in online. There are many sosial media today. The current study is aimed to discover the implementation of Web 2.0 in Indonesia
Statistics & Input-Output Measures for School Libraries in Colorado, 2002.
Colorado State Library, Denver.
This document presents statistics and input-output measures for K-12 school libraries in Colorado for 2002. Data are presented by type and size of school, i.e., high schools (six categories ranging from 2,000 and over to under 300), junior high/middle schools (five categories ranging from 1,000-1,999 to under 300), elementary schools (four…
Reich, Justin; Murnane, Richard; Willett, John
2012-01-01
To document wiki usage in U.S. K-12 settings, this study examined a representative sample drawn from a population of nearly 180,000 wikis. The authors measured the opportunities wikis provide for students to develop 21st-century skills such as expert thinking, complex communication, and new media literacy. The authors found four types of wiki…
Directory of Open Access Journals (Sweden)
Bauer, Bruno
2013-11-01
Full Text Available [english] This paper discusses the massive changes over the last 25 years particularly in medical libraries. The modernisation and upgrade of catalogues, bibliographies and journals is been accomplished by now while the transformation in the book sector is only in the beginning. With the help of new search engine technology the idea of a one-stop-shop was implemented to complete the change from printed to online media. In order to outlast future years medical libraries will have to handle the constant pressure for change and innovations while budgets are shrinking.[german] Der Beitrag thematisiert die massiven Veränderungen, die von wissenschaftlichen Bibliotheken, insbesondere Medizinbibliotheken, in den letzten 25 Jahren bewältigt worden sind. Während der Medienwandel beim Katalog, den Bibliografien und den Zeitschriften vollständig vollzogen worden ist, ist der Zeitpunkt der vollständigen Transformation der Bücher noch offen. Ergänzend zum Wandel von Print zu Online-Medien wurde die Idee des One-Stop-Shops umgesetzt, was mittels Suchmaschinentechnologie ermöglicht worden ist. Um in Zukunft bestehen zu können, werden Medizinbibliotheken auch weiterhin den Veränderungs- bzw. Innovationsdruck, in immer kürzeren Intervallen bei zunehmend limitierten Budgets, bewältigen müssen.
International Nuclear Information System (INIS)
Huebner, W.F.; Merts, A.L.; Magee, N.H. Jr.; Argo, M.F.
1977-08-01
The astrophysical elements opacity library includes equation of state data, various mean opacities, and 2000 values of the frequency-dependent extinction coefficients in equally spaced intervals u identical with hν/kT from 0 to 20 for 41 degeneracy parameters eta from -28 (nondegenerate) to 500 and 46 temperatures kT from 1 eV to 100 keV. Among available auxiliary quantities are the free electron density, mass density, and plasma cutoff frequency. A library-associated program can produce opacities for mixtures with up to 20 astrophysically abundant constituent elements at 4 levels of utility for the user
The four spaces of the public library
DEFF Research Database (Denmark)
Jochumsen, Henrik; Skot-Hansen, Dorte; Rasmussen, Casper Hvenegaard
2016-01-01
During the last 10–15 years the societal context and thereby the library's societal legitimacy has changed in a crucial manner. The development of the Internet and tendencies toward globalisation, detraditionalisation and cultural liberation has challenged the library. Therefore the role...... of the public library in the beginning of the new millennium and as a more concrete tool for designing, developing and redesigning the library....... of the physical library has changed from a more or less passive collection of books and other media to an active space for experience and inspiration and a local meeting point. One could speak of a transformation from ‘collection to connection’ or even from ‘collection to creation’ rather than the predicted...
An Examination of Ideology among Selected K12 Christian School Superintendents
Dolson, Jimmy L.
2013-01-01
This research project focused on explaining the decision making process of K12 Christian school superintendents whose schools belong to the Association of Christian Schools International (ACSI) organization. In spite of their similar religious and philosophical beliefs, ACSI K12 Christian school superintendents differed significantly in…
Ghana Library Journal - Vol 22, No 1-2 (2010)
African Journals Online (AJOL)
Networking the library catalogue: Lessons from the Kwame Nkrumah university of science and technology library, Kumasi, Ghana · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Ahenkorah-Marfo, EM Borteye, 35-44 ...
School Library Media Activities Monthly, 2001
2001-01-01
Provides six fully developed library media activities that are designed for use with specific curriculum units in guidance, health, mathematics, science, reading, language arts, and social studies. Library media skills, curriculum objectives, grade levels, resources, instructional roles, procedures, evaluation, and follow-up are described for each…
The WIMSLIB library - neutron data library for WIMS-D
International Nuclear Information System (INIS)
Liu Ping
1998-05-01
During a visit to the IAEA Nuclear Data Section from 13 June to 12 December 1997, the author processed the Chinese Evaluated Nuclear Data Library (CENDL), Version 2.1, using the NJOY Nuclear Data Processing System, Version 94.105, to generate the working library WIMSLIB for input to WIMS-D/4 and WIMS-D/5A. The WIMSLIB library was then used to perform benchmark testing of CENDL-2.1. (author)
K-n and K-p elastic scattering in K-d collisions from 1.2 to 2.2 GeV/c
International Nuclear Information System (INIS)
Declais, Y.; Duchon, J.; Louvel, M.; Patry, J.-P.; Seguinot, J.; Baillon, P.; Bruman, C.; Ferro-Luzzi, M.; Perreau, J.-M.; Ypsilantis, T.
1977-01-01
This report contains the detailed description of an experiment which has determined the differential cross section of the K - n→K - n elastic scattering reaction. The results are 12 angular distributions spanning the K - n c.m. energy interval from approximately 1.86 to approximately 2.32 GeV. The measurements have been performed at the CERN PS using a beam of negative kaons with momenta from 1.2 to 2.2 GeV/c incident on a liquid deuterium target. By means of electronic apparatus the process K - d→K - n psub(s) was identified and recorded; this process is basically the same as the K - n elastic reaction insofar as the spectator proton psub(s) has low momentum. The elastic reaction was derived from the above process by taking into account the Fermi motion of the target neutron and by introducing the appropriate corrections to compensate for the effects due to the composite nature of the neutron (double-scattering, final state interaction). These results, constituting the first extensive collection of data on the pure isospin 1 anti KN state have been used in conjunction with other data in a preliminary partial wave analysis of the anti KN elastic system over the c.m. energy range from 1.84 to 2.23 GeV. Mainly for testing purposes, a similar amount of data has been collected for the K - p elastic reaction also from K - d collisions (K - d→K - p nsub(s)). (Auth.)
Directory of Open Access Journals (Sweden)
Mitchell Davis
2013-07-01
Full Text Available Over the past two decades, a tremendous gap has emerged between the media experiences delivered by consumer companies like Amazon and Apple and those delivered by the library. The reasons for this are many, including a perception by library vendors that libraries themselves move slowly and feel no sense of urgency to innovate on behalf of patrons. The ever improving consumer media experience is the biggest competitor to the role of the library in the future. There are clear steps both public and academic libraries can take to remediate this, including demanding faster innovation from vendors, finding new roles for themselves in the content value chain and finding balance between the practicalities of ‘running a media business’ and the larger mission of the library.
Fonseca, Anna Carolina Oliveira; Ramos, Pedro; Balsalobre, Fernando A; Freitas, Edson L; Phillips, John S; Yung, Matthew W; Bento, Ricardo F
2017-09-01
Measuring the impact on quality of life, especially after the beginning of the treatment, is becoming increasingly important in healthcare. The aim of this study was to translate the Chronic Otitis Media Questionnaire-12 (COMQ-12) into Portuguese language and validate this version in a group of patients with chronic otitis media. The Portuguese version of COMQ-12 was obtained by translation and back translation. Portuguese speaking patients with a history of active chronic otitis media were asked to complete the COMQ-12 Portuguese version. Cronbach's α coefficient was calculated for an estimation of the internal consistency of the questionnaire. A total of 100 patients were included in the study; 49 women and 51 men, with a mean age of 39 years (range 12-77 years, median 40 years). The average COMQ-12 score was 29, out of a maximum score of 60. Cronbach's α result for the Portuguese version of the COMQ-12 was 0.85, indicating a high internal consistency. The participants presented with different forms of chronic otitis media, and almost all domains of the COMQ-12 questionnaire were able to differentiate between patients with healed chronic otitis media and patients with cholesteatoma or wet tympanic membrane perforation. Showing that patients with healed chronic otitis media have a better quality of life, measured by the COMQ-12, is a first step to guarantee the questionnaire's validity. The next step will consist on routinely using the questionnaire in patients undergoing surgery for chronic otitis media in order to evaluate their quality of life after treatment. The COMQ-12 Portuguese version showed high reliability, and may be used as an assessment of quality of life in patients with chronic otitis media. Copyright © 2017 Associação Brasileira de Otorrinolaringologia e Cirurgia Cérvico-Facial. All rights reserved.
Digital Preservation in Open-Source Digital Library Software
Madalli, Devika P.; Barve, Sunita; Amin, Saiful
2012-01-01
Digital archives and digital library projects are being initiated all over the world for materials of different formats and domains. To organize, store, and retrieve digital content, many libraries as well as archiving centers are using either proprietary or open-source software. While it is accepted that print media can survive for centuries with…
Still Polishing the Diamond: School Library Research over the Last Decade
Johnston, Melissa P.; Green, Lucy Santos
2018-01-01
In 2003 Delia Neuman wrote "Research in School Library Media for the Next Decade: Polishing the Diamond." One of the most influential pieces on school library research written in the last twenty years, the article provided a map for school library research by defining areas of concern and importance. Neuman developed questions grounded…
Staff development strategies for school library media centres: a case ...
African Journals Online (AJOL)
Staff development is a sine-qua non to the provision of efficient library services at any level. The study sets to investigate staff development strategies in school libraries and Information centres in Owerri, Imo State Nigeria. Self-designed questionnaires were used in eliciting data for the study. Ten schools were used with 10 ...
Interview with Joe Freidhoff: A Bird's-Eye View of K-12 Online Learning
Pourreau, Leslie
2015-01-01
The intent of this article is to introduce long-time "Online Learning" readership to the field of K-12 online learning while also providing direction for the K-12 online learning scholars about where the field is going or should be going in terms of meeting the needs of K-12 stakeholders. Recently an interview was conducted with Dr. Joe…
Pea, Roy; Nass, Clifford; Meheula, Lyn; Rance, Marcus; Kumar, Aman; Bamford, Holden; Nass, Matthew; Simha, Aneesh; Stillerman, Benjamin; Yang, Steven; Zhou, Michael
2012-03-01
An online survey of 3,461 North American girls ages 8-12 conducted in the summer of 2010 through Discovery Girls magazine examined the relationships between social well-being and young girls' media use--including video, video games, music listening, reading/homework, e-mailing/posting on social media sites, texting/instant messaging, and talking on phones/video chatting--and face-to-face communication. This study introduced both a more granular measure of media multitasking and a new comparative measure of media use versus time spent in face-to-face communication. Regression analyses indicated that negative social well-being was positively associated with levels of uses of media that are centrally about interpersonal interaction (e.g., phone, online communication) as well as uses of media that are not (e.g., video, music, and reading). Video use was particularly strongly associated with negative social well-being indicators. Media multitasking was also associated with negative social indicators. Conversely, face-to-face communication was strongly associated with positive social well-being. Cell phone ownership and having a television or computer in one's room had little direct association with children's socioemotional well-being. We hypothesize possible causes for these relationships, call for research designs to address causality, and outline possible implications of such findings for the social well-being of younger adolescents. PsycINFO Database Record (c) 2012 APA, all rights reserved.
Teacher Perception of Barriers and Benefits in K-12 Technology Usage
Carver, Lin B.
2016-01-01
This study explores K-12 teachers' perceptions of the benefits and barriers to technology integration by either teachers or students in K-12 instruction. The sample was composed of 68 students enrolled in online classes in the graduate studies in education department of a small private liberal arts institution in the southeast. Data was collected…
Directory of Open Access Journals (Sweden)
Cornelius Bert LR
2013-02-01
Full Text Available Abstract Background Screening for mental disorders among disability claimants is important, since mental disorders seem to be seriously under-recognized in this population. However, performance of potentially suitable scales is unknown. We aimed to evaluate the psychometric properties of three scales, the 10- and 6-item Kessler Psychological Distress Scale (K10, K6 and the 12-item General Health Questionnaire (GHQ-12, to predict present state mental disorders, classified according to the Diagnostic and Statistical Manual of Mental Disorders, 4thEdition (DSM-IV among disability claimants. Methods All scales were completed by a representative sample of persons claiming disability benefit after two years sickness absence (n=293. All diagnoses, both somatic and mental, were included. The gold standard was the Composite International Diagnostic Interview (CIDI 3.0 to diagnose present state DSM-IV disorder. Cronbach’s α, sensitivity, specificity, positive (PPV and negative predictive values (NPV, and the areas under the Receiver Operating Characteristic curve (AUC were calculated. Results Cronbach’s alpha’s were 0.919 (K10, 0.882 (K6 and 0.906 (GHQ-12. The optimal cut-off scores were 24 (K10, 14 ( K6 and 20 (GHQ-12. The PPV and the NPV for the optimal cut point of the K10 was 0.53 and 0.89, for the K6 0.51 and 0.87, and for the GHQ-12 0.50 and 0.82. The AUC’s for 30-day cases were 0.806 (K10; 95% CI 0.749-0.862, 0.796 (K6; 95% CI 0.737-0.854 and 0.695 (GHQ-12; 95% CI 0.626-0.765. Conclusions The K10 and K6 are reliable and valid scales to screen for present state DSM-IV mental disorder. The optimal cut-off scores are 24 (K10 and 14 (K6. The GHQ-12 (optimal cut-off score: 20 is outperformed by the K10 and K6, which are to be preferred above the GHQ-12. The scores on separate items of the K10 and K6 can be used in disability assessment settings as an agenda for an in-depth follow-up clinical interview to ascertain the presence of present state
Energy Retrofit for Aging K-12 Schools.
3D/International, Houston, TX.
Successfully retrofitting aging K-12 schools using energy conservation measures (ECM) that can improve the physical plant and reduce energy consumption are explored. Topics explore how certain ECM measures can benefit educational facilities, why retrofitting begun sooner rather than later is important, how to finance the retrofit program, and the…
National Strategies for Public Library Development
DEFF Research Database (Denmark)
Kann-Christensen, Nanna
2010-01-01
policies on the local level are discussed. according to the national goals and cultural policies for libraries. This is done in order to point towards a possible relationship between the political means and ends regarding library development. The two models to be discussed are the systems practiced...... by The Danish Agency for Libraries and Media, and The Swedish Arts Council, who both administer development grants to public libraries. The paper identifies both differences and similarities in both the means to (the political agendas) and the objectives of governmental influence in the libraries.......The economic rationale of New Public Management (NPM) is used in both Sweden and Denmark in order to employ the national cultural policies in local development projects. The paper discusses two different organizational models that are used in order for the national level to be able to exercise...
Development of an Attitude Scale to Assess K-12 Teachers' Attitudes toward Nanotechnology
Lan, Yu-Ling
2012-05-01
To maximize the contributions of nanotechnology to this society, at least 60 countries have put efforts into this field. In Taiwan, a government-funded K-12 Nanotechnology Programme was established to train K-12 teachers with adequate nanotechnology literacy to foster the next generation of Taiwanese people with sufficient knowledge in nanotechnology. In the present study, the Nanotechnology Attitude Scale for K-12 teachers (NAS-T) was developed to assess K-12 teachers' attitudes toward nanotechnology. The NAS-T included 23 Likert-scale items that can be grouped into three components: importance of nanotechnology, affective tendencies in science teaching, and behavioural tendencies to teach nanotechnology. A sample of 233 K-12 teachers who have participated in the K-12 Nanotechnology Programme was included in the present study to investigate the psychometric properties of the NAS-T. The exploratory factor analysis of this teacher sample suggested that the NAS-T was a three-factor model that explained 64.11% of the total variances. This model was also confirmed by the confirmatory factor analysis to validate the factor structure of the NAS-T. The Cronbach's alpha values of three NAS-T subscales ranged from 0.89 to 0.95. Moderate to strong correlations among teachers' NAS-T domain scores, self-perception of own nanoscience knowledge, and their science-teaching efficacy demonstrated good convergent validity of the NAS-T. As a whole, psychometric properties of the NAS-T indicated that this instrument is an effective instrument for assessing K-12 teachers' attitudes toward nanotechnology. The NAS-T will serve as a valuable tool to evaluate teachers' attitude changes after participating in the K-12 Nanotechnology Programme.
African Journals Online: Information, Communication & Library ...
African Journals Online (AJOL)
Items 1 - 18 of 18 ... African Journals Online: Information, Communication & Library Sciences .... published online and in print by Development Media Consulting, is a biannual ... and other issues related to information access, ethics and privacy.
International Nuclear Information System (INIS)
Resnik, W.M. II; Bosler, G.E.
1977-09-01
Many current reactor physics codes accept cross-section libraries in an isotope-ordered form, convert them with internal preprocessing routines to a group-ordered form, and then perform calculations using these group-ordered data. Occasionally, because of storage and time limitations, the preprocessing routines in these codes cannot convert very large multigroup isotope-ordered libraries. For this reason, the I2G code, i.e., ISOTXS to GRUPXS, was written to convert externally isotope-ordered cross section libraries in the standard file format called ISOTXS to group-ordered libraries in the standard format called GRUPXS. This code uses standardized multilevel data management routines which establish a strategy for the efficient conversion of large libraries. The I2G code is exportable contingent on access to, and an intimate familiarization with, the multilevel routines. These routines are machine dependent, and therefore must be provided by the importing facility. 6 figures, 3 tables
A Framework for Quality K-12 Engineering Education: Research and Development
Moore, Tamara J.; Glancy, Aran W.; Tank, Kristina M.; Kersten, Jennifer A.; Smith, Karl A.; Stohlmann, Micah S.
2014-01-01
Recent U.S. national documents have laid the foundation for highlighting the connection between science, technology, engineering and mathematics at the K-12 level. However, there is not a clear definition or a well-established tradition of what constitutes a quality engineering education at the K-12 level. The purpose of the current work has been…
Directory of Open Access Journals (Sweden)
Tina Hohmann
2006-07-01
Full Text Available New planning principles are required to meet the changing needs of the users of the library of the future. The digital revolution has changed the appearance of today’s libraries entirely. The majority of today’s information resources are of a non-physical nature and accessing information is more varied and complex. The traditional role as asset keeper is one of many tasks today. The recently completed examples of Dresden and Göttingen State- and University Library, the Seattle Public Library and the Idea Stores in London, all of them highly popular and frequented, show current trends in library design. What do they offer their visitors? access to information guidance (information skills possibility for communication working environment inspiring atmosphere Their design is based on the following main principles: Access to the library and its medias should be obvious and easy for everybody. There should be multifarious space for formal and informal communication between customers and staff. The interior should offer an attractive and comfortable environment for both customers and staff. The library building should adequately represent its institutional philosophy and aims. Its building design, structure and appliances should give consideration to sustainability.
Council On Library Resources, Inc. Seventeenth Annual Report, For the Year Ending June 30, 1973.
Council on Library Resources, Inc., Washington, DC.
This report describes the efforts of the Council on Library Resources to enhance the effectiveness, efficiency, and economy of operations in libraries during 1972-73. It covers 9 major areas: national library services, automation and networks, the academic library, the public library, microform and nonprint media, preservation and library…
To Reach Multicultural Users in Libraries--Some Reflections and Examples from Sweden.
Ekman, Maud
This paper describes library services to multicultural users in Sweden. The first section addresses library buildings and staff, stressing the importance of a welcoming environment. Library materials and technique are discussed in the second section, including media in other languages and access to the Internet. The third section considers…
Beware of electronic libraries / media
Sridhar, M. S.
1996-01-01
Print materials appeal to only one of the five senses, namely, the sight of man. Electronic medium provides for the effective use of the 'sight' and 'hearing' senses. With enormous dissemination capacity, easy acceptance by customers and monopolistic/profound effect on users a medium like TV acts as a 'third parent' to children, a powerful and hypnotic gadget to adults and a 'cultural melting pot' for the society. The advantages and limitations of both print and electronic media for informati...
Inspiring the Next Generation: Astronomy Catalyzes K12 STEM Education
Borders, Kareen; Thaller, Michelle; Winglee, Robert; Borders, Kyla
2017-06-01
K-12 educators need effective and relevant astronomy professional development. NASA's Mission Science provides innovative and accessible opportunities for K-12 teachers. Science questions involve scale and distance, including Moon/Earth scale, solar system scale, and distance of objects in the universe. Teachers can gain an understanding of basic telescopes, the history of telescopes, ground and satellite based telescopes, and models of JWST Telescope. An in-depth explanation of JWST and Spitzer telescopes gave participants background knowledge for infrared astronomy observations. During teacher training, we taught the electromagnetic spectrum through interactive stations. The stations included an overview via lecture and power point, the use of ultraviolet beads to determine ultraviolet exposure, the study of lenticulars and diagramming of infrared data, looking at visible light through diffraction glasses and diagramming the data, protocols for using astronomy based research in the classroom, and infrared thermometers to compare environmental conditions around the observatory. An overview of LIDAR physics was followed up by a simulated LIDAR mapping of the topography of Mars.We will outline specific steps for K-12 infrared astronomy professional development, provide data demonstrating the impact of the above professional development on educator understanding and classroom use, and detail future plans for additional K-12 professional development.Funding was provided by Washington STEM, NASA, and the Washington Space Grant Consortium.
The SERC K12 Educators Portal to Teaching Activities and Pedagogic Approaches
Larsen, K.; Kirk, K. B.; Manduca, C. A.; Ledley, T. S.; Schmitt, L.
2013-12-01
The Science Education Resource Center (SERC) has created a portal to information for K12 educators to provide high-quality grade level appropriate materials from a wide variety of projects and topics. These materials were compiled across the SERC site, showcasing materials that were created for, or easily adaptable to, K12 classrooms. This resource will help support implementation of Next Generation Science Standards by assisting educators in finding innovative resources to address areas of instruction that are conceptually different than previous national and state science standards. Specifically, the K12 portal assists educators in learning about approaches that address the cross-cutting nature of science concepts, increasing students quantitative reasoning and numeracy skills, incorporating technology such as GIS in the classroom, and by assisting educators of all levels of K12 instruction in using relevant and meaningful ways to teach science concepts. The K12 portal supports educators by providing access to hundreds of teaching activities covering a wide array of science topics and grade levels many of which have been rigorously reviewed for pedagogic quality and scientific accuracy. The portal also provides access to web pages that enhance teaching practices that help increase student's system thinking skills, make lectures interactive, assist instructors in conducting safe and effective indoor and outdoor labs, providing support for teaching energy and climate literacy principles, assisting educators in addressing controversial content, provide guidance in engaging students affective domain, and provides a collection of tools for making teaching relevant in 21st century classrooms including using GIS, Google Earth, videos, visualizations and simulations to model and describe scientific concepts. The portal also provides access to material for specific content and audiences by (1) Supporting AGIs 'Map your World' week to specifically highlight teaching
Enriching K-12 Science and Mathematics Education Using LEGOs
Williams, Keeshan; Igel, Irina; Poveda, Ronald; Kapila, Vikram; Iskander, Magued
2012-01-01
This paper presents a series of illustrative LEGO Mindstorms-based science and math activities, developed under an NSF GK-12 Fellows project, for elementary, middle, and high school grades. The activities, developed by engineering and science graduate Fellows in partnership with K-12 teachers, are grade appropriate, address pertinent learning…
Approaching K-12 Online Education in Pennsylvania
Vadell, Kathryn
2013-01-01
The purpose of this study is to determine how K-12 schools are addressing the need to accommodate online learners in Pennsylvania. It is built upon a review of literature focusing on educational legislation, the personalization of online learning and online learning solutions. The study posed 21 questions utilizing a mixed methods approach to…
Scientists Involved in K-12 Education
Robigou, V.
2004-12-01
The publication of countless reports documenting the dismal state of science education in the 1980s, and the Third International Mathematics and Science Study (TIMMS) report (1996) called for a wider involvement of the scientific community in K-12 education and outreach. Improving science education will not happen without the collaboration of educators and scientists working in a coordinated manner and it requires a long-term, continuous effort. To contribute effectively to K-12 education all scientists should refer to the National Science Education Standards, a set of policies that guide the development of curriculum and assessment. Ocean scientists can also specifically refer to the COSEE recommendations (www.cosee.org) that led to the creation of seven regional Centers for Ocean Sciences Education Excellence. Scientists can get involved in K-12 education in a multitude of ways. They should select projects that will accommodate time away from their research and teaching obligations, their talent, and their interest but also contribute to the education reform. A few examples of effective involvement are: 1) collaborating with colleagues in a school of education that can lead to better education of all students and future teachers, 2) acting as a resource for a national program or a local science fair, 3) serving on the advisory board of a program that develops educational material, 4) speaking out at professional meetings about the value of scientists' involvement in education, 5) speaking enthusiastically about the teaching profession. Improving science education in addition to research can seem a large, overwhelming task for scientists. As a result, focusing on projects that will fit the scientist's needs as well as benefit the science reform is of prime importance. It takes an enormous amount of work and financial and personnel resources to start a new program with measurable impact on students. So, finding the right opportunity is a priority, and stepping
USGS Spectral Library Version 7
Kokaly, Raymond F.; Clark, Roger N.; Swayze, Gregg A.; Livo, K. Eric; Hoefen, Todd M.; Pearson, Neil C.; Wise, Richard A.; Benzel, William M.; Lowers, Heather A.; Driscoll, Rhonda L.; Klein, Anna J.
2017-04-10
We have assembled a library of spectra measured with laboratory, field, and airborne spectrometers. The instruments used cover wavelengths from the ultraviolet to the far infrared (0.2 to 200 microns [μm]). Laboratory samples of specific minerals, plants, chemical compounds, and manmade materials were measured. In many cases, samples were purified, so that unique spectral features of a material can be related to its chemical structure. These spectro-chemical links are important for interpreting remotely sensed data collected in the field or from an aircraft or spacecraft. This library also contains physically constructed as well as mathematically computed mixtures. Four different spectrometer types were used to measure spectra in the library: (1) Beckman™ 5270 covering the spectral range 0.2 to 3 µm, (2) standard, high resolution (hi-res), and high-resolution Next Generation (hi-resNG) models of Analytical Spectral Devices (ASD) field portable spectrometers covering the range from 0.35 to 2.5 µm, (3) Nicolet™ Fourier Transform Infra-Red (FTIR) interferometer spectrometers covering the range from about 1.12 to 216 µm, and (4) the NASA Airborne Visible/Infra-Red Imaging Spectrometer AVIRIS, covering the range 0.37 to 2.5 µm. Measurements of rocks, soils, and natural mixtures of minerals were made in laboratory and field settings. Spectra of plant components and vegetation plots, comprising many plant types and species with varying backgrounds, are also in this library. Measurements by airborne spectrometers are included for forested vegetation plots, in which the trees are too tall for measurement by a field spectrometer. This report describes the instruments used, the organization of materials into chapters, metadata descriptions of spectra and samples, and possible artifacts in the spectral measurements. To facilitate greater application of the spectra, the library has also been convolved to selected spectrometer and imaging spectrometers sampling and
Directory of Open Access Journals (Sweden)
Jean K. Sand
2009-06-01
that understanding how to properly cite sources was a major area of concern. Students were also confused about whom to ask for help during the research process. Instructional intervention was developed and applied. The survey was re-administered with the addition of items that were based on the interventions. Responses showed a marked improvement in understanding by at least 20%. Some responses improved by as much as 60%. Conclusion - The study validated the Action Research Training Model as the first dimension and conceptual framework that informs and guides instructional practices of school library media specialists and teachers in a K-12 school district. After using the model to examine student-teacher knowledge and understanding of ethical use of information (second dimension, there was recognition of the need to clarify the school’s position on the ethical use of information for teachers and students and provide intentional instruction and interventions for students beginning at an earlier grade level. After being made aware of the results, teachers were anxious to work with library media specialists to address issues and to look for opportunities within research units to collaborate.
Observation of Λ-hypernuclei in the reaction 12C(π+,K+)/sub Λ/12C
International Nuclear Information System (INIS)
Milner, E.C.
1985-12-01
The observation of Λ-hypernuclear levels in /sub Λ/ 12 C by associated production through the (π + ,K + ) reaction is reported. Spectrometers used in the measurements are discussed. The /sub Λ/ 12 C excitation energy spectra were recorded at laboratory scattering angles of 5.6 0 , 10.3 0 , and 15.2 0 . The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup π/ = 2 + states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (π + ,K + ) reaction, compared to the (K - ,π - ) reaction in which lower spin states are excited. 29 refs., 40 figs
Tapping into the Power of Twitter: A Look at Its Potential in Canadian Health Libraries
Directory of Open Access Journals (Sweden)
David C. Waddell
2012-12-01
Full Text Available In health libraries, it is becoming increasingly important to recognize and understand user interactions and expectations. Research suggests that more and more patients will begin to rely on online resources to receive health information. In response, many health organizations have turned to social media and micro-blogging services to try and meet those needs. The ease of posting and sharing information on Twiter makes it an essential tool for health libraries use to reach their users. However, libraries that lack systematic metrics for measuring success can find themselves pouring precious resources into social media upkeep without knowing if they are promoting their strategic vision. This paper first uses a literature review to summarize the best practices among Twitter researchers. The authors then measure the success of these practices among several health libraries using simple metrics for evaluation. By advocating accountable Twitter use, the authors hope to promote a goal-oriented social media strategy that ensures health libraries are maximizing their efficiency. Administrators and libraries can engage communities through active Twitter use by going well beyond just promoting their services. Through better Twitter use, libraries can show users that they listen to other organizations in the community, hear and respond to the questions and concerns of individual users, and send people links to information that go beyond the reach of their own website. Administrators can subsequently report accurate metrics to demonstrate what is working well and which strategies have not been successful. It is then possible to make immediate changes to maximize the impact that social media can have on that organization’s strategic goals. The objective of this paper is to provide every reader with the ability to head into a meeting about social media and confidently develop a strategy that will plan for success, with the metrics to prove it.
MANAGING CHANGE IN ACADEMIC LIBRARY: THE CASE OF VILNIUS UNIVERSITY LIBRARY
Directory of Open Access Journals (Sweden)
Marija Prokopčik
2014-04-01
Full Text Available ABSTRACTPurpose: The main objective of this article is to ascertain some most significant fields of the academic library activities, which have (or could have an impact on strengthening the library’s role as a partner in academic community, as well as to perform assessment of Vilnius University Library (thereinafter VUL capacities in order to see what kind of current or future activities performed by the library may contribute to the building-up of such role in Vilnius University (thereinafter VU community.Methodology/approach: Analysis of LIS professional literature of the latter five years reveals the key trends in development of academic libraries, their innovative change and challenges – partnerships of open access, managing of research data; research support; research assessment, Library scientific research, as well as allows to perform situation analysis of one particular library in order to see if and at what scale these identified trends can be traced in VUL.Results: It was established that VUL contributes to the idea and practical implementation of open access, collaborates with VU and Lithuania’s academic community in the projects of research data management, takes an active part in carrying out bibliometric research, helps to form a range of research support services, promotes the Library’s scholarly research and contributes to formation of the institution’s research potential.Research limitation: This article focuses on analysis of one academic library (VUL and its activities. Such issues like studies support, library as a space for communication, professional assistance in research events organization, improvement of information and media literacy were deliberately not covered.Originality/practical implications: Identification of common trends and measures of their practical implementation in one particular institution may be useful for other libraries planning the strategy of change and (or implementing selected solutions.
K/sup -/n and K/sup -/p elastic scattering in K/sup -/d collisions from 12 to 22 GeV/c
Déclais, Y; Bricman, C; Duchon, J; Ferro-Luzzi, M; Louvel, M; Patry, J P; Perreau, J M; Séguinot, Jacques; Ypsilantis, Thomas
1977-01-01
The elastic scattering of negative K-mesons on the proton and on the neutron of the deuterium has been measured at six incident momenta equally spaced between 1.2 and 2.2 GeV/c. Differential cross sections over the almost complete angular range have been obtained for K/sup - /p and K/sup -/n. The aim of the experiment was the measurement of the pure isospin I=1 reaction K/sup -/n to K/sup -/n. The results for the reaction on proton are a by-product and provide a verification of the assumptions necessary for the analysis of the neutron reaction.
K-12 Education Nonprofit Employees' Perceptions of Strategies for Recruiting and Retaining Employees
Byrne, Tara Marie
2013-01-01
This qualitative study explored the key reasons individuals who work in K-12 education nonprofit organizations enter the field of K-12 nonprofit education and their motivations for doing so. The purpose of this study was to find new strategies for recruiting and retaining K-12 education nonprofit employees by examining the obstacles that exist to…
36 CFR 1253.3 - Presidential Libraries.
2010-07-01
... e-mail address is [email protected] (j) Ronald Reagan Library is located at 40 Presidential... is 805-577-4074. The e-mail address is reagan[email protected] (k) George Bush Library is located at...
Lon gene and photoprotection in Escherichia coli K-12
Energy Technology Data Exchange (ETDEWEB)
Waksman, G.; Thomas, G.; Favre, A. (Institut de Recherche en Biologie Moleculaire, Group de Photobiologie Moleculaire, Paris (France))
1984-03-01
Photoprotection, i.e. the increased resistance of the cells preilluminated with near ultraviolet light (300-380 nm) to the lethal action of 254nm radiations requires either an integrated prophage or a recA mutation in Escherichia coli K12 strains. Significant photoprotection occurs in an Escherichia coli K12 recA/sup +/ cell containing the lon allele responsible for filamentous growth after 254nm irradiation. The Fil phenotype can be suppressed by the sfiA or sfiB suppressor genes. Since the E. coli K12 recA/sup +/ lon sfiB strain exhibits no more photoprotection, it is concluded that in lon strains photoprotection is due to the abolition of the 254nm induced filamentation by the near ultraviolet treatment. In addition, near ultraviolet illumination of the cells leads to a severe restriction of the bulk protein synthesis. This effect is observed only in nuv/sup +/ cells that contain 4-thiouridine the chromophore responsible for photoprotection. It is proposed that in lon (lysogenic strains) photoprotection is due to prevention of the SOS response. During the growth lag, the low residual level of protein synthesis does not allow the induction of the SOS response and accordingly prevents filamentation (the lytic cycle).
Buenconsejo, Pio John S; Siegel, Alexander; Savan, Alan; Thienhaus, Sigurd; Ludwig, Alfred
2012-01-09
For different areas of combinatorial materials science, it is desirable to have multiple materials libraries: especially for irreversible high-throughput studies, like, for example, corrosion resistance testing in different media or annealing of complete materials libraries at different temperatures. Therefore a new combinatorial sputter-deposition process was developed which yields 24 materials libraries in one experiment on a single substrate. It is discussed with the example of 24 Ti-Ni-Ag materials libraries. They are divided based on the composition coverage and orientation of composition gradient into two sets of 12 nearly identical materials libraries. Each materials library covers at least 30-40% of the complete ternary composition range. An acid etch test in buffered-HF solution was performed, illustrating the feasibility of our approach for destructive materials characterization. The results revealed that within the composition range of Ni < 30 at.%, the films were severely etched. The composition range which shows reversible martensitic transformations was confirmed to be outside this region. The high output of the present method makes it attractive for combinatorial studies requiring multiple materials libraries.
E-Books in Public School Libraries: Are We There Yet?
Rothman, Allison
2017-01-01
Demands for school technology innovations, implementation of 1:1 device models, and increased interest in digital media highlight complicated issues such as funding, equity, and decision making for e-book collection development and programming in school libraries. School librarians considering purchase of e-books for school libraries still cannot…
Armed To Learn: Aiming At California K 12 School Gun Policy
2016-03-01
AIMING AT CALIFORNIA K-12 SCHOOL GUN POLICY by Catherine Wilson Jones March 2016 Thesis Co-Advisors: Kathleen Kiernan John Rollins...Master’s thesis 4. TITLE AND SUBTITLE ARMED TO LEARN: AIMING AT CALIFORNIA K-12 SCHOOL GUN POLICY 5. FUNDING NUMBERS 6. AUTHOR(S) Catherine...gap in viewpoints between gun control advocates who want tighter gun control and constitutionalists who believe as strongly in the Second Amendment
Development of the Advanced Energy Design Guide for K-12 Schools -- 50% Energy Savings
Energy Technology Data Exchange (ETDEWEB)
Bonnema, E.; Leach, M.; Pless, S.; Torcellini, P.
2013-02-01
This Technical Support Document (TSD) describes the process and methodology for the development of the Advanced Energy Design Guide for K-12 School Buildings: Achieving 50% Energy Savings Toward a Net Zero Energy Building (AEDG-K12) (ASHRAE et al. 2011a). The AEDG-K12 provides recommendations for achieving 50% whole-building energy savings in K-12 schools over levels achieved by following ANSI/ASHRAE/IESNA Standard 90.1-2004, Energy Standard for Buildings Except Low-Rise Residential Buildings (Standard 90.1-2004) (ASHRAE 2004b). The AEDG-K12 was developed in collaboration with the American Society of Heating, Refrigerating and Air-Conditioning Engineers (ASHRAE), the American Institute of Architects (AIA), the Illuminating Engineering Society of North America (IES), the U.S. Green Building Council (USGBC), and the U.S. Department of Energy (DOE).
A Survey of Graphic Novel Collection and Use in American Public Libraries
Directory of Open Access Journals (Sweden)
Edward Francis Schneider
2014-09-01
Full Text Available Objective – The objective of this study was to survey American public libraries about their collection and use of graphic novels and compare their use to similar data collected about video games. Methods – Public libraries were identified and contacted electronically for participation through an open US government database of public library systems. The libraries contacted were asked to participate voluntarily. Results – The results indicated that both graphic novels and video games have become a common part of library collections, and both media can have high levels of impact on circulation. Results indicated that while almost all libraries surveyed had some graphic novels in their collections, those serving larger populations were much more likely to use graphic novels in patron outreach. Similarly, video game collection was also more commonly found in libraries serving larger populations. Results also showed that young readers were the primary users of graphic novels. Conclusion – Responses provided a clear indicator that graphic novels are a near-ubiquitous part of public libraries today. The results on readership bolster the concept of graphic novels as a gateway to adult literacy. The results also highlight differences between larger and smaller libraries in terms of resource allocations towards new media. The patron demographics associated with comics show that library cooperation could be a potential marketing tool for comic book companies.
Ping, Qing; Yang, Christopher C.; Marshall, Sarah A.; Avis, Nancy E.; Ip, Edward H.
2017-01-01
Most cancer patients, including patients with breast cancer, experience multiple symptoms simultaneously while receiving active treatment. Some symptoms tend to occur together and may be related, such as hot flashes and night sweats. Co-occurring symptoms may have a multiplicative effect on patients’ functioning, mental health, and quality of life. Symptom clusters in the context of oncology were originally described as groups of three or more related symptoms. Some authors have suggested symptom clusters may have practical applications, such as the formulation of more effective therapeutic interventions that address the combined effects of symptoms rather than treating each symptom separately. Most studies that have sought to identify clusters in breast cancer survivors have relied on traditional research studies. Social media, such as online health-related forums, contain a bevy of user-generated content in the form of threads and posts, and could be used as a data source to identify and characterize symptom clusters among cancer patients. The present study seeks to determine patterns of symptom clusters in breast cancer survivors derived from both social media and research study data using improved K-Medoid clustering. A total of 50,426 publicly available messages were collected from Medhelp.com and 653 questionnaires were collected as part of a research study. The network of symptoms built from social media was sparse compared to that of the research study data, making the social media data easier to partition. The proposed revised K-Medoid clustering helps to improve the clustering performance by re-assigning some of the negative-ASW (average silhouette width) symptoms to other clusters after initial K-Medoid clustering. This retains an overall non-decreasing ASW and avoids the problem of trapping in local optima. The overall ASW, individual ASW, and improved interpretation of the final clustering solution suggest improvement. The clustering results suggest
Ping, Qing; Yang, Christopher C; Marshall, Sarah A; Avis, Nancy E; Ip, Edward H
2016-06-01
Most cancer patients, including patients with breast cancer, experience multiple symptoms simultaneously while receiving active treatment. Some symptoms tend to occur together and may be related, such as hot flashes and night sweats. Co-occurring symptoms may have a multiplicative effect on patients' functioning, mental health, and quality of life. Symptom clusters in the context of oncology were originally described as groups of three or more related symptoms. Some authors have suggested symptom clusters may have practical applications, such as the formulation of more effective therapeutic interventions that address the combined effects of symptoms rather than treating each symptom separately. Most studies that have sought to identify clusters in breast cancer survivors have relied on traditional research studies. Social media, such as online health-related forums, contain a bevy of user-generated content in the form of threads and posts, and could be used as a data source to identify and characterize symptom clusters among cancer patients. The present study seeks to determine patterns of symptom clusters in breast cancer survivors derived from both social media and research study data using improved K-Medoid clustering. A total of 50,426 publicly available messages were collected from Medhelp.com and 653 questionnaires were collected as part of a research study. The network of symptoms built from social media was sparse compared to that of the research study data, making the social media data easier to partition. The proposed revised K-Medoid clustering helps to improve the clustering performance by re-assigning some of the negative-ASW (average silhouette width) symptoms to other clusters after initial K-Medoid clustering. This retains an overall non-decreasing ASW and avoids the problem of trapping in local optima. The overall ASW, individual ASW, and improved interpretation of the final clustering solution suggest improvement. The clustering results suggest
[Carcinogenesis and its mechanism of mutant-type[12Asp]K-ras4B gene].
Gui, Li-ming; Wei, Li-hui; Zhang, Ying-mei; Wang, Jian-liu; Wang, Ying; Chen, Ying; Ma, Da-long
2002-01-01
Ras gene plays an important role in the extra- and intra-cellular signal transduction pathway. It mediates series cascade reactions, and eventually actives transcriptional factors in nucleus. It is unknown on the mechanism of carcinogenesis of Ras gene in endometrial carcinoma, though K-ras mutant is very common in endometrial atypical hyperplasia and carcinoma. On basis of discovering the mutation in 12th codon of K-ras in endometrial carcinoma cell line, HEC-1A, we explored the carcinogenesis and molecular mechanism of mutant-type [12Asp] K-ras4B gene. (1) Full-length [12Asp]K-ras4B cDNA was amplified with RT-PCR, then inserted into pcDI eukaryotic expressive vector. (2) Morphological change, growth kinetics in vitro and tumorigencity in nude mice in vivo after-before transfection were observed. (3) To test the cell growth kinetics by methyl thiazolium tetrazolium (MTT) and [3H]thymidine incorporation method. (1) The authors have successfully constructed eukaryotic expression plasmid pcDI-[12Asp] K-ras4B; (2) To confirm that [12Asp] K-ras4B mutant can trigger the neoplastic transformation of NIH3T3 cells by test in vitro and in vivo. (3) After pMCV-RasN17 plasmid, a Ras mutant were transfected into pcDI-[12Asp] K-ras4B cells, the growth of this cell were restrained significantly in comparison with control group. (4) These findings indicate the expression of RafS621A resulted in remarkable inhibition in proliferation of pcDI-[12Asp]K-ras4B cell (P ras4B cell growth (P ras4B gene alone is able to cause neoplastic transformation in NIH3T3 cells in vitro and in vivo. (2) [12Asp]K-ras4B-induced NIH3T3 cells neoplastic transformation required Raf signaling pathway.
The Green Pages: Environmental Education Activities K-12.
Clearing, 1990
1990-01-01
Presented are 37 environmental science activities for students in grades K-12. Topics include water pollution, glaciers, protective coloration, shapes in nature, environmental impacts, recycling, creative writing, litter, shapes found in nature, color, rain cycle, waste management, plastics, energy, pH, landfills, runoff, watersheds,…
Nigerian School Library Journal - Vol 10 (2011)
African Journals Online (AJOL)
Career in School Librarianship: A Necessity for Provision of Effective School Library Media Programmes in Nigerian Schools. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DF Elaturoti, 1-5 ...
Social Media in the Curriculum and Co-Curriculum: Pre-Service Teachers and Their Collegiate Peers
Heiberger, Greg A.
2013-01-01
Although use of social media by students has been shown to be nearly ubiquitous, many K-12 school systems have banned its use on their campuses or use between their teachers and students. In contrast, many collegiate faculty have utilized social media in their teaching. Social media has been shown to assist faculty in engaging with students,…
K-12 Online Learning and the Training Needs for School Psychology Practitioners
Tysinger, P. Dawn; Tysinger, Jeff; Diamanduros, Terry; Kennedy, Kathryn
2013-01-01
K-12 online learning is growing at an exponential rate in the United States and around the world. Students and teachers are entering and embracing the K-12 online learning environment. Thus, it becomes imperative for school psychologists to follow. In order to offer the most productive learning environment for all students, the services provided…
Generic vs. Modality-Specific Competencies for K-12 Online and Blended Teaching
Pulham, Emily B.; Graham, Charles R.; Short, Cecil R.
2018-01-01
Although research has explored teacher competencies in K-12 blended and online learning, it has not specified which competencies are appropriate to an online or digital medium, which refer to blending in-person with online experiences, or which are generic--applicable in any teaching modality. This article explores selected K-12 online and blended…
Germain, Claudia; Mayo, Jeanne B.; Hart, Lisa
2000-01-01
Provides five fully developed library media activities that are designed for use with specific curriculum units in reading and language arts, science, social studies, and music. Library media skills, curriculum objectives, grade levels, resources, instructional roles, procedures, evaluation, and follow-up are described for each activity. (LRW)
Making LibrariesAccessible for Visually Impaired Users: Practical Advice For Librarians
Directory of Open Access Journals (Sweden)
Devney Hamilton
2011-12-01
Full Text Available This article provides an introduction to making university libraries accessible to visually impaired users. It includes a summary of how visually impaired students access information and how libraries can provide access to materials, devices and software, and staff support to ensure visually impaired students ’ equal opportunity to use the library. The practical advice for librarians are based on interviews with 18 visually impaired university students and professionals who specialize in media, library services and information retrieval.
Energy Technology Data Exchange (ETDEWEB)
Chang, Jong Hwa; Lee, Young Ouk; Han, Yin Iu
2000-03-01
This report contains summary information and figures depicting the KAERI photonuclear data library that extends up to 140 MeV of incident photon. The library consists of 143 isotopes from C-12 to Bi-209, providing the photoabsorption cross section and the emission spectra for neutron, proton, deuteron, triton, alpha particles, and all residual nuclides in ENDF6 format. The contents of this report and ENDF-6 format data library are available at http://atom.kaeri.re.kr/.
K-12 Teachers' Perceptions of School Policy and Fear of School Violence
Ricketts, Melissa L.
2007-01-01
Since the 1990s, schools have focused their attention on policies designed to improve school safety. Most researches on school violence policies have concentrated on the needs of students and administrators. This study investigated the impact of school violence policies on K-12 teachers' fear. Using self-report data from 447 K-12 teachers from a…
Opinions on Computing Education in Korean K-12 System: Higher Education Perspective
Kim, Dae-Kyoo; Jeong, Dongwon; Lu, Lunjin; Debnath, Debatosh; Ming, Hua
2015-01-01
The need for computing education in the K-12 curriculum has grown globally. The Republic of Korea is not an exception. In response to the need, the Korean Ministry of Education has announced an outline for software-centric computing education in the K-12 system, which aims at enhancing the current computing education with software emphasis. In…
GABAB receptor phosphorylation regulates KCTD12-induced K+ current desensitization
DEFF Research Database (Denmark)
Adelfinger, L; Turecek, R; Ivankova, K
2014-01-01
released from the G-protein. Receptor-activated K+ currents desensitize in the sustained presence of agonist to avoid excessive effects on neuronal activity. Desensitization of K+ currents integrates distinct mechanistic underpinnings. GABAB receptor activity reduces protein kinase-A activity, which...... reduces phosphorylation of serine-892 in GABAB2 and promotes receptor degradation. This form of desensitization operates on the time scale of several minutes to hours. A faster form of desensitization is induced by the auxiliary subunit KCTD12, which interferes with channel activation by binding to the G......-protein βγ subunits. Here we show that the two mechanisms of desensitization influence each other. Serine-892 phosphorylation in heterologous cells rearranges KCTD12 at the receptor and slows KCTD12-induced desensitization. Likewise, protein kinase-A activation in hippocampal neurons slows fast...
Crowd-Sourcing with K-12 citizen scientists: The Continuing Evolution of the GLOBE Program
Murphy, T.; Wegner, K.; Andersen, T. J.
2016-12-01
Twenty years ago, the Internet was still in its infancy, citizen science was a relatively unknown term, and the idea of a global citizen science database was unheard of. Then the Global Learning and Observations to Benefit the Environment (GLOBE) Program was proposed and this all changed. GLOBE was one of the first K-12 citizen science programs on a global scale. An initial large scale ramp-up of the program was followed by the establishment of a network of partners in countries and within the U.S. Now in the 21st century, the program has over 50 protocols in atmosphere, biosphere, hydrosphere and pedosphere, almost 140 million measurements in the database, a visualization system, collaborations with NASA satellite mission scientists (GPM, SMAP) and other scientists, as well as research projects by GLOBE students. As technology changed over the past two decades, it was integrated into the program's outreach efforts to existing and new members with the result that the program now has a strong social media presence. In 2016, a new app was launched which opened up GLOBE and data entry to citizen scientists of all ages. The app is aimed at fresh audiences, beyond the traditional GLOBE K-12 community. Groups targeted included: scouting organizations, museums, 4H, science learning centers, retirement communities, etc. to broaden participation in the program and increase the number of data available to students and scientists. Through the 20 years of GLOBE, lessons have been learned about changing the management of this type of large-scale program, the use of technology to enhance and improve the experience for members, and increasing community involvement in the program.
APPROXIMATIONS TO THE USES OF TWITTER BY UNIVERSITY LIBRARIES IN ARGENTINA.
Directory of Open Access Journals (Sweden)
Claudia Nora Laudano
2016-07-01
Full Text Available This article analyses the main uses of the social media Twitter in university libraries in Argentina. After revising existing literature, we outline the research methods used to identify whether libraries are currently adopting Twitter and how it is being used. We focus on the following areas: the starting date of the activity, basic institutional data, visibility and access to Twitter from the library web, the quantity of tweets over time, those "followed" and those "following" and quantity and type of posts during the period of time selected for research. The results show that few libraries have used Twitter and their use of this media tool has generally been unplanned, mostly for spreading information rather than interaction. It also stresses that despite an extensive literature on what are considered good practices, generally they are not taken by the institutions. At last, we propose further research in this area to widen our knowledge of the daily use of Twitter among librarians.
ABCD, an Open Source Software for Modern Libraries
Directory of Open Access Journals (Sweden)
Sangeeta Namdev Dhamdhere
2011-12-01
Full Text Available Nowadays, librarians are using various kinds of open source software for different purposes such as library automation, digitization, institutional repository, content management. ABCD, acronym for Automatisación de Bibliotécas y Centros de Documentación, is one of such software. It caters to almost all present needs of modern libraries of any sizes. It offers a solution to library automation with ISBD as well as local formats. It has excellent indexing and retrieval features based on UNESCO’s ISIS technology, a web OPAC, and a library Portal with integrated meta-search and content management system to manage online as well as offline digital resources and physical documents and media.
Appearance Culture in Nine- to 12-Year-Old Girls: Media and Peer Influences on Body Dissatisfaction
Clark, Levina; Tiggemann, Marika
2006-01-01
Little research has investigated sociocultural factors in the development of body dissatisfaction in preadolescent girls. This study examined the combined influence of media and peer factors. The participants were 100 girls aged nine to 12 years. The girls completed questionnaire measures of media exposure (television and magazines), peer…
Tinkering with Teachers: The Case for 3D Printing in the Education Library
Elrod, Rachael
2016-01-01
Opportunities to utilize 3D printing in the K-12 classroom are growing every day. This paper describes the process of implementing a 3D printing service in the Education Library of The University of Florida, Gainesville, a large, doctoral-degree granting, research university. Included are examples of lesson plans featuring 3D printing, creation of…
African Journal of Library, Archives and Information Science - Vol 12 ...
African Journals Online (AJOL)
Computer Anxiety, Phobia, Obsession and Work-Stress at the University of Ibadan: Part 2 - Evaluation of a Model. M.A. Tiamiyu, A. Ajayi, W.M. Olatokun. Resource Mobilisation for Library and Information Services Development in Africa. Elizabeth Kiondo. Moving a Small Library in an African Setting. Adriaan Swanepoel ...
Kaluzienski, Lynn; Hamley, Catherine; Rodda, Charles; Kranich, Gregory; Wilson, Laura
2016-01-01
Follow a Researcher™ is an innovative University of Maine 4-H program that connects youth with a graduate student who is conducting field research in a remote location. Using technology and social media, K-12 classrooms have an unprecedented opportunity to get to know a student researcher. Youth engage in the research process and witness NGSS Science and Engineering Practices in action.
Middle School Students' Social Media Use
Martin, Florence; Wang, Chuang; Petty, Teresa; Wang, Weichao; Wilkins, Patti
2018-01-01
Cyber bullying, digital identity, impact of digital footprints, and use of inappropriate social media are topics that are gaining attention in K-12 schools. As more schools and school districts are implementing 1-1 and "bring your own technology" initiatives, attention to these topics is becoming increasingly important. A total of 593…
The Gender and Science Digital Library: Affecting Student Achievement in Science.
Nair, Sarita
2003-01-01
Describes the Gender and Science Digital Library (GSDL), an online collection of high-quality, interactive science resources that are gender-fair, inclusive, and engaging to students. Considers use by teachers and school library media specialists to encourage girls to enter careers in science, technology, engineering, and math (STEM). (LRW)
Nigerian School Library Journal - Vol 9 (2009)
African Journals Online (AJOL)
Automation of school library media centres in the 21 century: The imperative of databases and software packages · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. TK Oluwakemi, JO Richard, 57-72 ...
Evaluating the Performance of Online K-12 Schools
Carpenter, Dick; Kafer, Krista; Reeser, Kelly; Shafer, Sheryl
2015-01-01
This article examines K-12 online student and school performance across an entire state (Colorado) in the United States through two comparisons. First, state assessment scores of students in online schools are compared to those in traditional brick and mortar schools. Second, the accountability scores of online schools are compared to those of…
Designing GIS Learning Materials for K-12 Teachers
Hong, Jung Eun
2017-01-01
Although previous studies have proven the usefulness and effectiveness of geographic information system (GIS) use in the K-12 classroom, the rate of teacher adoption remains low. The identified major barrier to its use is a lack of teachers' background and experience. To solve this limitation, many organisations have provided GIS-related teacher…
Effects of paraquat on Escherichia coli: Differences between B and K-12 strains
International Nuclear Information System (INIS)
Kitzler, J.W.; Minakami, H.; Fridovich, I.
1990-01-01
Escherichia coli B and K-12 are equally susceptible to the bacteriostatic effects of aerobic paraquat, but they differed strikingly when the lethality of paraquat was evaluated. E. coli B suffered an apparent loss of viability when briefly exposed to paraquat, whereas E. coli K-12 did not. This difference depended on the ability of the B-strain, but not the K-12 strain, to retain internalized paraquat; the B strain was killed on aerobic tryptic soy-yeast extract plates during the incubation which preceded the counting of colonies. This difference in retention of paraquat between strains was demonstrated by delayed loss of viability, by growth inhibition, and by cyanide-resistant respiration after brief exposure to paraquat, washing, and testing in fresh medium. This difference was also shown by using [ 14 C]paraquat. This previously unrecognized difference between E. coli B and K-12 has been the cause of apparently contradictory reports and should lead to some reevaluation of the pertinent literature
Engineering design skills coverage in K-12 engineering program curriculum materials in the USA
Chabalengula, Vivien M.; Mumba, Frackson
2017-11-01
The current K-12 Science Education framework and Next Generation Science Standards (NGSS) in the United States emphasise the integration of engineering design in science instruction to promote scientific literacy and engineering design skills among students. As such, many engineering education programmes have developed curriculum materials that are being used in K-12 settings. However, little is known about the nature and extent to which engineering design skills outlined in NGSS are addressed in these K-12 engineering education programme curriculum materials. We analysed nine K-12 engineering education programmes for the nature and extent of engineering design skills coverage. Results show that developing possible solutions and actual designing of prototypes were the highly covered engineering design skills; specification of clear goals, criteria, and constraints received medium coverage; defining and identifying an engineering problem; optimising the design solution; and demonstrating how a prototype works, and making iterations to improve designs were lowly covered. These trends were similar across grade levels and across discipline-specific curriculum materials. These results have implications on engineering design-integrated science teaching and learning in K-12 settings.
Energy Technology Data Exchange (ETDEWEB)
Tahmasebi, Elham [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of); Shakerzadeh, Ehsan, E-mail: e.shakerzadeh@scu.ac.ir [Chemistry Department, Faculty of Science, Shahid Chamran University, Ahvaz (Iran, Islamic Republic of); Biglari, Zeinab [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of)
2016-02-15
Graphical abstract: - Highlights: • Encapsulation of Li, Na and K narrow the HOMO–LUMO gaps of the clusters. • The group III nitrides nanoclusters strongly interacted with the alkali metals. • First hyperpolarizabilities remarkably enhance for B{sub 12}N{sub 12} encapsulated with Na/K. - Abstract: Density functional theory (DFT) calculations have been carried out to study the influence of alkali metals (Li, Na and K) encapsulation within the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and the group IV carbides (C{sub 24}, Si{sub 12}C{sub 12}and Ge{sub 12}C{sub 12}) nanoclusters. The encapsulation of Li, Na and K atoms is found to narrow the HOMO–LUMO gaps of the considered clusters. The electronic properties of these clusters, especially the group III nitrides nanoclusters, are strongly sensitive to interaction with the alkali metals. Moreover it is observed that the encapsulation of alkali metals enhances the first hyperpolarizabilities of B{sub 12}N{sub 12} nanocluster. Surprisingly, due to the alkali metals encapsulation within B{sub 12}N{sub 12} nanocluster, the first hyperpolarizability values are remarkably increased to 8505.49 and 122,503.76 a.u. for Na@B{sub 12}N{sub 12} and K@B{sub 12}N{sub 12}, respectively. Also the TD-DFT calculations at both CAM-B3LYP/6-311+G(d) and PBE0/6-311+G(d) levels of theory are also performed to investigate the origin of first hyperpolarizabilities.
Designer Librarian: Embedded in K12 Online Learning
Boyer, Brenda
2015-01-01
Over the past two decades, shifts in technology have altered the roles of school librarians in a multitude of ways. New rigorous standards, proliferation of devices, and steady growth of online and blended learning for the K12 market now demand librarians engage with learners in online environments. Taking an instructional design approach is the…
Online System Adoption and K-12 Academic Outcomes
Kimmons, R.
2015-01-01
This study seeks to understand the relationship between K-12 online system adoption (e.g., Blackboard, Edmodo, WordPress) and school-level academic achievement ratings. Utilizing a novel approach to data collection via website data extraction and indexing of all school websites in a target state in the United States (n?=?732) and merging these…
Florida's Opinion on K-12 Public Education Spending
Forster, Greg
2006-01-01
This scientifically representative poll of 1,200 Floridians finds that public opinion about K-12 public education spending is seriously misinformed. Floridians think public schools need more money, but the main reason is that they are badly mistaken about how much money the public schools actually get. Key findings of the study include: (1) Half…
International Electrotechnical Commission. Geneva
2005-01-01
Power cables with extruded insulation and their accessories for rated voltages from 1 kV (Um = 1,2 kV) up to 30 kV (Um = 36 kV) : Part 2: cables for rated voltages from 6 kV (Um = 7,2 kV) up to 30 kV (Um = 36 kV)
International Nuclear Information System (INIS)
Pope, A.L.
1965-05-01
This paper describes the programme EDITOR and gives operating instructions. EDITOR is written in the S2 FORTRAN dialect for the IBM 7030 computer. Its purpose is to prepare data library tapes for the U.K.A.E.A. nuclear data library by copying prescribed data files in BCD from one or more input data tapes, or from card decks, on to a single output tape. The first version of the programme was designed by D. Sams at A.W.R.E. Aldermaston; a number of improvements have been incorporated into the current version. (author)
VizieR Online Data Catalog: A library of high-S/N optical spectra of FGKM stars (Yee+, 2017)
Yee, S. W.; Petigura, E. A.; von Braun, K.
2017-09-01
Classification of stars, by comparing their optical spectra to a few dozen spectral standards, has been a workhorse of observational astronomy for more than a century. Here, we extend this technique by compiling a library of optical spectra of 404 touchstone stars observed with Keck/HIRES by the California Planet Search. The spectra have high resolution (R~60000), high signal-to-noise ratio (S/N~150/pixel), and are registered onto a common wavelength scale. The library stars have properties derived from interferometry, asteroseismology, LTE spectral synthesis, and spectrophotometry. To address a lack of well-characterized late-K dwarfs in the literature, we measure stellar radii and temperatures for 23 nearby K dwarfs, using modeling of the spectral energy distribution and Gaia parallaxes. This library represents a uniform data set spanning the spectral types ~M5-F1 (Teff~3000-7000K, R*~0.1-16R{Sun}). We also present "Empirical SpecMatch" (SpecMatch-Emp), a tool for parameterizing unknown spectra by comparing them against our spectral library. For FGKM stars, SpecMatch-Emp achieves accuracies of 100K in effective temperature (Teff), 15% in stellar radius (R*), and 0.09dex in metallicity ([Fe/H]). Because the code relies on empirical spectra it performs particularly well for stars ~K4 and later, which are challenging to model with existing spectral synthesizers, reaching accuracies of 70K in Teff, 10% in R*, and 0.12dex in [Fe/H]. We also validate the performance of SpecMatch-Emp, finding it to be robust at lower spectral resolution and S/N, enabling the characterization of faint late-type stars. Both the library and stellar characterization code are publicly available. (2 data files).
Active Commuting among K-12 Educators: A Study Examining Walking and Biking to Work
Bopp, Melissa; Hastmann, Tanis J.; Norton, Alyssa N.
2013-01-01
Background. Walking and biking to work, active commuting (AC) is associated with many health benefits, though rates of AC remain low in the US. K-12 educators represent a significant portion of the workforce, and employee health and associated costs may have significant economic impact. Therefore, the purpose of this study was to examine the current rates of AC and factors associated with AC among K-12 educators. Methods. A volunteer sample of K-12 educators (n = 437) was recruited to partici...
California's K-12 Public Schools. How Are They Doing?
National Research Council Canada - National Science Library
Carroll, Stephen J; Krop, Cathy; Arkes, Jeremy; Morrison, Peter A; Flanagan, Ann
2005-01-01
... are no longer performing as well as they did previously or as well as schools in other states. The primary objective of our study was to look closely at California's public system of kindergarten through twelfth grade (K-12...
Repositioning teaching in Nigerian secondary schools using media ...
African Journals Online (AJOL)
Repositioning teaching in Nigerian secondary schools using media resources in a digital age. ... Lagos Journal of Library and Information Science ... that the new tools served as an added advantage on the traditional method of teaching and learning, especially in information delivery; channelled through media resources.
Randall, K; Lever, M; Peddie, B A; Chambers, S T
1995-08-17
Escherichia coli was grown in hyperosmotic media containing both glycine betaine and one other betaine. E. coli K-12 derivative WG439 (putP- proP- proU-) did not accumulate any of 15 betaines. Strains WG445 (putP- proP- proU+), WG443 (putP- proP+ proU-) and the control strains all accumulated less betaine, (CH3)3N(+)-(CH2)n-COO-, when n was greater than 1. Accumulation was not detectable when n = 5. Both L- and D-isomers of alpha-substituted betaines were accumulated by both strains WG443 and WG445, the D-isomers more slowly. Hydroxylated alpha-substituted betaines were accumulated relatively more through the osmoregulated transport protein ProU than through ProP. In actively growing cultures glycine betaine appeared to be the preferred substrate for accumulation, but the proportion of the second accumulated betaine increased as cultures approached stationary phase.
Development of an Attitude Scale to Assess K-12 Teachers' Attitudes toward Nanotechnology
Lan, Yu-Ling
2012-01-01
To maximize the contributions of nanotechnology to this society, at least 60 countries have put efforts into this field. In Taiwan, a government-funded K-12 Nanotechnology Programme was established to train K-12 teachers with adequate nanotechnology literacy to foster the next generation of Taiwanese people with sufficient knowledge in…
Winant, Richard M.
1983-01-01
Virginia Commonwealth University's University Library Services offers through its organizational structure an opportunity for librarians to work directly with media experts. University Library Services envisions the future librarian as an information manager, information specialist, and teacher. In joining together Technical Services, Public Services, Collection Management, Special Collections, Learning Resource Centers, Media Production Center, AV Services, TV Services, Engineering and Telecommunications, the librarian is in an environment which gives the opportunity for growth and support by media expertise.
Automation of school library media centres in the 21 st century: The ...
African Journals Online (AJOL)
examines the various categories of software packages available for libraries and information centres and the extent to which library automation will support their information delivery system. The paper emphasizes the criteria for sofllllare evaluation and finally concluded that the tremendous advancement in computer ...
Cross, Deborah Iyron
2015-01-01
Arizona Online Instruction (AOI) provided an instructional alternative to nearly fifty thousand K-12 students in Arizona during the 2012-2013 school year. Growth in online education underscores the importance of evolving the role of the K-12 virtual teacher as the human agent (Turvey, 2008) demonstrating social learning theory (Bandura, 1977) by…
The lon gene and photoprotection in Escherichia coli K-12
International Nuclear Information System (INIS)
Waksman, G.; Thomas, G.; Favre, A.
1984-01-01
Photoprotection, i.e. the increased resistance of the cells preilluminated with near ultraviolet light (300-380 nm) to the lethal action of 254nm radiations requires either an integrated prophage or a recA mutation in Escherichia coli K12 strains. Significant photoprotection occurs in an Escherichia coli K12 recA + cell containing the lon allele responsible for filamentous growth after 254nm irradiation. The Fil phenotype can be suppressed by the sfiA or sfiB suppressor genes. Since the E. coli K12 recA + lon sfiB strain exhibits no more photoprotection, it is concluded that in lon strains photoprotection is due to the abolition of the 254nm induced filamentation by the near ultraviolet treatment. In addition, near ultraviolet illumination of the cells leads to a severe restriction of the bulk protein synthesis. This effect is observed only in nuv + cells that contain 4-thiouridine the chromophore responsible for photoprotection. It is proposed that in lon (lysogenic strains) photoprotection is due to prevention of the SOS response. During the growth lag, the low residual level of protein synthesis does not allow the induction of the SOS response and accordingly prevents filamentation (the lytic cycle). (author)
The Engaged Microbiologist: Bringing the Microbiological Sciences to the K-12 Community.
Westenberg, David J
2016-03-01
Exposing K-12 students to cutting edge science that impacts their daily lives can bring classroom lessons to life. Citizen-science projects are an excellent way to bring high-level science to the classroom and help satisfy one of the cornerstone concepts of the Next Generation Science Standards (NGSS), "engaging in practices that scientists and engineers actually use." This can be a daunting task for teachers who may lack the background or resources to integrate these projects into the classroom. This is where scientific societies such as the American Society for Microbiology (ASM) can play a critical role. ASM encourages its members to engage with the K-12 community by providing networking opportunities and resources for ASM members and K-12 teachers to work together to bring microbiology into the classroom. Journal of Microbiology & Biology Education.
Involving Practicing Scientists in K-12 Science Teacher Professional Development
Bertram, K. B.
2011-12-01
The Science Teacher Education Program (STEP) offered a unique framework for creating professional development courses focused on Arctic research from 2006-2009. Under the STEP framework, science, technology, engineering, and math (STEM) training was delivered by teams of practicing Arctic researchers in partnership with master teachers with 20+ years experience teaching STEM content in K-12 classrooms. Courses based on the framework were offered to educators across Alaska. STEP offered in-person summer-intensive institutes and follow-on audio-conferenced field-test courses during the academic year, supplemented by online scientist mentorship for teachers. During STEP courses, teams of scientists offered in-depth STEM content instruction at the graduate level for teachers of all grade levels. STEP graduate-level training culminated in the translation of information and data learned from Arctic scientists into standard-aligned lessons designed for immediate use in K-12 classrooms. This presentation will focus on research that explored the question: To what degree was scientist involvement beneficial to teacher training and to what degree was STEP scientist involvement beneficial to scientist instructors? Data sources reveal consistently high levels of ongoing (4 year) scientist and teacher participation; high STEM content learning outcomes for teachers; high STEM content learning outcomes for students; high ratings of STEP courses by scientists and teachers; and a discussion of the reasons scientists indicate they benefited from STEP involvement. Analyses of open-ended comments by teachers and scientists support and clarify these findings. A grounded theory approach was used to analyze teacher and scientist qualitative feedback. Comments were coded and patterns analyzed in three databases. The vast majority of teacher open-ended comments indicate that STEP involvement improved K-12 STEM classroom instruction, and the vast majority of scientist open-ended comments
Improving Public Library Services for Rural Community Development
African Journals Online (AJOL)
The library as a social instrument for transformation in response to the ... To provide effective services for children and young people including requisite .... explanations clearer than they would have been without this multi-media tool especially.
CP violation and ΔI=1/2 enhancement in K decays
International Nuclear Information System (INIS)
Choudhury, S.R.; Scadron, M.D.
1996-01-01
We study CP-conserving and CP-violating K 0 →ππ and K 0 →ππγ decays, using the same techniques which explain the ΔI=1/2 enhancement of the former to also explore CP violation of the latter transitions. If CP violation is driven by the WWγ vertex, we show that direct CP violation in K L →ππγ is scaled to the s→dγ E1 quark transition and the latter is suppressed by the GIM mechanism (compatible with recent experiments). In the same spirit, the dominant ΔI=1/2 enhancement of CP-conserving kaon weak decays can be scaled to an s→d quark transition which is enhanced by the GIM mechanism. copyright 1996 The American Physical Society
K-12 Teacher Perceptions Regarding the Flipped Classroom Model for Teaching and Learning
Gough, Evan; DeJong, David; Grundmeyer, Trent; Baron, Mark
2017-01-01
A great deal of evidence can be cited from higher education literature on the effectiveness of the flipped classroom; however, very little research was discovered on the flipped classroom at the K-12 level. This study examined K-12 teachers' perceptions regarding the flipped classroom and differences in teachers' perceptions based on grade level…
The influence of excess K2O on the electrical properties of (K,Na)1/2Bi1/2TiO3 ceramics
Li, Linhao; Li, Ming; Sinclair, Derek C.
2018-04-01
The solid solution (KxNa0.50-x)Bi0.50TiO3 (KNBT) between Na1/2Bi1/2TiO3 and K1/2Bi1/2TiO3 (KBT) has been extensively researched as a candidate lead-free piezoelectric material because of its relatively high Curie temperature and good piezoelectric properties, especially near the morphotropic phase boundary (MPB) at x ˜ 0.10 (20 mol. % KBT). Here, we show that low levels of excess K2O in the starting compositions, i.e., (Ky+0.03Na0.50-y)Bi0.50TiO3.015 (y-series), can significantly change the conduction mechanism and electrical properties compared to a nominally stoichiometric KNBT series (KxNa0.50-x)Bi0.50TiO3 (x-series). Impedance spectroscopy measurements reveal significantly higher bulk conductivity (σb) values for y ≥ 0.10 samples [activation energy (Ea) ≤ 0.95 eV] compared to the corresponding x-series samples which possess bandgap type electronic conduction (Ea ˜ 1.26-1.85 eV). The largest difference in electrical properties occurs close to the MPB composition (20 mol. % KBT) where y = 0.10 ceramics possess σb (at 300 °C) that is 4 orders of magnitude higher than that of x = 0.10 and the oxide-ion transport number in the former is ˜0.70-0.75 compared to processing. This demonstrates the electrical properties of KNBT to be sensitive to low levels of A-site nonstoichiometry and indicates that excess K2O in KNBT starting compositions to compensate for volatilisation can lead to undesirable high dielectric loss and leakage currents at elevated temperatures.
International Nuclear Information System (INIS)
Chung, I-Che; Li, Hsin-Pai; Chang, Yu-Sun; Chen, Lih-Chyang; Chung, An-Ko; Chao, Mei; Huang, Hsin-Yi; Hsueh, Chuen; Tsang, Ngan-Ming; Chang, Kai-Ping; Liang, Ying
2014-01-01
Overexpression of heterogeneous nuclear ribonucleoprotein K (hnRNP K), a DNA/RNA binding protein, is associated with metastasis in nasopharyngeal carcinoma (NPC). However, the mechanisms underlying hnRNP K-mediated metastasis is unclear. The aim of the present study was to determine the role of matrix metalloproteinase (MMP) in hnRNP K-mediated metastasis in NPC. We studied hnRNP K-regulated MMPs by analyzing the expression profiles of MMP family genes in NPC tissues and hnRNP K-knockdown NPC cells using Affymetrix microarray analysis and quantitative RT-PCR. The association of hnRNP K and MMP12 expression in 82 clinically proven NPC cases was determined by immunohistochemical analysis. The hnRNP K-mediated MMP12 regulation was determined by zymography and Western blot, as well as by promoter, DNA pull-down and chromatin immunoprecipitation (ChIP) assays. The functional role of MMP12 in cell migration and invasion was demonstrated by MMP12-knockdown and the treatment of MMP12-specific inhibitor, PF-356231. MMP12 was overexpressed in NPC tissues, and this high level of expression was significantly correlated with high-level expression of hnRNP K (P = 0.026). The levels of mRNA, protein and enzyme activity of MMP12 were reduced in hnRNP K-knockdown NPC cells. HnRNP K interacting with the region spanning −42 to −33 bp of the transcription start site triggered transcriptional activation of the MMP12 promoter. Furthermore, inhibiting MMP12 by MMP12 knockdown and MMP12-specific inhibitor, PF-356231, significantly reduced the migration and invasion of NPC cells. Overexpression of MMP12 was significantly correlated with hnRNP K in NPC tissues. HnRNP K can induce MMP12 expression and enzyme activity through activating MMP12 promoter, which promotes cell migration and invasion in NPC cells. In vitro experiments suggest that NPC metastasis with high MMP12 expression may be treated with PF-356231. HnRNP K and MMP12 may be potential therapeutic markers for NPC, but
The effect of injection of high K+ solution into scala media.
Fukazawa, T; Ohmura, M; Yagi, N
1987-01-01
Thirty guinea pig ears were studied to investigate the effect of endolymphatic hydrops on the cochlea. High K+ solution was injected into the scala media, and cochlear microphonics (CM) and endocochlear potential (EP) were observed before, during and after the injection. The CM amplitude decreased rapidly after injection, ending in a depressed plateau value. By contrast, EP remained almost unchanged. By changing the composition of the solution it was suggested that the effect of the injection was mechanical one, rather than biochemical. In three ears, spontaneous recovery of CM was observed during a relatively long interval after the injection. The meaning of these findings for the hearing loss in Meniere's disease is discussed.
INTRIGOSS: A new Library of High Resolution Synthetic Spectra
Franchini, Mariagrazia; Morossi, Carlo; Di Marcancantonio, Paolo; Chavez, Miguel; GES-Builders
2018-01-01
INTRIGOSS (INaf Trieste Grid Of Synthetic Spectra) is a new High Resolution (HiRes) synthetic spectral library designed for studying F, G, and K stars. The library is based on atmosphere models computed with specified individual element abundances via ATLAS12 code. Normalized SPectra (NSP) and surface Flux SPectra (FSP), in the 4800-5400 Å wavelength range, were computed by means of the SPECTRUM code. The synthetic spectra are computed with an atomic and bi-atomic molecular line list including "bona fide" Predicted Lines (PLs) built by tuning loggf to reproduce very high SNR Solar spectrum and the UVES-U580 spectra of five cool giants extracted from the Gaia-ESO survey (GES). The astrophysical gf-values were then assessed by using more than 2000 stars with homogenous and accurate atmosphere parameters and detailed chemical composition from GES. The validity and greater accuracy of INTRIGOSS NSPs and FSPs with respect to other available spectral libraries is discussed. INTRIGOSS will be available on the web and will be a valuable tool for both stellar atmospheric parameters and stellar population studies.
Neutron inelastic sattering from liquid 3He at 40 mK and at 1.2 K
International Nuclear Information System (INIS)
Skoeld, K.; Pelizzari, C.A.
1978-01-01
In a previous neutron scattering experiment on 3 He at T = 15 mK the present authors observed two peaks in the scattering function which were identified as the zero sound mode and the spin-fluctuation peak respectively. These results are different from those obtained by others at T = 0.63 K in which case no such structure was observed. In order to determine whether this discrepancy is due to the difference in the temperature of the two experiments, measurements have now been made at T = 40 mK and at T = 1.2 K. These results show that the two-peak structure persists at the higher temperature although measurable broadening is observed in the spin-fluctuation part of the spectrum. (author)
Virtual Schools: The Changing Landscape of K-12 Education in the U.S.
Toppin, Ian N.; Toppin, Sheila M.
2016-01-01
Virtual schools are a growing phenomenon in k-12 education. School systems in almost every state in the United States offer some version of fully online or blended education. It is no longer far-fetched to conclude that if the current trend continues, virtual school enrollments will eclipse those of traditional brick-and-mortar k-12 institutions…
Calculated K-effectives using ENDF/B-V data for U + Pu solution critical experiments
International Nuclear Information System (INIS)
Primm, R.T. III; Mincey, J.F.
1981-01-01
Effective multiplication factors for 12 critical experiments have been calculated using multigroup cross sections derived from the ENDF/B-V library. All 12 experiments contained mixed plutonium and uranium nitrate solutions. The range of hydrogen-to-fissile plutonium atom ratios spanned by these experiments was 200 to 2200. A comparison with K-effectives calculated with ENDF/B-IV data is presented
Utilisation of Library Information Resources among Generation Z Students: Facts and Fiction
Directory of Open Access Journals (Sweden)
Oghenere Gabriel Salubi
2018-04-01
Full Text Available Generation Z was the foremost generation to have prevalent access to the Internet from an early age. Technology has strongly influenced this generation in terms of communication, education and consequently their academic information behaviour. With the next generation of scholars already being trained, in a decade, most of the researchers will be mainly digital natives. This study sought to establish the library information resources use pattern in relation to users’ preferred information media in order to render better academic information services to library users. A total of 390 respondents were surveyed at the Nelson Mandela University and the University of Fort Hare using quantitative and qualitative methods. Most of the respondents, 82.3%, were aged between 18 and 23 years; while the average library use time was two hours daily. The most utilised library resource is the Wi-Fi with e-books and e-journals found to be lowly utilised. Records from the E-librarians revealed that undergraduate students account for no more than 6% of total users of electronic databases with 62.3% of the respondents preferring print information resources. Better understanding of library users’ demographics and information media preference is essential in proving the right kind of information services to Generation Z library users.
Leadership Analysis in K-12 Case Study: "Divided Loyalties"
Alsubaie, Merfat Ayesh
2016-01-01
This report mainly aims to provide a critical and in-depth analysis of the K-12 Case, "Divided Loyalty" by Holy and Tartar (2004). The case recounts how the manifestation of inadequate leadership skills in a school setting could affect negatively the performance of students.
Information Security Management Practices of K-12 School Districts
Nyachwaya, Samson
2013-01-01
The research problem addressed in this quantitative correlational study was the inadequacy of sound information security management (ISM) practices in K-12 school districts, despite their increasing ownership of information assets. Researchers have linked organizational and sociotechnical factors to the implementation of information security…
Library Continuing Education in South Central Pennsylvania: The SPACE Council Needs Assessment.
Townley, Charles; Hollinger, James
A survey of a sample of 141 of the 423 academic and public libraries, information centers, and media centers in its operating area was conducted by the Southeastern Pennsylvania Area Continuing Education (SPACE) Council to identify library continuing education priorities for both professional and nonprofessional staff. Questionnaires were sent to…
Curación de contenidos en bibliotecas mediante plataformas social media
Guallar, Javier
2016-01-01
English abstract. The use of content curation by libraries in social media platforms is analyzed. Social media analyzed are Scoop.it, Paper.li, Flipboard, Storify, Milq, List.ly, Facebook and Twitter, with many examples of use by libraries. Spanish abstract. Se analiza el uso de la curación de contenidos por bibliotecas en plataformas de medios sociales. Los medios sociales analizados son Pinterest, Scoop.it, Paper.li, Flipboard, Storify, Milq, List.ly, Facebook y Twitter, con variados ejempl...
Czech Academy of Sciences Publication Activity Database
Šafář, Jan; Šimková, Hana; Kubaláková, Marie; Suchánková, Pavla; Čihalíková, Jarmila; Bartoš, Jan; Fiocchetti, F.; Roselli, M.; Gill, B. S.; Doležel, Jaroslav; Lucretti, S.
2009-01-01
Roč. 61, 1-2 (2009), s. 151-160 ISSN 0394-9257 R&D Projects: GA ČR GD521/05/H013; GA ČR GA521/06/1723; GA ČR GA521/07/1573; GA MŠk(CZ) LC06004; GA MŠk OC08025 Institutional research plan: CEZ:AV0Z50380511 Keywords : BAC library * Flow sorting * Homoeologous chromosomes Subject RIV: GE - Plant Breeding
Radencic, S.; McNeal, K. S.; Pierce, D.; Hare, D.
2011-12-01
The Initiating New Science Partnerships in Rural Education (INSPIRE) program at Mississippi State University (MSU), funded by the NSF Graduate STEM Fellows in K-12 Education (GK12) program, focuses on the advancement of Earth and Space science education in K-12 classrooms. INSPIRE is currently in its second year of partnering ten graduate students from the STEM fields of Geosciences, Engineering and Chemistry at MSU with five teachers from local, rural school districts. The five year project serves to increase inquiry and technology experiences in science and math while enhancing graduate student's communication skills as they create interactive lessons linking their STEM research focus to the state and national standards covered in the classrooms. Each graduate student is responsible for the development of two lessons each month of the school year that are then published on the INSPIRE project webpage, www.gk12.msstate.edu, where they are a free resource for any K-12 classroom teacher seeking innovative activities for their classrooms. Many of the participating teachers and graduate students share activities developed with non-participating teachers, expanding INSPIRE's outreach throughout the local community. Numerous challenges were met during the formation of the program as well as throughout the first year in which the project management team worked together to find solutions ensuring that INSPIRE maintained successful partnerships for all involved. Proposed solutions of the following key components were identified by INSPIRE through the development, implementation, and continuous evaluation (internal and external) of the first year of the program as areas that can pose challenges to the construction of strong relationships between STEM research and K-12 classrooms: initializing the partnerships with the K-12 classrooms and STEM graduate fields at the university; maintaining strong partnerships; providing appropriate training and support; developing sound
Evaluated cross-section libraries and kerma factors for neutrons up to 100 MeV on 12C
International Nuclear Information System (INIS)
Chadwick, M.B.; Blann, M.; Cox, L.; Young, P.G.; Meigooni, A.
1995-01-01
A program is being carried out at Lawrence Livermore National Laboratory to develop high-energy evaluated nuclear data libraries for use in Monte Carlo simulations of cancer radiation therapy. In this report we describe evaluated cross sections and kerma factors for neutrons with incident energies up to 100 MeV on 12 C. The aim of this effort is to incorporate advanced nuclear physics modeling methods, with new experimental measurements, to generate cross section libraries needed for an accurate simulation of dose deposition in fast neutron therapy. The evaluated libraries are based mainly on nuclear model calculations, benchmarked to experimental measurements where they exist. We use the GNASH code system, which includes Hauser-Feshbach, preequilibrium, and direct reaction mechanisms. The libraries tabulate elastic and nonelastic cross sections, angle-energy correlated production spectra for light ejectiles with A≤and kinetic energies given to light ejectiles and heavy recoil fragments. The major steps involved in this effort are: (1) development and validation of nuclear models for incident energies up to 100 MeV; (2) collation of experimental measurements, including new results from Louvain-la-Nueve and Los Alamos; (3) extension of the Livermore ENDL formats for representing high-energy data; (4) calculation and evaluation of nuclear data; and (5) validation of the libraries. We describe the evaluations in detail, with particular emphasis on our new high-energy modeling developments. Our evaluations agree well with experimental measurements of integrated and differential cross sections. We compare our results with the recent ENDF/B-VI evaluation which extends up to 32 MeV
1:12,000 Grid of Louisiana, Geographic NAD83, LGS (2007) [quad12k_losco_2007
Louisiana Geographic Information Center — This "QUAD12K_LOSCO_2007" ploygon shapefile is a reference index to the polygon footprints of Digital Orthographic Quarter Quadrangles (DOQQs) for Louisiana and a...
Pinterest as a Tool: Applications in Academic Libraries and Higher Education
Directory of Open Access Journals (Sweden)
Kirsten Hansen
2012-12-01
Full Text Available Pinterest, a pinboard-style social photo-sharing website, has become a popular site for many individuals who collect images that help them plan, organize, and explore any topic of interest. Launched in March 2010, Pinterest now has over 10 million users and is continuing to grow. Libraries and educators are starting to explore this new type of social media and how it can be used to connect with and inspire their patrons and students. This article will look at how the University of Regina Library is currently using Pinterest to engage and interact with the University community. This social tool has appealed not only to librarians but educators as well. Pinterest is starting to have an impact on the way educators teach and present information and ideas to their students. The popularity of Pinterest has even inspired other image-based social media sites such as Learnist. After developing a Pinterest account for the library, a list of best practices were created. The library looked at copyright considerations and developed a series of questions to help us determine whether to pin or repin an image. This article will look at how Pinterest can be used in libraries and higher education, and some of the copyright considerations involved in using this image-driven site.
K-12 STEM Educators and the Inclusive Classroom
Li, Songze
2016-01-01
The United States public schools promote inclusion and educational equity among diverse student populations. Considerable and growing numbers of students with categorical disabilities and Limited English Proficiency (LEP) are enrolled in regular classrooms. The systemic barriers in learning that they have could impact teacher perceptions and decisions about teaching practices as well as the teaching profession. These students have challenged K-12 science, technology, engineering, and mathemat...
Sensitivity analysis of critical experiments with evaluated nuclear data libraries
International Nuclear Information System (INIS)
Fujiwara, D.; Kosaka, S.
2008-01-01
Criticality benchmark testing was performed with evaluated nuclear data libraries for thermal, low-enriched uranium fuel rod applications. C/E values for k eff were calculated with the continuous-energy Monte Carlo code MVP2 and its libraries generated from Endf/B-VI.8, Endf/B-VII.0, JENDL-3.3 and JEFF-3.1. Subsequently, the observed k eff discrepancies between libraries were decomposed to specify the source of difference in the nuclear data libraries using sensitivity analysis technique. The obtained sensitivity profiles are also utilized to estimate the adequacy of cold critical experiments to the boiling water reactor under hot operating condition. (authors)
Web metrics for library and information professionals
Stuart, David
2014-01-01
This is a practical guide to using web metrics to measure impact and demonstrate value. The web provides an opportunity to collect a host of different metrics, from those associated with social media accounts and websites to more traditional research outputs. This book is a clear guide for library and information professionals as to what web metrics are available and how to assess and use them to make informed decisions and demonstrate value. As individuals and organizations increasingly use the web in addition to traditional publishing avenues and formats, this book provides the tools to unlock web metrics and evaluate the impact of this content. The key topics covered include: bibliometrics, webometrics and web metrics; data collection tools; evaluating impact on the web; evaluating social media impact; investigating relationships between actors; exploring traditional publications in a new environment; web metrics and the web of data; the future of web metrics and the library and information professional.Th...
Cell-Based High-Throughput Screening for Aromatase Inhibitors in the Tox21 10K Library.
Chen, Shiuan; Hsieh, Jui-Hua; Huang, Ruili; Sakamuru, Srilatha; Hsin, Li-Yu; Xia, Menghang; Shockley, Keith R; Auerbach, Scott; Kanaya, Noriko; Lu, Hannah; Svoboda, Daniel; Witt, Kristine L; Merrick, B Alex; Teng, Christina T; Tice, Raymond R
2015-10-01
Multiple mechanisms exist for endocrine disruption; one nonreceptor-mediated mechanism is via effects on aromatase, an enzyme critical for maintaining the normal in vivo balance of androgens and estrogens. We adapted the AroER tri-screen 96-well assay to 1536-well format to identify potential aromatase inhibitors (AIs) in the U.S. Tox21 10K compound library. In this assay, screening with compound alone identifies estrogen receptor alpha (ERα) agonists, screening in the presence of testosterone (T) identifies AIs and/or ERα antagonists, and screening in the presence of 17β-estradiol (E2) identifies ERα antagonists. Screening the Tox-21 library in the presence of T resulted in finding 302 potential AIs. These compounds, along with 31 known AI actives and inactives, were rescreened using all 3 assay formats. Of the 333 compounds tested, 113 (34%; 63 actives, 50 marginal actives) were considered to be potential AIs independent of cytotoxicity and ER antagonism activity. Structure-activity analysis suggested the presence of both conventional (eg, 1, 2, 4, - triazole class) and novel AI structures. Due to their novel structures, 14 of the 63 potential AI actives, including both drugs and fungicides, were selected for confirmation in the biochemical tritiated water-release aromatase assay. Ten compounds were active in the assay; the remaining 4 were only active in high-throughput screen assay, but with low efficacy. To further characterize these 10 novel AIs, we investigated their binding characteristics. The AroER tri-screen, in high-throughput format, accurately and efficiently identified chemicals in a large and diverse chemical library that selectively interact with aromatase. © The Author 2015. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Zero Energy Schools: Designing for the Future: Zero Energy Ready K-12 Schools
Energy Technology Data Exchange (ETDEWEB)
Torcellini, Paul A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-29
Designing, building, and operating zero energy ready K-12 schools provides benefits for districts, students, and teachers. Optimizing energy efficiency is important in any building, but it's particularly important in K-12 schools. Many U.S. school districts struggle for funding, and improving a school building's energy efficiency can free up operational funds that may then be available for educational and other purposes.
Spacemakers: A Leadership Perspective on Curriculum and the Purpose of K-12 Educational Makerspaces
Harron, Jason R.; Hughes, Joan E.
2018-01-01
This qualitative research study investigated how educational makerspace leaders, whom we refer to as spacemakers, framed the purpose of the makerspace in K-12 education and how makerspaces support school curriculum. Using interviews with twelve K-12 spacemakers, the study found spacemakers were experienced, self-motivated educators. These leaders…
The K-12 Educational Technology Value Chain: Apps for Kids, Tools for Teachers and Levers for Reform
Pierce, Glenn L.; Cleary, Paul F.
2016-01-01
Historically implementing, maintaining and managing educational technology has been difficult for K-12 educational systems. Consequently, opportunities for significant advances in K-12 education have often gone unrealized. With the maturation of Internet delivered services along with K-12 institutional trends, educational technologies are poised…
CRISPR library designer (CLD): software for multispecies design of single guide RNA libraries.
Heigwer, Florian; Zhan, Tianzuo; Breinig, Marco; Winter, Jan; Brügemann, Dirk; Leible, Svenja; Boutros, Michael
2016-03-24
Genetic screens using CRISPR/Cas9 are a powerful method for the functional analysis of genomes. Here we describe CRISPR library designer (CLD), an integrated bioinformatics application for the design of custom single guide RNA (sgRNA) libraries for all organisms with annotated genomes. CLD is suitable for the design of libraries using modified CRISPR enzymes and targeting non-coding regions. To demonstrate its utility, we perform a pooled screen for modulators of the TNF-related apoptosis inducing ligand (TRAIL) pathway using a custom library of 12,471 sgRNAs. CLD predicts a high fraction of functional sgRNAs and is publicly available at https://github.com/boutroslab/cld.
Applying the Quadratic Usage Framework to Research on K-12 STEM Digital Learning Resources
Luetkemeyer, Jennifer R.
2016-01-01
Numerous policymakers have called for K-12 educators to increase their effectiveness by transforming science, technology, engineering, and mathematics (STEM) learning and teaching with digital resources and tools. In this study we outline the significance of studying pressing issues related to use of digital resources in the K-12 environment and…
Social media use in medical education: a systematic review.
Cheston, Christine C; Flickinger, Tabor E; Chisolm, Margaret S
2013-06-01
The authors conducted a systematic review of the published literature on social media use in medical education to answer two questions: (1) How have interventions using social media tools affected outcomes of satisfaction, knowledge, attitudes, and skills for physicians and physicians-in-training? and (2) What challenges and opportunities specific to social media have educators encountered in implementing these interventions? The authors searched the MEDLINE, CINAHL, ERIC, Embase, PsycINFO, ProQuest, Cochrane Library, Web of Science, and Scopus databases (from the start of each through September 12, 2011) using keywords related to social media and medical education. Two authors independently reviewed the search results to select peer-reviewed, English-language articles discussing social media use in educational interventions at any level of physician training. They assessed study quality using the Medical Education Research Study Quality Instrument. Fourteen studies met inclusion criteria. Interventions using social media tools were associated with improved knowledge (e.g., exam scores), attitudes (e.g., empathy), and skills (e.g., reflective writing). The most commonly reported opportunities related to incorporating social media tools were promoting learner engagement (71% of studies), feedback (57%), and collaboration and professional development (both 36%). The most commonly cited challenges were technical issues (43%), variable learner participation (43%), and privacy/security concerns (29%). Studies were generally of low to moderate quality; there was only one randomized controlled trial. Social media use in medical education is an emerging field of scholarship that merits further investigation. Educators face challenges in adapting new technologies, but they also have opportunities for innovation.
Manage Your Social Media in 5 Minutes a Day
Watson, Anne Marie
2017-01-01
The Marketing column features essays about a variety of creative and innovative marketing strategies used to highlight collections or promote services in all types of libraries. Its purpose is to provide real examples of how libraries are using marketing and outreach techniques in interesting ways. This article describes the social media content…
Directory of Open Access Journals (Sweden)
Obst, Oliver
2009-09-01
Full Text Available The Medical Branch Library is a subject library of the University and Regional Library Münster, and was founded in 1993 as the central medical library in the grounds of the University Hospital. Second only to the German National Library in Cologne, it is the largest medical library in North Rhine-Westphalia. The budget of the library derives mainly from the Medical Faculty. The funding from the university and from tuition fees is used to acquire textbooks. The physical library is used almost exclusively as a place of learning (by students, while the online presence mainly by researchers and physicians. The library offers since 1997 e-journals, since 2003 e-books and media for Smart Computers/Phones. It is using innovative ways for supplying journal articles, such as a virtual library budget and serving Subito for free.
Tablets in K-12 Education: Integrated Experiences and Implications
An, Heejung, Ed.; Alon, Sandra, Ed.; Fuentes, David, Ed.
2015-01-01
The inclusion of new and emerging technologies in the education sector has been a topic of interest to researchers, educators, and software developers alike in recent years. Utilizing the proper tools in a classroom setting is a critical factor in student success. "Tablets in K-12 Education: Integrated Experiences and Implications"…
Directory of Open Access Journals (Sweden)
Gretz, Marianne
2011-09-01
Full Text Available Despite major economic and organizational changes in the pharmaceutical industry, the Pharmaceutical Library Task Force (Arbeitskreis Pharma-Bibliotheken has been going strong in the Medical Library Working Party (Arbeitsgemeinschaft für medizinisches Bibliothekswesen – AGMB for the past 18 years. However, Task Force discussion topics have moved away from questions about spatial or staffing expansion or building up inventory, and toward themes such as outsourcing, training, technology scouting, and building up comprehensive copyright expertise. While actual physical stock is shrinking or has been eliminated entirely from many company libraries, the everyday working lives of company librarians are increasingly taken up with management of electronic media, in-house marketing and the associated user training, evaluation and use of new technologies, and clarification of complex copyright issues. Widespread know-how, in-depth knowledge of specialist areas (such as copyright, communication skills, networking, cost awareness, adaptability, willingness to learn new things, and demonstrating the value they add to the company are the factors that will secure the future of company librarians, whether with – or, in a pinch – without a physical library.
Disorder effects in Mn(12)-acetate at 83 K.
Cornia, Andrea; Fabretti, Antonio Costantino; Sessoli, Roberta; Sorace, Lorenzo; Gatteschi, Dante; Barra, Anne-Laure; Daiguebonne, Carole; Roisnel, Thierry
2002-07-01
The structure of hexadeca-mu-acetato-tetraaquadodeca-mu(3)-oxo-dodecamanganese bis(acetic acid) tetrahydrate, [Mn(12)O(12)(CH(3)COO)(16)(H(2)O)(4)] x 2CH(3)COOH x 4H(2)O, known as Mn(12)-acetate, has been determined at 83 (2) K by X-ray diffraction methods. The fourfold (S(4)) molecular symmetry is disrupted by a strong hydrogen-bonding interaction with the disordered acetic acid molecule of solvation, which displaces one of the acetate ligands in the cluster. Up to six Mn(12) isomers are potentially present in the crystal lattice, which differ in the number and arrangement of hydrogen-bonded acetic acid molecules. These results considerably improve the structural information available on this molecular nanomagnet, which was first synthesized and characterized by Lis [Acta Cryst. (1980), B36, 2042-2046].
Daum, David N.; Woods, Amelia M.
2015-01-01
K-12 online physical education (OLPE) is as an educational opportunity in at least 30 states in the US (NASPE, 2006; 2010; 2012). The purpose of this study was to examine physical education teacher educators' perceptions toward and understanding of K-12 OLPE. Bandura's Social Cognitive Theory (1986) served as the theoretical framework for this…
Content and Design Features of Academic Health Sciences Libraries' Home Pages.
McConnaughy, Rozalynd P; Wilson, Steven P
2018-01-01
The goal of this content analysis was to identify commonly used content and design features of academic health sciences library home pages. After developing a checklist, data were collected from 135 academic health sciences library home pages. The core components of these library home pages included a contact phone number, a contact email address, an Ask-a-Librarian feature, the physical address listed, a feedback/suggestions link, subject guides, a discovery tool or database-specific search box, multimedia, social media, a site search option, a responsive web design, and a copyright year or update date.
Srivastava, Sarvesh Kumar; Yamada, Ryosuke; Ogino, Chiaki; Kondo, Akihiko
2013-02-01
Room-temperature extracellular biosynthesis of gold nanoparticles (Au NPs) was achieved using Escherichia coli K12 cells without the addition of growth media, pH adjustments or inclusion of electron donors/stabilizing agents. The resulting nanoparticles were analysed by ultraviolet-visible (UV-vis) spectrophotometry, atomic force microscopy, transmission electron microscopy and X-ray diffraction. Highly dispersed gold nanoplates were achieved in the order of around 50 nm. Further, the underlying mechanism was found to be controlled by certain extracellular membrane-bound proteins, which was confirmed by Fourier transformation-infrared spectroscopy and sodium dodecyl sulfate polyacrylamide gel electrophoresis. We observed that certain membrane-bound peptides are responsible for reduction and subsequent stabilization of Au NPs (confirmed by zeta potential analysis). Upon de-activation of these proteins, no nanoparticle formation was observed. Also, we prepared a novel biocatalyst with Au NPs attached to the membrane-bound fraction of E. coli K12 cells serving as an efficient heterogeneous catalyst in complete reduction of 4-nitrophenol in the presence of NaBH4 which was studied with UV-vis spectroscopy. This is the first report on bacterial membrane-Au NP nanobiocomposite serving as an efficient heterogeneous catalyst in complete reduction of nitroaromatic pollutant in water.
School Library Policy and Legal Opinions of Texas Public School Principals and Certified Librarians
Directory of Open Access Journals (Sweden)
Andrew Shupala
2006-09-01
Full Text Available This study involved a survey of the attitudes of Texas public school principals and certified librarians, perceptions andexperiences with regard to school library policy for media selection, and procedures for responding to complaints againstlibrary media. Analysis of the data included a methodology of mixed-methods explanatory design. Selection of the principalsand certified librarians was proportionate and stratified according to the state's 20 Education Service Centerregions. Of the 1,036 independent school districts that employed the state population of 10,014 principals and certifiedlibrarians, 275 independent school districts (26.5 percent allowed participation in the survey. Although random samplingof the state population had not been possible, the demographic and employment characteristics of the study samplewere comparable to those of the state population. Two key findings were (a that the legal opinions of principals andcertified librarians were useful predictors of their opinions of library media selection policy and complaint proceduresand (b that the principals' appreciation of selection policy and complaint procedures sometimes differed from the librarians'because of the principals' different legal perspective of library selection policy and complaint procedures.
1994-02-28
use and customize those policies and procedures applicable to the implementor’s situation. It is not the intent of this manual to restrict the library...improvements. Pare 10 ka•- V •DkI U Release Manager The Release Manager provides franchisees with media copies of existing libraries, as needed. Security...implementors, and potential library franchisees . Security Team The Security Team assists the Security Officer with security analysis. Team members are
K-12 Marketplace Sees Major Flow of Venture Capital
Ash, Katie
2012-01-01
The flow of venture capital into the K-12 education market has exploded over the past year, reaching its highest transaction values in a decade in 2011, industry observers say. They attribute that rise to such factors as a heightened interest in educational technology; the decreasing cost of electronic devices such as tablet computers, laptops,…
ZZ BOREHOLE-EB6.8-MG, multi group cross-section library for deterministic and Monte Carlo codes
International Nuclear Information System (INIS)
Kodeli, Ivo; Aldama, Daniel L.; Leege, Piet F.A. de; Legrady, David; Hoogenboom, J. Eduard
2007-01-01
1 - Description: Format: MATXS and ACE; Number of groups: 175 neutron, 45 gamma-ray; Nuclides: H-1, C-12, O-16, Na-23, Mg-nat, Al-27, Si-28, -29, -30, S-nat, Cl-35, -37, K-nat, Ca-nat, Mn-55, Fe-54, -56, -57, -58, I-127, W-nat. Origin: ENDF/B-VI.8; Weighting spectrum: Fission and fusion peak at high energies and a 1/E + thermal Maxwellian extension at low energies. The following materials/nuclides are included in the library: H-1, C-12, O-16, Na-23, Mg-nat, Al-27, Si-28, -29, -30, S-nat, Cl-35, -37, K-nat, Ca-nat, Fe-54, -56, -57, -58, Mn-55, I-127, W-nat. ZZ-BOREHOLE-EB6.8-MG is a multigroup cross section library for deterministic (DOORS, DANTSYS) and Monte Carlo (MCNP) transport codes developed for the oil well logging applications. The library is based on the ENDF/B-VI.8 evaluation and was processed by the NJOY-99 code. The cross sections are given in the 175 neutron and 45 gamma ray group structure. The MATXS format library can be directly used in TRANSX code to prepare the multigroup self-shielded cross sections for deterministic discrete ordinates codes like DOORS and DANTSYS. The data provided in the GROUPR and GAMINR format were converted to the MCNP ACE format by the NSLINK, SCALE and CRSRD codes. IAEA1398/03: Multigroup cross section data for Mn-55 were added in TRANSX format
Social media, text messaging, and email-preferences of asthma patients between 12 and 40 years old.
Baptist, Alan P; Thompson, Michael; Grossman, Karla Stoermer; Mohammed, Layla; Sy, Annie; Sanders, Georgiana M
2011-10-01
Electronic media such as social media (Facebook, Twitter, MySpace), email, and text messaging could be useful in the management of asthma. However, patient use and preferences for electronic media in asthma management is currently unknown. A survey was sent to asthma patients between 12-40 years of age. The survey collected demographic information, use of electronic media, interest in using electronic media to receive asthma information, and interest in using electronic media to communicate with a health care provider about asthma. Free text entries were encouraged. 145 completed surveys were returned. Text messaging, email, and Facebook were used at least weekly by a majority of respondents (82%, 77%, and 65%, respectively). Email was clearly the most preferred method to receive asthma information and to communicate with a physician. There was some interest in using Facebook or text messaging, whereas Myspace and Twitter had minimal interest. On logistic regression analysis, female and Black or Hispanic participants were more likely to have an interest in the use of electronic media for asthma care. Frequent users (>1X/week) of each electronic media type had greater enthusiasm for their incorporation into asthma care. Free text entries revealed that many participants felt social media sites were for connecting with friends rather than for health care, and privacy concerns were also raised. Electronic media offers a novel way to improve asthma care. Email was the most preferred method, though text messaging and social media sites like Facebook may be appropriate for certain patients.
Verification and validation of multi-group library MUSE1.0 created from ENDF/B-VII.0
International Nuclear Information System (INIS)
Chen Yixue; Wu Jun; Yang Shouhai; Zhang Bin; Lu Daogang; Chen Chaobin
2010-01-01
A multi-group library set named MUSE1.0 with 172-neutron group and 42-photon group is produced based on ENDF/B-VII.0 using NJOY code. Weight function of the multi-group library set is taken from the Vitanim-e library and the max legendre order of scattering matrix is six. All the nuclides have thermal scattering data created using free-gas scattering law and 10 Bondarenko background cross sections se lected to generate the self-shielded multi-group cross sections. The final libraries have GENDF-format, MATXS-format and ACE-multi-group sub-libraries and each sub-library generated under 4 temperatures(293 K,600 K,800 K and 900 K). This paper provides a summary of the procedure to produce the library set and a detail description of the validation of the multi-group library set by several critical benchmark devices and shielding benchmark devices using MCNP code. The ability to handle the thermal neutron transport and resonance self-shielding problems are investigated specially. In the end, we draw the conclusion that the multi-group libraries produced is credible and can be used in the R and D process of Supercritical Water Reactor Design. (authors)
Wise, Stephen A.; Phinney, Karen W.; Duewer, David L.; Sniegoski, Lorna T.; Welch, Michael J.; Pritchett, Jeanita; Pabello, Guiomar; Avila Calderon, Marco A.; Balderas, Miryan; Qinde, Liu; Kooi, Lee Tong; Rego, Eliane; Garrido, Bruno; Allegri, Gabriella; de La Cruz, Marcia; Barrabin, Juliana; Monteiro, Tânia; Lee, Hwashim; Kim, Byungjoo; Delatour, Vincent; Peignaux, Maryline; Kawaguchi, Migaku; Bei, Xu; Can, Quan; Nammoonnoy, Jintana; Schild, Katrin; Ohlendorf, Rüdiger; Henrion, Andre; Ceyhan Gören, Ahmet; Yılmaz, Hasibe; Bilsel, Mine; Konopelko, L.; Krylov, A.; Lopushanskaya, E.
2018-01-01
Glucose and creatinine are two of the most frequently measured substances in human blood/serum for assessing the health status of individuals. Because of their clinical significance, CCQM-K11 glucose in human serum and CCQM-K12 creatinine in human serum were the fourth and fifth key comparisons (KCs) performed by the Organic Analysis Working Group (OAWG). These KCs were conducted in parallel and were completed in 2001. The initial subsequent KCs for glucose, CCQM-K11.1, and creatinine, CCQM-K12.1, were completed in 2005. Measurements for the next KCs for these two measurands, CCQM-K11.2 and CCQM-K12.2, were completed in 2013. While designed as subsequent KCs, systematic discordances between the participants' and the anchor institution's results in both comparisons lead the OAWG to request reference results from two experienced laboratories that had participated in the 2001 comparisons. Based on the totality of the available information, the OAWG converted both CCQM-K11.2 and CCQM-K12.2 to 'Track C' KCs where the key comparison reference value is estimated by consensus. These comparisons highlighted that carrying out comparisons for complex chemical measurements and expecting to be able to treat them under the approaches used for formal CIPM subsequent comparisons is not an appropriate strategy. The approach used here is a compromise to gain the best value from the comparison; it is not an approach that will be used in the future. Instead, the OAWG will focus on Track A and Track C comparisons that are treated as stand-alone entities. Participation in CCQM-K11.2 demonstrates a laboratory's capabilities to measure a polar (pKow > 2), low molecular mass (100 g/mol to 500 g/mol) metabolite in human serum at relatively high concentrations (0.1 mg/g to 10 mg/g). Participation in CCQM-K12.2 demonstrates capabilities to measure similar classes of metabolites at relatively low concentrations (1 μg/g to 30 μg/g). The capabilities required for the analysis of complex
Production of the next-generation library virtual tour
Duncan, James M.; Roth, Linda K.
2001-01-01
While many libraries offer overviews of their services through their Websites, only a small number of health sciences libraries provide Web-based virtual tours. These tours typically feature photographs of major service areas along with textual descriptions. This article describes the process for planning, producing, and implementing a next-generation virtual tour in which a variety of media elements are integrated: photographic images, 360-degree “virtual reality” views, textual descriptions, and contextual floor plans. Hardware and software tools used in the project are detailed, along with a production timeline and budget, tips for streamlining the process, and techniques for improving production. This paper is intended as a starting guide for other libraries considering an investment in such a project. PMID:11837254
Son, Young-Jin; Phue, Je-Nie; Trinh, Loc B; Lee, Sang Jun; Shiloach, Joseph
2011-06-30
E. coli B (BL21), unlike E.coli K-12 (JM109) is insensitive to glucose concentration and, therefore, grows faster and produces less acetate than E. coli K-12, especially when growing to high cell densities at high glucose concentration. By performing genomic analysis, it was demonstrated that the cause of this difference in sensitivity to the glucose concentration is the result of the differences in the central carbon metabolism activity. We hypothesized that the global transcription regulator Cra (FruR) is constitutively expressed in E. coli B and may be responsible for the different behaviour of the two strains. To investigate this possibility and better understand the function of Cra in the two strains, cra - negative E. coli B (BL21) and E. coli K-12 (JM109) were prepared and their growth behaviour and gene expression at high glucose were evaluated using microarray and real-time PCR. The deletion of the cra gene in E. coli B (BL21) minimally affected the growth and maximal acetate accumulation, while the deletion of the same gene in E.coli K-12 (JM109) caused the cells to stop growing as soon as acetate concentration reached 6.6 g/L and the media conductivity reached 21 mS/cm. ppsA (gluconeogenesis gene), aceBA (the glyoxylate shunt genes) and poxB (the acetate producing gene) were down-regulated in both strains, while acs (acetate uptake gene) was down-regulated only in E.coli B (BL21). These transcriptional differences had little effect on acetate and pyruvate production. Additionally, it was found that the lower growth of E. coli K-12 (JM109) strain was the result of transcription inhibition of the osmoprotectant producing bet operon (betABT). The transcriptional changes caused by the deletion of cra gene did not affect the activity of the central carbon metabolism, suggesting that Cra does not act alone; rather it interacts with other pleiotropic regulators to create a network of metabolic effects. An unexpected outcome of this work is the finding that cra
Who Moved My Intranet? The Human Side of Introducing Collaborative Technologies to Library Staff
Jeffery, Keven; Dworak, Ellie
2010-01-01
Intranets can be crucial tools in fostering communication within an academic library. This article describes the successful implementation of an intranet wiki at the San Diego State University Library & Information Access. The steps involved with implementing, marketing, and supporting the MediaWiki software are described, and the results of a…
Activity and task of the saveMLAK and aid for library
Okamoto, Makoto
We report the activities of saveMLAK, an organization dedicated to supporting museums, libraries, archives, and kominkans damaged by the Great East Japan Earthquake, focusing on the activities for libraries. saveMLAK provides a website using MediaWiki collaborative editing software for accumulating information regarding damage and support activities, offering information support, indirect support, and intermediary support. We also report the collaboration with Miyagi Prefectural Library based on the accumulated, shared information as an example of support for libraries in the disaster area. We describe the process of the activities of saveMLAK and problems emerging so far, and provide constructive criticism and proposals to other support activities for libraries. In conclusion, we suggest establishment of permanent organizations/functions to prepare for emergencies and to cope with disasters in the future.
Opportunities and Challenges for Technology Development and Adoption in Public Libraries
DEFF Research Database (Denmark)
Serholt, Sofia; Eriksson, Eva; Dalsgaard, Peter
2018-01-01
In this paper, we discuss opportunities and challenges for technology development and adoption in public libraries. The results are based on a multi-site comparative study and thematic analysis of six months of extensive ethnographic work in libraries in three different European countries....... The results explore the socio-technical practices, understandings, and perspectives of library staff and patrons when it comes to the role(s) and function(s) of libraries today. The contribution of this paper is two fold. Firstly, the results from the analysis of rich ethnographic data presented under six...... themes. Secondly, we offer a list of identified key opportunities and challenges focusing on 1) media and technology literacy, 2) institutional transformation and technical infrastructures, 3) resource constraints among library staff, and 4) a shift in focus towards supporting activities....
Energy Technology Data Exchange (ETDEWEB)
Cole, P.R.
1996-03-01
A grant was made to install and pilot-test the Science, Engineering and Technology (SET) Career Library Corner at the New York Hall of Science. The SET Career Library Corner is located in a multi-media library setting where visitors can explore careers in a quiet, uninterrupted environment, in contrast to the original installation designed as a museum floor exhibit.
Active commuting among K-12 educators: a study examining walking and biking to work.
Bopp, Melissa; Hastmann, Tanis J; Norton, Alyssa N
2013-01-01
Walking and biking to work, active commuting (AC) is associated with many health benefits, though rates of AC remain low in the US. K-12 educators represent a significant portion of the workforce, and employee health and associated costs may have significant economic impact. Therefore, the purpose of this study was to examine the current rates of AC and factors associated with AC among K-12 educators. A volunteer sample of K-12 educators (n = 437) was recruited to participate in an online survey. Participants responded about AC patterns and social ecological influences on AC (individual, interpersonal, institutional, community, and environmental factors). t-tests and ANOVAs examined trends in AC, and Pearson correlations examined the relationship between AC and dependent variables. Multiple regression analysis determined the relative influence of individual, interpersonal, institutional, community, and environmental levels on AC. Participants actively commuted 0.51 ± 1.93 times/week. There were several individual, interpersonal, institutional, community, and environmental factors significantly related to AC. The full model explained 60.8% of the variance in AC behavior. This study provides insight on the factors that determine K-12 educators mode of commute and provide some insight for employee wellness among this population.
Active Commuting among K-12 Educators: A Study Examining Walking and Biking to Work
Directory of Open Access Journals (Sweden)
Melissa Bopp
2013-01-01
Full Text Available Background. Walking and biking to work, active commuting (AC is associated with many health benefits, though rates of AC remain low in the US. K-12 educators represent a significant portion of the workforce, and employee health and associated costs may have significant economic impact. Therefore, the purpose of this study was to examine the current rates of AC and factors associated with AC among K-12 educators. Methods. A volunteer sample of K-12 educators ( was recruited to participate in an online survey. Participants responded about AC patterns and social ecological influences on AC (individual, interpersonal, institutional, community, and environmental factors. -tests and ANOVAs examined trends in AC, and Pearson correlations examined the relationship between AC and dependent variables. Multiple regression analysis determined the relative influence of individual, interpersonal, institutional, community, and environmental levels on AC. Results. Participants actively commuted times/week. There were several individual, interpersonal, institutional, community, and environmental factors significantly related to AC. The full model explained 60.8% of the variance in AC behavior. Conclusions. This study provides insight on the factors that determine K-12 educators mode of commute and provide some insight for employee wellness among this population.
African Journal of Library, Archives and Information Science - Vol 10 ...
African Journals Online (AJOL)
Short Communication The New Information Retrieval Media and the Next Millennium: Some Challenges for Nigeria Libraries · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Samuel F. Ajala, 75-78 ...
Role of alkali carbonate and salt in topochemical synthesis of K1/2Na1/2NbO3 and NaNbO3 templates
Lee, Jae-Seok; Jeon, Jae-Ho; Choi, Si-Young
2013-11-01
Since the properties of lead-free piezoelectric materials have thus far failed to meet those of lead-based materials, either chemical doping or morphological texturing should be employed to improve the piezoelectric properties of lead-free piezoelectric ceramics. The goal of this study was to synthesize plate-like K1/2Na1/2NbO3 and NaNbO3 particles, which are the most favorable templates for morphological texturing of K1/2Na1/2NbO3 ceramics. To achieve this goal, Bi2.5Na3.5Nb5O18 precursors in a plate-like shape were first synthesized and subsequently converted into K1/2Na1/2NbO3 or NaNbO3 particles that retain the morphology of Bi2.5Na3.5Nb5O18. In this study, we found that sodium or potassium carbonate does not play a major role in converting the Bi2.5Na3.5Nb5O18 precursor to K1/2Na1/2NbO3 or NaNbO3, on the contrary to previous reports; however, the salt contributes to the conversion reaction. All synthesis processes have been performed via a molten salt method, and scanning electron microscopy, scanning probe microscopy, and inductively coupled plasma mass spectroscopy were used to characterize the synthesized K1/2Na1/2NbO3 or NaNbO3 templates.
76 FR 77242 - National Library of Medicine; Notice of Closed Meeting
2011-12-12
... personal privacy. Name of Committee: National Library of Medicine Special Emphasis Panel, Conflict R01/K99... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Library of Medicine.... Place: National Library of Medicine, 6705 Rockledge Drive, Suite 301, Bethesda, MD 20817, (Telephone...
78 FR 55265 - National Library of Medicine; Notice of Closed Meeting
2013-09-10
... personal privacy. Name of Committee: National Library of Medicine Special Emphasis Panel; Conflicts R01/K22... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Library of Medicine.... Place: National Library of Medicine, 6705 Rockledge Drive, Suite 301, Bethesda, MD 20817 (Telephone...
77 FR 72365 - National Library of Medicine; Notice of Closed Meeting
2012-12-05
... personal privacy. Name of Committee: National Library of Medicine Special Emphasis Panel; Conflict R01/K99... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Library of Medicine... applications. Place: National Library of Medicine, 6705 Rockledge Drive, Suite 301, Bethesda, MD 20817...
77 FR 17490 - National Library of Medicine; Notice of Closed Meeting
2012-03-26
... personal privacy. Name of Committee: National Library of Medicine Special Emphasis Panel, Conflict R01/K99... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Library of Medicine.... Place: National Library of Medicine, 6705 Rockledge Drive, Suite 301, Bethesda, MD 20817, (Telephone...
Scientific Library’s Book and Media Swap Coming April 16 | Poster
By Robin Meckley, Contributing Writer The 14th annual Book and Media Swap will be held on Wednesday, April 16, from 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549. The staff is holding the swap to coincide with National Library Week, an annual celebration of libraries that occurs in April. As of April 10, the library had collected nearly 2,000 books,
Isler, Stephane; Aguglia, Davide; Bonnin, Xavier Abel
2017-01-01
This paper presents the critical design aspects addressed during the development of a 100 kW, 12.5 kV, 22 kHz, and 30 kV insulated medium frequency transformer used in a power converter. The transformers are used in a resonant multilevel converter topology producing HV DC voltage from a three phase 400 V AC industrial grid. The power converter is used to supply radio frequency systems in particle accelerators. Considerations about material selection, dielectric, magnetic and thermal design are discussed and experimental results on the full scale transformer and power converter are presented.
Semiconductor Industry Association, San Jose, CA.
The U.S. semiconductor industry, now the nation's largest manufacturing industry, displays its commitment to training its current workers and educating future workers by supporting educational efforts on the K-12 level. This catalog describes innovative actions by 16 Semiconductor Industry Association companies to improve education at the K-12…
Petrausch, Robert J.
2005-01-01
Interdisciplinary study can allow students to share ideas with scholars in allied fields and broaden their knowledge of global issues. Mass communication/media studies programs in the U.S. and U.K. can serve as models to lead students into successful learning through interdisciplinary study. This paper outlines five strategic imperatives for the…
25 CFR 36.40 - Standard XIII-Library/media program.
2010-04-01
... philosophy. The librarian or educational media specialist, with students and staff, shall set objectives... the following: Tactile objects, globes, models, maps, films, film-strips, microforms, slides, audio...
Anderson, Talea
2015-01-01
In 2013-2014, Brooks Library at Central Washington University (CWU) launched library content in three systems: a digital asset-management system, an institutional repository (IR), and a web-based discovery layer. In early 2014, the archives at the library began to use these systems to disseminate media recently digitized from legacy formats. As…
Exploring the Effectiveness of Online Education in K-12 Environments
Heafner, Tina L., Ed.; Hartshorne, Richard, Ed.; Petty, Teresa, Ed.
2015-01-01
The integration of technology in classrooms is rapidly emerging as a way to provide more educational opportunities for students. As virtual learning environments become more popular, evaluating the impact of this technology on student success is vital. "Exploring the Effectiveness of Online Education in K-12 Environments" combines…
Should Your Library Have a Social Media Policy?
Kroski, Ellyssa
2009-01-01
Today's new media tools are incredibly powerful communication vehicles that allow organizations to connect and engage with many different audiences. With more than seven million users, Twitter is growing at an annual rate of 1,382 percent, Facebook boasts over 250 million active members, and aspiring writers have started more than 133 million…
Infrared Astronomy Professional Development for K-12 Educators: WISE Telescope
Borders, Kareen; Mendez, B. M.
2010-01-01
K-12 educators need effective and relevant astronomy professional development. WISE Telescope (Wide-Field Infrared Survey Explorer) and Spitzer Space Telescope Education programs provided an immersive teacher professional development workshop at Arecibo Observatory in Puerto Rico during the summer of 2009. As many common misconceptions involve scale and distance, teachers worked with Moon/Earth scale, solar system scale, and distance of objects in the universe. Teachers built and used basic telescopes, learned about the history of telescopes, explored ground and satellite based telescopes, and explored and worked on models of WISE Telescope. An in-depth explanation of WISE and Spitzer telescopes gave participants background knowledge for infrared astronomy observations. We taught the electromagnetic spectrum through interactive stations. The stations included an overview via lecture and power point, the use of ultraviolet beads to determine ultraviolet exposure, the study of WISE lenticulars and diagramming of infrared data, listening to light by using speakers hooked up to photoreceptor cells, looking at visible light through diffraction glasses and diagramming the data, protocols for using astronomy based research in the classroom, and infrared thermometers to compare environmental conditions around the observatory. An overview of LIDAR physics was followed up by a simulated LIDAR mapping of the topography of Mars. We will outline specific steps for K-12 infrared astronomy professional development, provide data demonstrating the impact of the above professional development on educator understanding and classroom use, and detail future plans for additional K-12 professional development. Funding was provided by WISE Telescope, Spitzer Space Telescope, Starbucks, Arecibo Observatory, the American Institute of Aeronautics and Astronautics, and the Washington Space Grant Consortium.
Engineering Education in K-12 Schools
Spence, Anne
2013-03-01
Engineers rely on physicists as well as other scientists and mathematicians to explain the world in which we live. Engineers take this knowledge of the world and use it to create the world that never was. The teaching of physics and other sciences as well as mathematics is critical to maintaining our national workforce. Science and mathematics education are inherently different, however, from engineering education. Engineering educators seek to enable students to develop the habits of mind critical for innovation. Through understanding of the engineering design process and how it differs from the scientific method, students can apply problem and project based learning to solve the challenges facing society today. In this talk, I will discuss the elements critical to a solid K-12 engineering education that integrates science and mathematics to solve challenges throughout the world.
Efficient pooling designs for library screening
Bruno, William J.; Knill, Emanuel; Balding, David J.; Bruce, D. C.; Doggett, N. A.; Sawhill, W. W.; Stallings, R. L.; Whittaker, Craig C.; Torney, David C.
1994-01-01
We describe efficient methods for screening clone libraries, based on pooling schemes which we call ``random $k$-sets designs''. In these designs, the pools in which any clone occurs are equally likely to be any possible selection of $k$ from the $v$ pools. The values of $k$ and $v$ can be chosen to optimize desirable properties. Random $k$-sets designs have substantial advantages over alternative pooling schemes: they are efficient, flexible, easy to specify, require fewer pools, and have er...
The Role of Libraries in Curbing Teenage Pregnancy in Nigeria ...
African Journals Online (AJOL)
The Role of Libraries in Curbing Teenage Pregnancy in Nigeria. ... As a result of this most teenagers learn about sex education through their peers, mass media, etc. ... orientation to teenagers on teenage pregnancy and how it can be avoided.
Analysis of library patrons' usage of social media in a Nigerian ...
African Journals Online (AJOL)
The findings revealed that Whatsapp and facebook were greatly used as it creates current awareness on the happening in the institution; it also established that social media enabled students to access local and web contents of information needs globally. The findings revealed that critical social media literacy is needed to ...
Transforming K-12 Rural Education through Blended Learning: Teacher Perspectives
Kellerer, Paula; Kellerer, Eric; Werth, Eric; Werth, Lori; Montgomery, Danielle; Clyde, Rozella; Cozart, Joe; Creach, Laura; Hibbard, Laura; LaFrance, Jason; Rupp, Nadine; Walker, Niki; Carter, Theresa; Kennedy, Kathryn
2014-01-01
A qualitative study exploring rural teacher perspectives on the impact of blended learning on students and teachers was conducted in Idaho during the Fall of 2013. Researchers from Northwest Nazarene University's DOCEO Center in partnership with Idaho Digital Learning Academy (IDLA) and the International Association for K-12 Online Learning…
Problem-Based Learning in the Physical Science Classroom, K-12
McConnell, Tom J.; Parker, Joyce; Eberhardt, Janet
2018-01-01
"Problem-Based Learning in the Physical Science Classroom, K-12" will help your students truly understand concepts such as motion, energy, and magnetism in true-to-life contexts. The book offers a comprehensive description of why, how, and when to implement problem-based learning (PBL) in your curriculum. Its 14 developmentally…
The current situation of e-books in academic and public libraries in Sweden
Directory of Open Access Journals (Sweden)
Elena Macevičiūtė
2014-03-01
Full Text Available Introducing e-books into Swedish libraries has been influenced by the idea of equal access to all media for all Swedish citizens as well as by librarians’ wish to provide the best possible service to their users. Libraries perceived this new resource and service as a way of fulfilling their specific function in a democratic society, which is usually described as mediation (or transfer of knowledge and culture to all. This is a common basis for the incorporation of new media and information resources (including e-books into Swedish academic and public libraries. Apart from this common platform, we see other similarities in working with e-books in both types of libraries, but also a number of differences. Most of them relate to the position of libraries within their respective context and in relation to their specific role. Academic libraries are quite influential players in the global scholarly communication and supporters of both research and study processes. As such they are embedded in a mainly international market of scientific information and scholarly materials. They have significant resources provided by their parent universities for the acquisition of scholarly material and a wide choice of commercially available material from different providers. They are also incorporated into a national library consortium with great negotiation power. Thus, they have more freedom to experiment with a variety of business and pricing models offered on the international market. They also have a high competence in publishing and are often publishers themselves. Their involvement in research processes and in open access initiatives puts them in a position to provide expertise to researchers in the areas of publishing and intellectual property protection. Public libraries are part of the local cultural and educational landscape. As such, they depend on the production of media and content in national languages which helps cater to the needs and demands of
Energy Technology Data Exchange (ETDEWEB)
Milner, E.C.
1985-12-01
The observation of ..lambda..-hypernuclear levels in /sub ..lambda..//sup 12/C by associated production through the (..pi../sup +/,K/sup +/) reaction is reported. Spectrometers used in the measurements are discussed. The /sub ..lambda..//sup 12/C excitation energy spectra were recorded at laboratory scattering angles of 5.6/sup 0/, 10.3/sup 0/, and 15.2/sup 0/. The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup ..pi../ = 2/sup +/ states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (..pi../sup +/,K/sup +/) reaction, compared to the (K/sup -/,..pi../sup -/) reaction in which lower spin states are excited. 29 refs., 40 figs.
An Exploratory Study on K-12 Teachers' Use of Technology and Multimedia in the Classroom
Martin, Florence; Carr, Marsha L.
2015-01-01
21st century has seen new technology and multimedia made available for integration in K-12 classrooms. This exploratory study examines K-12 teachers' use of technology and multimedia in the classroom in two southern counties in the Southeastern United States. The purpose of the study was to answer the following five research questions: 1) What…
Directory of Open Access Journals (Sweden)
Nazan Özenç Uçak
1995-03-01
Full Text Available Developments in libraries which began with the use of computers accelerate with the emergence of new technologies every day. Especially, the widespread use of microcomputers, developments in communication and optic disk technologies, and the use ofartifxcal intelligence and expert systems in libraries have impact upon the library profession. The assortment, quality and speed of library services have increased due to these developments. Along with the technological advances, the organizational structure of , and the management approcah to, libraries changes, too. These ongoing changes bring forth the question of what would happen to the libraries and librarianship of the future. Kütüphanelerde bilgisayarların kullanımı ile başlayan gelişmeler, her geçen gün yeni teknolojilerin ortaya çıkmasıyla giderek büyümektedir, özellikle mikrobilgisayarların geniş kullanım alanı bulması, iletişim teknolojisinin hızlı gelişimi, optik disk teknolojisindeki yenilikler, yapay zeka ve uzman sistemlerden kütüphanecilik alanında yararlanılabilmesi kütüphanecilik mesleğini etkilemektedir. Bu gelişmelere bağlı olarak verilen hizmetlerin çeşidi, niteliği ve hızı artmaktadır. Kütüphanelerin Örgüt yapılarında, yönetim anlayışlarında da değişimler söz konusudur. Bugün yaşanan bu değişimler geleceğin kütüphanelerinin ve kütüphaneciliğinin neolacağı sorularını gündeme getirmektedir.
Solubilization of Na,K-ATPase from rabbit kidney outer medulla using only C12E8
Directory of Open Access Journals (Sweden)
H.L. Santos
2002-03-01
Full Text Available SDS, C12E8, CHAPS or CHAPSO or a combination of two of these detergents is generally used for the solubilization of Na,K-ATPase and other ATPases. Our method using only C12E8 has the advantage of considerable reduction of the time for enzyme purification, with rapid solubilization and purification in a single chromatographic step. Na,K-ATPase-rich membrane fragments of rabbit kidney outer medulla were obtained without adding SDS. Optimum conditions for solubilization were obtained at 4ºC after rapid mixing of 1 mg of membrane Na,K-ATPase with 1 mg of C12E8/ml, yielding 98% recovery of the activity. The solubilized enzyme was purified by gel filtration on a Sepharose 6B column at 4ºC. Non-denaturing PAGE revealed a single protein band with phosphomonohydrolase activity. The molecular mass of the purified enzyme estimated by gel filtration chromatography was 320 kDa. The optimum apparent pH obtained for the purified enzyme was 7.5 for both PNPP and ATP. The dependence of ATPase activity on ATP concentration showed high (K0.5 = 4.0 µM and low (K0.5 = 1.4 mM affinity sites for ATP, with negative cooperativity. Ouabain (5 mM, oligomycin (1 µg/ml and sodium vanadate (3 µM inhibited the ATPase activity of C12E8-solubilized and purified Na,K-ATPase by 99, 81 and 98.5%, respectively. We have shown that Na,K-ATPase solubilized only with C12E8 can be purified and retains its activity. The activity is consistent with the form of (alphaß2 association.
Examining Student-Adult Relationships during K-12 School Age Years
Lappi, Shelly J.
2012-01-01
This study examined the relationship between dependent and independent variables and the effects relationships have on K-12 students as they struggle through life stressors. Thus, the research study was based upon this over arching question: How does having positive student-adult relationships impact a student's ability to cope with life…
Librarian's nitty-gritty guide to social media
Solomon, Laura
2014-01-01
The vast array of social media options present a challenge: it's tough to keep current, let alone formulate a plan for using these tools effectively. Solomon, a librarian with extensive experience in web development, design, and technology, cuts to the chase with this invaluable guide to using social media in any kind of library. With a straightforward and pragmatic approach, she broadens her best-selling ALA Editions Special Report on the topic and Presents an overview of the social media world, providing context for services like Facebook, Twitter, and YouTube, and analyzes how adults' an
International Nuclear Information System (INIS)
Cho, Man Soon; Choo, K. N.; Kang, Y. H.; Sohn, J. M.; Shin, Y. T.; Park, S. J.; Kim, B. G.; Oh, S. Y.
2010-01-01
To overcome the restriction of the irradiation test at a high temperature of the existing material capsule with Al thermal media, a capsule suitable for the irradiation at the high temperature was developed and the performance test was undertaken. The 08M-10K capsule was designed and fabricated as that with double thermal media to verify the structural and external integrity in the high-temperature irradiation higher than 500 .deg. C. The thermal performance test was undertaken at the out-pile test facility, and the soundness of the double thermal media was confirmed with the naked eye after disassembling the capsule. Though the temperatures of the specimens reach 500±20 .deg. C as a result maintaining the capsule during 5 hours after setting the specimens temperatures in the target range, the high-temperature thermal media with double structure was confirmed to maintain the soundness. And the specimens and the thermal media were heated to 600 .deg. C for about 3 minutes, but the thermal media were maintained sound. Especially, the Al thermal media were heated for 5 hours in range of 500±20 .deg. C and for 3 minutes at the temperature of 600 .deg. C. However, the thermal media were confirmed to maintain the soundness. Whether a capsule has only Al thermal media or the high-temperature thermal media with double structure, any capsule can be used in the range of 500±20 .deg. C as the result of this experiment maintaining the specimens high-temperature
Cloning and expression of the Escherichia coli K-12 sad gene.
Marek, L E; Henson, J M
1988-01-01
The Escherichia coli K-12 sad gene, which encodes an NAD-dependent succinic semialdehyde dehydrogenase, was cloned into a high-copy-number vector. Minicells carrying a sad+ plasmid produced a 55,000-dalton peptide, the probable sad gene product.
Hadjina, G; Granić, D; Bekavac, A
1990-01-01
New technologies in information and retrieval services of the Central Medical Library are presented, as well as comparison between traditional search of biomedical literature and search of biomedical bases available on CD-ROM and on-line. MeSH thesaurus represents the basis for all modes of searches, either through published indexes (Index Medicus, Biomedicina Iugoslavica), searches through on-line, or via CD-ROM technology. Experience in indexing according to MeSH structure helps us to search and retrieve biomedical literature on new media too. Great interest in new media for search and retrieval of biomedical literature among our users (100%) justifies their introduction into the Library. In the period of four months, 75% of our users chose CD-ROM technology in their search, 25% chose on-line search, and both technologies were combined by 33% of the users. Having these new media in our library we have reached the point from which we join the world biomedical information network and successfully meet the growing need for information in the field of biomedicine.
University Libraries and Digital Learning Environments
2011-01-01
University libraries around the world have embraced the possibilities of the digital learning environment, facilitating its use and proactively seeking to develop the provision of electronic resources and services. The digital environment offers opportunities and challenges for librarians in all aspects of their work – in information literacy, virtual reference, institutional repositories, e-learning, managing digital resources and social media. The authors in this timely book are leading exp...
Gender Sorting across K-12 Schools in the United States
Long, Mark C.; Conger, Dylan
2013-01-01
This article documents evidence of nonrandom gender sorting across K-12 schools in the United States. The sorting exists among coed schools and at all grade levels, and it is highest in the secondary school grades. We observe some gender sorting across school sectors and types: for instance, males are slightly underrepresented in private schools…
Energy Technology Data Exchange (ETDEWEB)
Yen Tzu-Hsiang; Chen Bao-Dong [Refining and Manufacturing Research Institute, CPC Corporation, Chia-Yi City 60036, Taiwan (China); Hong Wen-Tang; Tsai Yu-Ching; Wang Hung-Yu; Huang Cheng-Nan; Lee Chien-Hsiung [Institute of Nuclear Energy Research Atomic Energy Council, Taoyuan County 32546, Taiwan (China)
2010-07-01
Numerical simulations are performed to analyze the combustion of the anode off-gas / cathode off-gas mixture within the two-stage porous media burner of a 1 kW solid oxide fuel cell (SOFC) system. In performing the simulations, the anode gas is assumed to be hydrogen and the combustion of the gas mixture is modeled using a turbulent flow model. The validity of the numerical model is confirmed by comparing the simulation results for the flame barrier temperature and the porous media temperature with the corresponding experimental results. Simulations are then performed to investigate the effects of the hydrogen content and the burner geometry on the temperature distribution within the burner and the corresponding operational range. It is shown that the maximum flame temperature increases with an increasing hydrogen content. In addition, it is found that the burner has an operational range of 1.2--6.5 kW when assigned its default geometry settings (i.e. a length and diameter of 0.17 m and 0.06 m, respectively), but increases to 2--9 kW and 2.6--11.5 kW when the length and diameter are increased by a factor of 1.5, respectively. Finally, the operational range increases to 3.5--16.5 kW when both the diameter and the length of the burner are increased by a factor of 1.5.
Looking for Books in Social Media
DEFF Research Database (Denmark)
Koolen, Marijn; Bogers, Toine; Jaap, Kamps
2015-01-01
; potentially complex needs are obscured by the systems’ limitations. In this paper we study explicit information requests in social media, focusing on the rich area of social book search. We analyse a large set of annotated book requests from the LibraryThing discussion forums. We investigate 1...
Disaster Management in Academic Libraries in Ghana | Akussah ...
African Journals Online (AJOL)
The article presents the findings of a survey of the management of disasters in academic libraries in Ghana. In the 12 academic libraries surveyed, the findings revealed varying levels of unpreparedness of most academic libraries for disasters in Ghana. The absence of purpose of recovery after disasters, the lack of disaster ...
Westbrook, R. Niccole; Watkins, Sean
2012-01-01
As primary source materials in the library are digitized and made available online, the focus of related library services is shifting to include new and innovative methods of digital delivery via social media, digital storytelling, and community-based and consortial image repositories. Most images on the Web are not of sufficient quality for most…
Draft Genome Sequence of Escherichia coli K-12 (ATCC 10798)
Dimitrova, Daniela; Engelbrecht, Kathleen C.; Putonti, Catherine; Koenig, David W.; Wolfe, Alan J.
2017-01-01
ABSTRACT Here, we present the draft genome sequence of Escherichia coli ATCC 10798. E.?coli ATCC 10798 is a K-12 strain, one of the most well-studied model microorganisms. The size of the genome was 4,685,496?bp, with a G+C content of 50.70%. This assembly consists of 62 contigs and the F plasmid.
Hanna, Mark; Sanders, Karen
2012-01-01
A longitudinal study of U.K. journalism undergraduates records how their attitudes on societal roles of the news media changed during university education. Students became more likely to endorse an adversarial approach toward public officials and businesses as extremely important. Yet students did not support these roles as strongly as an older…
Animal products and K-ras codon 12 and 13 mutations in colon carcinomas
Kampman, E.; Voskuil, D.W.; Kraats, A.A. van; Balder, H.F.; Muijen, G.N.P. van; Goldbohm, R.A.; Veer, P. van 't
2000-01-01
K-ras gene mutations (codons 12 and 13) were determined by PCR-based mutant allele-specific amplification (MASA) in tumour tissue of 185 colon cancer patients: 36% harboured mutations, of which 82% were located in codon 12. High intakes of animal protein, calcium and poultry were differently
Directory of Open Access Journals (Sweden)
M. A. KRÄHENBÜHL
1998-03-01
Full Text Available The excess molar enthalpies of 1-octene + dimethylcarbonate or diethylcarbonate or 1,2-propylcarbonate have been measured at two high temperatures 363.15 K and 413.15 K and for pressures varying from 18 to 20 bar with an isothermal flow-calorimeter. All these mixtures have exhibited positive HEm.
Like, Comment, Retweet: Understanding Student Social Media Preferences
Dee Winn; Michael Groenendyk; Melissa Rivosecchi
2016-01-01
The majority of academic libraries currently use one or more social media websites in their efforts to communicate and engage with students. Some of the most widely used sites are Facebook, Twitter, YouTube and Instagram. Education students at the University of British Columbia were surveyed and asked to rank whether they preferred receiving Library communications from Facebook, Twitter or WordPress (blogs). The results indicate that students ranked Facebook first, WordPress second and Twitte...
Poor Reading Culture: A Barrier to Students' Patronage of Libraries ...
African Journals Online (AJOL)
FIRST LADY
show that computer and other media, harsh economic reality, societal demand for materialism, inadequate library materials among others are causes of poor reading culture of students in secondary schools. .... foundation of elementary education. ... play in the social, economic and technological development of any country.
Altincicek, Boran; Ter Braak, Bas; Laughton, Alice M; Udekwu, Klas I; Gerardo, Nicole M
2011-10-01
To better understand the molecular basis underlying aphid immune tolerance to beneficial bacteria and immune defense to pathogenic bacteria, we characterized how the pea aphid Acyrthosiphon pisum responds to Escherichia coli K-12 infections. E. coli bacteria, usually cleared in the hemolymph of other insect species, were capable of growing exponentially and killing aphids within a few days. Red fluorescence protein expressing E. coli K-12 laboratory strain multiplied in the aphid hemolymph as well as in the digestive tract, resulting in death of infected aphids. Selected gene deletion mutants of the E. coli K-12 predicted to have reduced virulence during systemic infections showed no difference in either replication or killing rate when compared to the wild type E. coli strain. Of note, however, the XL1-Blue E. coli K-12 strain exhibited a significant lag phase before multiplying and killing aphids. This bacterial strain has recently been shown to be more sensitive to oxidative stress than other E. coli K-12 strains, revealing a potential role for reactive oxygen species-mediated defenses in the otherwise reduced aphid immune system. Copyright © 2011 Elsevier Ltd. All rights reserved.
Structural insight into the rearrangement of the switch I region in GTP-bound G12A K-Ras
Energy Technology Data Exchange (ETDEWEB)
Xu, Shenyuan; Long, Brian N.; Boris, Gabriel H.; Chen, Anqi; Ni, Shuisong; Kennedy, Michael A.
2017-11-10
K-Ras, a molecular switch that regulates cell growth, apoptosis and metabolism, is activated when it undergoes a conformation change upon binding GTP and is deactivated following the hydrolysis of GTP to GDP. Hydrolysis of GTP in water is accelerated by coordination to K-Ras, where GTP adopts a high-energy conformation approaching the transition state. The G12A mutation reduces intrinsic K-Ras GTP hydrolysis by an unexplained mechanism. Here, crystal structures of G12A K-Ras in complex with GDP, GTP, GTPγS and GppNHp, and of Q61A K-Ras in complex with GDP, are reported. In the G12A K-Ras–GTP complex, the switch I region undergoes a significant reorganization such that the Tyr32 side chain points towards the GTP-binding pocket and forms a hydrogen bond to the GTP γ-phosphate, effectively stabilizing GTP in its precatalytic state, increasing the activation energy required to reach the transition state and contributing to the reduced intrinsic GTPase activity of G12A K-Ras mutants.
Technical Feasibility Study for Zero Energy K-12 Schools
Energy Technology Data Exchange (ETDEWEB)
Bonnema, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Goldwasser, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Torcellini, Paul [National Renewable Energy Lab. (NREL), Golden, CO (United States); Pless, Shanti [National Renewable Energy Lab. (NREL), Golden, CO (United States); Studer, Daniel [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-11-01
This technical feasibility study provides documentation and research results supporting a possible set of strategies to achieve source zero energy K-12 school buildings as defined by the U.S. Department of Energy (DOE) zero energy building (ZEB) definition (DOE 2015a). Under this definition, a ZEB is an energy-efficient building in which, on a source energy basis, the actual annual delivered energy is less than or equal to the on-site renewable exported energy.
Public libraries, information society and technology: communication
Directory of Open Access Journals (Sweden)
Elsa Barber
2001-01-01
Full Text Available The research team focuses in the influence that Argentinian public libraries (popular and public have with library automation and public services oriented to the use of information technologies, and the acquisition of communitarian information skills within the information society. The methodology consists of a survey already successfully approved in previous investigations by the research team (UBACYT FI013 and TF06. The questionnaire focuses on related variables. On one hand, the variables were related to libraries automation processes (equipment, information systems,working modules, retrospective conversion, digitization, networks,and so on. And on the other hand, with given information technologies services (access to networks and documents in every media, Web navigation assistance, information technology local server, services to minorities, and so on. Data would be gathered with specific applications from the social sciences field. The final stage would be to study specific aspects of the automation processes of the libraries surveyed, in order to verify the reciprocal relationship between the automation level reached. And subsequently, to examine the likelihood of establishing new services that respond to the community information trends within the information technology and telecommunications development context.
Nuclear Data Libraries for Hydrogen in Light Water Ice
International Nuclear Information System (INIS)
Torres, L; Gillette, V.H
2000-01-01
Nuclear data libraries were produced for hydrogen (H) in light water ice at different temperatures, 20, 30, 50, 77, 112, 180, 230 K.These libraries were produced using the NJOY nuclear data processing system.With this code we produce pointwise cross sections and related quantities, in the ENDF format, and in the ACE format for MCNP.Experimental neutron spectra at such temperatures were compared with MCNP4B simulations, based on the locally produced libraries, leading to satisfactory results
Apparent intermediate K conductance channel hyposmotic activation in human lens epithelial cells.
Lauf, Peter K; Misri, Sandeep; Chimote, Ameet A; Adragna, Norma C
2008-03-01
This study explores the nature of K fluxes in human lens epithelial cells (LECs) in hyposmotic solutions. Total ion fluxes, Na-K pump, Cl-dependent Na-K-2Cl (NKCC), K-Cl (KCC) cotransport, and K channels were determined by 85Rb uptake and cell K (Kc) by atomic absorption spectrophotometry, and cell water gravimetrically after exposure to ouabain +/- bumetanide (Na-K pump and NKCC inhibitors), and ion channel inhibitors in varying osmolalities with Na, K, or methyl-d-glucamine and Cl, sulfamate, or nitrate. Reverse transcriptase polymerase chain reaction (RT-PCR), Western blot analyses, and immunochemistry were also performed. In isosmotic (300 mosM) media approximately 90% of the total Rb influx occurred through the Na-K pump and NKCC and approximately 10% through KCC and a residual leak. Hyposmotic media (150 mosM) decreased K(c) by a 16-fold higher K permeability and cell water, but failed to inactivate NKCC and activate KCC. Sucrose replacement or extracellular K to >57 mM, but not Rb or Cs, in hyposmotic media prevented Kc and water loss. Rb influx equaled Kc loss, both blocked by clotrimazole (IC50 approximately 25 microM) and partially by 1-[(2-chlorophenyl) diphenylmethyl]-1H-pyrazole (TRAM-34) inhibitors of the IK channel KCa3.1 but not by other K channel or connexin hemichannel blockers. Of several anion channel blockers (dihydro-indenyl)oxy]alkanoic acid (DIOA), 4-2(butyl-6,7-dichloro-2-cyclopentylindan-1-on-5-yl)oxybutyric acid (DCPIB), and phloretin totally or partially inhibited Kc loss and Rb influx, respectively. RT-PCR and immunochemistry confirmed the presence of KCa3.1 channels, aside of the KCC1, KCC2, KCC3 and KCC4 isoforms. Apparently, IK channels, possibly in parallel with volume-sensitive outwardly rectifying Cl channels, effect regulatory volume decrease in LECs.
Library performance measurement in the digital age
Conyers, A.; Payne, Philip
2011-01-01
Book synopsis: University libraries around the world have embraced the possibilities of the digital learning environment, facilitating its use and proactively seeking to develop the provision of electronic resources and services. The digital environment offers opportunities and challenges for librarians in all aspects of their work - in information literacy, virtual reference, institutional repositories, e-learning, managing digital resources and social media. The authors in this timely book ...
Isolation and characterization of cDNA clones for carrot extensin and a proline-rich 33-kDa protein
International Nuclear Information System (INIS)
Chen, J.; Varner, J.E.
1985-01-01
Extensins are hydroxyproline-rich glycoproteins associated with most dicotyledonous plant cell walls. To isolate cDNA clones encoding extensin, the authors started by isolating poly(A) + RNA from carrot root tissue, and then translating the RNA in vitro, in the presence of tritiated leucine or proline. A 33-kDa peptide was identified in the translation products as a putative extensin precursor. From a cDNA library constructed with poly(A) + RNA from wounded carrots, one cDNA clone (pDC5) was identified that specifically hybridized to poly(A) + RNA encoding this 33-kDa peptide. They isolated three cDNA clones (pDC11, pDC12, and pDC16) from another cDNA library using pCD5 as a probe. DNA sequence data, RNA hybridization analysis, and hybrid released in vitro translation indicate that the cDNA clones pDC11 encodes extensin and that cDNA clones pDC12 and pDC16 encode the 33-kDa peptide, which as yet has an unknown identity and function. The assumption that the 33-kDa peptide was an extensin precursor was invalid. RNA hybridization analysis showed that RNA encoded by both clone types is accumulated upon wounding
Enhancing the Impact of Evidence-Based Publications on K-12 ESL Teacher Practices
Abbott, Marilyn L.; Lee, Kent; Rossiter, Marian J.
2017-01-01
The reading of current research-informed publications is an essential component of teacher professional development that has the potential to lead to or reinforce the implementation of effective instructional practices. To our knowledge, no studies have examined kindergarten to grade 12 (K-12) ESL teacher engagement in professional reading related…
How Vocational Psychologists Can Make a Difference in K-12 Education
Perry, Justin C.; Shannon, Lisa
2017-01-01
In general, vocational psychologists have not been engaged in applied research that demonstrates how career interventions can improve educational problems that matter to relevant decision-makers and stakeholders. This article describes how vocational psychology can make a difference in K-12 education by embracing an interdisciplinary…
Nigerian School Library Journal - Vol 4, No 1&2 (2005)
African Journals Online (AJOL)
Evaluation of School Library Resources, Services and Usage: A Case Study of International School, University of Ibadan · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. SO Akande, 103-112 ...
Take control of media on your iPad
Carlson, Jeff
2011-01-01
Join media-savvy author Jeff Carlson as he helps you enjoy media on your iPad like never before. Jeff explains basic and advanced ways of adding media to your iPad, and gives you a thorough grounding in Apple's core media apps-iBooks, iPod, Videos, and Photos. He also helps you integrate your iPad with an Apple TV and looks at various ways of using an iPad as a TV remote. You'll also get plenty of suggestions for third-party apps and products, whether you want to read books not available in the iBookstore, stream music from the Internet to your iPad, convert your own DVD library to iPad-frien
CGNS Mid-Level Software Library and Users Guide
Poirier, Diane; Smith, Charles A. (Technical Monitor)
1998-01-01
The "CFD General Notation System" (CGNS) consists of a collection of conventions, and conforming software, for the storage and retrieval of Computational Fluid Dynamics (CFD) data. It facilitates the exchange of data between sites and applications, and helps stabilize the archiving of aerodynamic data. This effort was initiated in order to streamline the procedures in exchanging data and software between NASA and its customers, but the goal is to develop CGNS into a National Standard for the exchange of aerodynamic data. The CGNS development team is comprised of members from Boeing Commercial Airplane Group, NASA-Ames, NASA-Langley, NASA-Lewis, McDonnell-Douglas Corporation (now Boeing-St. Louis), Air Force-Wright Lab., and ICEM-CFD Engineering. The elements of CGNS address all activities associated with the storage of data on external media and its movement to and from application programs. These elements include: - The Advanced Data Format (ADF) Database manager, consisting of both a file format specification and its I/O software, which handles the actual reading and writing of data from and to external storage media; - The Standard Interface Data Structures (SIDS), which specify the intellectual content of CFD data and the conventions governing naming and terminology; - The SIDS-to-ADF File Mapping conventions, which specify the exact location where the CFD data defined by the SIDS is to be stored within the ADF file(s); and - The CGNS Mid-level Library, which provides CFD-knowledgeable routines suitable for direct installation into application codes. The CGNS Mid-level Library was designed to ease the implementation of CGNS by providing developers with a collection of handy I/O functions. Since knowledge of the ADF core is not required to use this library, it will greatly facilitate the task of interfacing with CGNS. There are currently 48 user callable functions that comprise the Mid-level library and are described in the Users Guide. The library is written in
Boulos, MN Kamel; Roudsari, AV; Gordon, C; Gray, JA Muir
2001-01-01
Background In 1998, the U.K. National Health Service Information for Health Strategy proposed the implementation of a National electronic Library for Health to provide clinicians, healthcare managers and planners, patients and the public with easy, round the clock access to high quality, up-to-date electronic information on health and healthcare. The Virtual Branch Libraries are among the most important components of the National electronic Library for Health . They aim at creating online kno...
Females and STEM: Determining the K-12 Experiences that Influenced Women to Pursue STEM Fields
Petersen, Anne Marie
In the United States, careers in the fields of Science, Technology, Engineering, and Mathematics (STEM) are increasing yet there are not enough trained personnel to meet this demand. In addition, of those that seek to pursue STEM fields in the United States, only 26% are female. In order to increase the number of women seeking STEM based bachelor's degrees, K-12 education must provide a foundation that prepares students for entry into these fields. The purpose of this phenomenological study was to determine the perceived K-12 experiences that influenced females to pursue a STEM field. Twelve college juniors or seniors seeking a degree in Biology, Mathematics, or Physics were interviewed concerning their K-12 experiences. These interviews were analyzed and six themes emerged. Teacher passion and classroom characteristics such as incorporating challenging activities played a significant role in the females' decisions to enter STEM fields. Extra-curricular activities such as volunteer and mentor opportunities and the females' need to benefit others also influenced females in their career choice. Both the formal (within the school) and informal (outside of the traditional classroom) pipeline opportunities that these students encountered helped develop a sense of self-efficacy in science and mathematics; this self-efficacy enabled them to persist in pursuing these career fields. Several participants cited barriers that they encountered in K-12 education, but these barriers were primarily internal as they struggled with overcoming self-imposed obstacles in learning and being competitive in the mathematics and science classrooms. The experiences from these female students can be used by K-12 educators to prepare and encourage current female students to enter STEM occupations.
An Automation Survival Guide for Media Centers.
Whaley, Roger E.
1989-01-01
Reviews factors that should affect the decision to automate a school media center and offers suggestions for the automation process. Topics discussed include getting the library collection ready for automation, deciding what automated functions are needed, evaluating software vendors, selecting software, and budgeting. (CLB)
Workplace Incivility and Bullying in the Library: Perception or Reality?
Freedman, Shin; Vreven, Dawn
2016-01-01
Recent media reports have increased awareness of workplace incivility and bullying. However, the literature regarding workplace incivility and bullying in academic libraries is under reported and under researched. This study examines the current state of librarians' perceptions on workplace incivility and bullying and evaluates the effects of…
Perception of library staff on the preservation and conservation of ...
African Journals Online (AJOL)
Perception of library staff on the preservation and conservation of library resources in the Federal ... Journal Home > Vol 48, No 1-2 (2015) > ... of preservation policy as well as lack of funding to purchase preservation equipment in the library.
Directory of Open Access Journals (Sweden)
Elsie Bain
2016-10-01
Full Text Available The College of The Bahamas Libraries and Instructional Media Services department is the premier academic and research library in the country. Its mission is to meet the needs and expectations of its patrons by acquiring and maintaining extensive physical and digital repositories of resources to support teaching and research. During a library symposium held in 2016 the planning committee surveyed attendees to gather information about their educational background and needs and goals for continuing professional education. The article summarizes the findings and potential implications of the survey.
International Nuclear Information System (INIS)
Ribeiro, Ana C.F.; Gomes, Joselaine C.S.; Barros, Marisa C.F.; Lobo, Victor M.M.; Esteso, Miguel A.
2011-01-01
Binary mutual diffusion coefficients (interdiffusion coefficients) of nickel chloride in water at T = 298.15 K and T = 310.15 K, and at concentrations between (0.000 and 0.100) mol · dm -3 , using a Taylor dispersion method have been measured. These data are discussed on the basis of the Onsager-Fuoss and Pikal models. The equivalent conductance at infinitesimal concentration of the nickel ion in these solutions at T = 310.15 K has been estimated using these results. Through the same technique, ternary mutual diffusion coefficients (D 11 , D 22 , D 12 , and D 21 ) for aqueous solutions containing NiCl 2 and lactose, at T = 298.15 K and T = 310.15 K, and at different carrier concentrations were also measured. These data permit us to have a better understanding of the structure of these systems and the thermodynamic behaviour of NiCl 2 in different media.
Crosstalk between Vitamins A, B12, D, K, C, and E Status and Arterial Stiffness
Luca, Constantin Tudor
2017-01-01
Arterial stiffness is associated with cardiovascular risk, morbidity, and mortality. The present paper reviews the main vitamins related to arterial stiffness and enabling destiffening, their mechanisms of action, providing a brief description of the latest studies in the area, and their implications for primary cardiovascular prevention, clinical practice, and therapy. Despite inconsistent evidence for destiffening induced by vitamin supplementation in several randomized clinical trials, positive results were obtained in specific populations. The main mechanisms are related to antiatherogenic effects, improvement of endothelial function (vitamins A, C, D, and E) and metabolic profile (vitamins A, B12, C, D, and K), inhibition of the renin-angiotensin-aldosterone system (vitamin D), anti-inflammatory (vitamins A, D, E, and K) and antioxidant effects (vitamins A, C, and E), decrease of homocysteine level (vitamin B12), and reversing calcification of arteries (vitamin K). Vitamins A, B12, C, D, E, and K status is important in evaluating cardiovascular risk, and vitamin supplementation may be an effective, individualized, and inexpensive destiffening therapy. PMID:28167849
Keeping Pace with K-12 Digital Learning: An Annual Review of Policy and Practice. Eleventh Edition
Watson, John; Pape, Larry; Murin, Amy; Gemin, Butch; Vashaw, Lauren
2014-01-01
"Keeping Pace with K-12 Digital Learning" (2014) is the 11th in a series of annual reports that began in 2004 that examine the status of K-12 online education across the country. The report provides an overview of the latest policies, practices, and trends affecting online learning programs across all 50 states. It summarizes that at a…
Design of redundant array of independent DVD libraries based on iSCSI
Chen, Yupeng; Pan, Longfa
2003-04-01
This paper presents a new approach to realize the redundant array of independent DVD libraries (RAID-LoIP) by using the iSCSI technology and traditional RAID algorithms. Our design reaches the high performance of optical storage system with following features: large storage size, highly accessing rate, random access, long distance of DVD libraries, block I/O storage, long storage life. Our RAID-LoIP system can be a good solution for broadcasting media asset storage system.
Bukurov, Bojana; Arsovic, Nenad; Grujicic, Sandra Sipetic; Haggard, Mark; Spencer, Helen; Marinkovic, Jelena Eric
2017-10-23
Recently, demand for and supply of short-form patient-reported outcome measures (PROMs) have risen throughout the world healthcare. Our contribution to meeting that demand has been translating and culturally adapting the Chronic Otitis Media Questionnaire-12 (COMQ-12) for adults into Serbian and enhancing its psychometric base on the relatively large Serbian COM caseload. Chronic otitis media can seriously affect quality of life progressively and in long-term, and it remains the major source of hearing problems in the developing world. The translated questionnaire was given twice to 60 adult patients with chronic otitis media of three types (inactive, active mucosal and active squamous disease) and to 60 healthy volunteers. Both patients and volunteers also filled the generic Short-Form 36 questionnaire (SF-36). Conventional statistical procedures were used in strategically driven development of scoring. Additionally, item responses were scaled by linear mapping against the provisional total score. Generalizability, detailed factor interpretation and supportability of scores were criteria, for the best compromise factor solution. Test-retest reliability was very high (0.924 to 0.989, depending on score). The a priori content dimensions of the questionnaire were strongly supported by 3-factor exploratory and confirmatory factor analyses for content validity, separating (i) ear symptoms from (ii) hearing problems, from (iii) daily activity restriction plus healthcare uptake. The 3-factor structure was furthermore highly stable on replication. The very large effect sizes when contrasting patients with healthy volunteers, and active with inactive disease established construct validity for the total score. A strong association with disease activity and a moderate one with generic health-related quality of life (HRQoL), the SF-36, supported construct validity for two of three factors extracted (ear symptoms, and impact on daily activities plus healthcare uptake). Given
Are K-12 Learners Motivated in Physical Education? A Meta-Analysis
Chen, Senlin; Chen, Ang; Zhu, Xihe
2012-01-01
Previous studies devoted to K-12 learner motivation in physical education share a general assumption that students may lack motivation. This meta-analytic study examined published original studies (n = 79) to determine students' motivation level and the association between motivation and outcomes. Original means of motivation measures were…
Modular Short Form Videos for Library Instruction
Directory of Open Access Journals (Sweden)
Cindy Craig
2017-10-01
Full Text Available In Brief Expensive software isn’t necessary to create effective tutorials. Quick, unedited tutorials created on social media, such as on Instagram or Snapchat, may be more effective. These short form videos (SFVs combine the advantages of animated GIFs with the advantages of screencasts: modularity, repetition of steps, and animated visuals supported by pertinent audio. SFVs are cheap (or free and easy to make with materials libraries already possess, such as Internet access, computers, and smartphones. They are easily replaceable if the subject changes. The short form forces librarians to get right to the point. Finally, SFVs are easily disseminated on social media and have the potential to go viral.
Anti-ageing effects of a new synthetic sphingolipid (K6EAA-L12) on aged murine skin.
Jung, Minyoung; Lee, Sanghoon; Park, Hwa-young; Youm, Jong-Kyung; Jeong, Sekyoo; Bae, Jonghwan; Kwon, Mi Jung; Park, Byeong Deog; Lee, Seung Hun; Choi, Eung Ho
2011-04-01
Recently, we reported on the anti-ageing effects of K6PC-5. This compound induced keratinocyte differentiation and fibroblast proliferation by increasing sphingosine-1 phosphate synthesis. We performed this study to confirm the anti-ageing effects of new synthetic products (the K6EAA series) derived from K6PC-5 through an amino group induction. Cellular responses such as differentiation, proliferation and calcium mobilization were investigated using cultured human keratinocytes and fibroblasts. Also, we measured the expressions of collagen mRNA and protein using real time RT-PCR and ELISA, respectively. The K6EAA-L12 product, selected by in vitro screening, was evaluated for anti-ageing effects on intrinsically and extrinsically (photo) aged models of hairless mice. In the intrinsically aged murine skin, K6EAA-L12 showed anti-ageing effects by activating collagen synthesis, eventually causing dermal thickening. Also, in the photo-aged skin, the dermal collagen density and dermal thickness were increased. In photo-aged murine skin, K6EAA-L12 increased stratum corneum integrity by increasing corneodesmosome density and improved the barrier recovery rate. However, there were no changes in the expressions of epidermal differentiation maker proteins. In conclusion, topical K6EAA-L12, a new synthetic K6PC-5 derivative, improves intrinsically and extrinsically (photo) aged skin by increasing the collagen density and improving the skin barrier function. © 2011 John Wiley & Sons A/S.
ENDF/B-III scattering law library
International Nuclear Information System (INIS)
Goulo, V.; Lemmel, H.D.
1989-12-01
This library contains scattering law data S(α,β) for 10 materials used for thermal reactor and shielding calculations: H 2 O, D 2 O, Be, BeO, C, CH 2 , C 6 H 6 , UO 2 , ZrH x (for H), ZrH x (for Zr) for temperatures from 296 to 1000 or 1200 deg. K. Data are in ENDF/B-3 format. The library is available from the IAEA Nuclear Data Section on magnetic tape, costfree upon request. (author). Figs and tabs
Energy Technology Data Exchange (ETDEWEB)
Pless, S.; Torcellini, P.; Long, N.
2007-09-01
This Technical Support Document describes the process and methodology for the development of the Advanced Energy Design Guide for K-12 School Buildings (K-12 AEDG), a design guidance document intended to provide recommendations for achieving 30% energy savings in K-12 Schools over levels contained in ANSI/ASHRAE/IESNA Standard 90.1-1999, Energy Standard for Buildings Except Low-Rise Residential Buildings. The 30% energy savings target is the first step toward achieving net-zero energy schools; schools that, on an annual basis, draw from outside sources less or equal energy than they generate on site from renewable energy sources.
Genotyping of K-ras codons 12 and 13 mutations in colorectal cancer by capillary electrophoresis.
Chen, Yen-Ling; Chang, Ya-Sian; Chang, Jan-Gowth; Wu, Shou-Mei
2009-06-26
Point mutations of the K-ras gene located in codons 12 and 13 cause poor responses to the anti-epidermal growth factor receptor (anti-EGFR) therapy of colorectal cancer (CRC) patients. Besides, mutations of K-ras gene have also been proven to play an important role in human tumor progression. We established a simple and effective capillary electrophoresis (CE) method for simultaneous point mutation detection in codons 12 and 13 of K-ras gene. We combined one universal fluorescence-based nonhuman-sequence primer and two fragment-oriented primers in one tube, and performed this two-in-one polymerase chain reaction (PCR). PCR fragments included wild type and seven point mutations at codons 12 and 13 of K-ras gene. The amplicons were analyzed by single-strand conformation polymorphism (SSCP)-CE method. The CE analysis was performed by using a 1x Tris-borate-EDTA (TBE) buffer containing 1.5% (w/v) hydroxyethylcellulose (HEC) (MW 250,000) under reverse polarity with 15 degrees C and 30 degrees C. Ninety colorectal cancer patients were blindly genotyped using this developed method. The results showed good agreement with those of DNA sequencing method. The SSCP-CE was feasible for mutation screening of K-ras gene in populations.
Draft Genome Sequence of Escherichia coli K-12 (ATCC 10798).
Dimitrova, Daniela; Engelbrecht, Kathleen C; Putonti, Catherine; Koenig, David W; Wolfe, Alan J
2017-07-06
Here, we present the draft genome sequence of Escherichia coli ATCC 10798. E. coli ATCC 10798 is a K-12 strain, one of the most well-studied model microorganisms. The size of the genome was 4,685,496 bp, with a G+C content of 50.70%. This assembly consists of 62 contigs and the F plasmid. Copyright © 2017 Dimitrova et al.
Directory of Open Access Journals (Sweden)
Jurgita Rudzıonıene
2013-10-01
Full Text Available The main aim of the article is to find out how the professional public librarians have changed during last decades of huge changes in public libraries. Specialists which have long professional work experience as public librarians were selected for this research. Due to this,the empirical research was performed. The research points out professional and personal changes of librarians due to modernization processes at the library as social institution acting in information and communication field. Quantitative research was used to fulfill the task of the research. Questionnaire was created for the research and was used to survey the librarians of selected libraries. Research reports the results of the study based on the data derived from actual observation of several Lithuanian public libraries and their librarians, who have their work experience at the library more than 10 years. Five public libraries which have won competition of the best public libraries in Lithuania according to their results were chosen (competition was arranged in the frame of the project ”Bibliotekos pažangai” (Libraries for Innovation initiated by Bill & and Melinda Gates Foundation. The research consists of several steps. Selection of libraries was made at the first step. The second step of the research was to choose librarians from selected libraries with indicated work experience. The third step was to make a quantitative study. For this purpose a special questionnaire was created. The research results indicate professional and personal changes of public librarians due to intensive Information technologies development at the libraries and show professional librarians as agents of changes./Makalenin amacı, profesyonel halk kütüphanecilerinin son yıllarda halk kütüphanelerinde meydana gelen büyük değişiklikler paralelinde nasıl değiştiğini ortaya koymaktır. Araştırma örneklemi uzun süreli iş deneyimine sahip halk kütüphanelerinde
Curriculum Guide for Music Education, K-12. Bulletin 1978, No. 18.
Alabama State Dept. of Education, Montgomery.
This curriculum guide contains objectives, activities, and evaluation procedures for a K-12 music education program. It would be useful to anyone responsible for teaching music. The authors believe that music education has the dual obligation of developing the aesthetic sensitivity of all students regardless of their individual levels of musical…
Increasing Diversity in K-12 School Leadership. Policy Brief 2018-3
Castro, Andrene; Germain, Emily; Gooden, Mark
2018-01-01
Principals represent the most "visible" form of leadership in schools, but current workforce data show that K-12 school principals are overwhelmingly white and fail to reflect the diversity within the student population. With increased policy focus on teacher diversity, equal attention must also be directed towards the lack of diversity…
International Nuclear Information System (INIS)
Liu, Ping; Kong, Feng; Wang, Jue; Lu, Qinghua; Xu, Haijia; Qi, Tonggang; Meng, Juan
2015-01-01
Perivascular adipocyte (PVAC) proliferation and differentiation were closely involved in cardiovascular disease. We aimed to investigate whether phosphatidylinositol 3-kinase (PI3K) and mitogen-activated protein kinase (MAPK) signaling pathways enhance PVAC functions activated by insulin-like growth factor 1(IGF-1) and suppressed by mesenchyme homeobox 2 (MEOX2). In this study, PVACs from primary culture were cultured and induced to differentiate. Cell viability assays demonstrated that IGF-1 promoted PVAC proliferation and differentiation. However MEOX2 counteracted these IGF-1-mediated actions. Flow Cytometry revealed that IGF-1 increased S phase cells and decreased apoptosis; however, MEOX2 decreased S phase cells, increased G0–G1 phase cells, and promoted apoptosis. During PVAC proliferation and differentiation, IGF-1 activated PI3K/Akt1/2 and ERK1/2 signaling pathways, upregulated the expression of these signaling proteins and FAS, and increased PVAC lipid content. In contrast, MEOX2 constrained the phosphorylation of ERK1/2 and Akt1/2 protein, down-regulated these signaling molecules and FAS, and decreased PVAC lipid content. Instead, MEOX2 knockdown enhanced the ERK1/2 and Akt1/2 phosphorylation, augmented the expression of these signaling molecules and FAS, and increased PVAC lipid content. Our findings suggested that PI3K/Akt1/2 and ERK1/2 activation mediated by IGF-1 is essential for PVAC proliferation and differentiation, and MEOX2 is a promising therapeutic gene to intervene in the signaling pathways and inhibit PVAC functions. - Highlights: • IGF-1 activated PI3K/Akt2 and ERK1/2 pathways to mediate PVAC proliferation and differentiation. • The expression of ERK1, ERK 2, PI3K, Akt1 and Akt2 showed different change trends between PVAC proliferation and differentiation. • MEOX2 effectively expressed in PVAC, increased early and late cellular apoptosis, and inhibited its proliferation. • MEOX2 depressed PVAC differentiation and FAS expression
Energy Technology Data Exchange (ETDEWEB)
Liu, Ping, E-mail: lping@sdu.edu.cn [Department of Cardiology, The Second Hospital of Shandong University, No. 247, Beiyuan Road, Shandong, Jinan 250033 (China); Kong, Feng; Wang, Jue [Central Laboratory, The Second Hospital of Shandong University, Shandong, Jinan 250033 (China); Lu, Qinghua [Department of Cardiology, The Second Hospital of Shandong University, No. 247, Beiyuan Road, Shandong, Jinan 250033 (China); Xu, Haijia [Department of Cardiology, Wendeng Central Hospital of Weihai City, Shandong, Weihai 264400 (China); Qi, Tonggang [Central Laboratory, The Second Hospital of Shandong University, Shandong, Jinan 250033 (China); Meng, Juan [Department of Cardiology, The Second Hospital of Shandong University, No. 247, Beiyuan Road, Shandong, Jinan 250033 (China)
2015-02-01
Perivascular adipocyte (PVAC) proliferation and differentiation were closely involved in cardiovascular disease. We aimed to investigate whether phosphatidylinositol 3-kinase (PI3K) and mitogen-activated protein kinase (MAPK) signaling pathways enhance PVAC functions activated by insulin-like growth factor 1(IGF-1) and suppressed by mesenchyme homeobox 2 (MEOX2). In this study, PVACs from primary culture were cultured and induced to differentiate. Cell viability assays demonstrated that IGF-1 promoted PVAC proliferation and differentiation. However MEOX2 counteracted these IGF-1-mediated actions. Flow Cytometry revealed that IGF-1 increased S phase cells and decreased apoptosis; however, MEOX2 decreased S phase cells, increased G0–G1 phase cells, and promoted apoptosis. During PVAC proliferation and differentiation, IGF-1 activated PI3K/Akt1/2 and ERK1/2 signaling pathways, upregulated the expression of these signaling proteins and FAS, and increased PVAC lipid content. In contrast, MEOX2 constrained the phosphorylation of ERK1/2 and Akt1/2 protein, down-regulated these signaling molecules and FAS, and decreased PVAC lipid content. Instead, MEOX2 knockdown enhanced the ERK1/2 and Akt1/2 phosphorylation, augmented the expression of these signaling molecules and FAS, and increased PVAC lipid content. Our findings suggested that PI3K/Akt1/2 and ERK1/2 activation mediated by IGF-1 is essential for PVAC proliferation and differentiation, and MEOX2 is a promising therapeutic gene to intervene in the signaling pathways and inhibit PVAC functions. - Highlights: • IGF-1 activated PI3K/Akt2 and ERK1/2 pathways to mediate PVAC proliferation and differentiation. • The expression of ERK1, ERK 2, PI3K, Akt1 and Akt2 showed different change trends between PVAC proliferation and differentiation. • MEOX2 effectively expressed in PVAC, increased early and late cellular apoptosis, and inhibited its proliferation. • MEOX2 depressed PVAC differentiation and FAS expression
Nuclear data library table (Version November 1998)
International Nuclear Information System (INIS)
Baard, J.H.
1998-11-01
This report presents the edition of the Nuclear Data Library Table, valid from 1998-11-01. This library contains data for conversion of activity values to fluence rate and fluence values. The revised table is a modified version of the older library coded 1990-12-12. The older library has been extended with 23 reaction; the special 'background' reaction has been deleted. A table has been incorporated in this report which indicates the changes in this revised library data in comparison to previously used data. The data has been incorporated in this report which indicates the changes in this revised library data in comparison to previously used data. The data are presented as obtained as output from the program SAPNDLT. A table with half-lives of product nuclides is presented; in Appendix 2 these values have been calculated using the decay constants from this library. Surveys of thermal and fast cross sections are given for the various reactions in Appendix 3 and 4 respectively. Also a table with activities per mg mass for a fluence rate of 10 1 8 m -2 .s -1 is presented in Appendix 3 and 4 respectively. Also a table with activities per mg mass for a fluence rate of 10 1 8 m -1 is presented in Appendix 5 for various irradiation intervals. Appendix 6 gives for the various reactions the Kerma rate value. 8 refs
Non-stoichiometry in the KMo2P3O12-tunnel structure: The oxide K0.75MoNbP3O12
International Nuclear Information System (INIS)
Leclaire, A.; Borel, M.M.; Grandin, A.; Raveau, B.
1990-01-01
K 0.75 MoNbP 3 O 12 , M r =503.009, orthorhombic, Pbcm, a=8.8518 (5), b=9.1453 (11), c=12.5174 (11) A, V=1013.3 (3) A 3 , Z=4, D x =3.300 Mg m -3 , λ(Mo Kα)=0.71073 A, μ=3.13 mm -1 , F(000)=953, T=294 K, R=0.029, wR=0.033 for 1235 observed reflections. This compound is isostructural with KMo 2 P 3 O 12 -type oxides. Its framework is built up from MoO 6 octahedra and PO 4 tetrahedra which delimit tunnels running along b. Different from KMo 2 P 3 O 12 , the tunnels are partly occupied by the potassium ions which are distributed at random. (orig.)
International Nuclear Information System (INIS)
Serna M, S.; Jimenez R, M.; Solache R, M.
1999-01-01
This work was made with the purpose to extend information about the hydrolysis constants of gadolinium (III) in ion strength media 2M of NaCl, NaClO 4 , KCl at 303 K using the potentiometric method for this determination, and analysing starting from those data, the influence of anions and cations. It is concluded that the media which were determined the hydrolysis constants are very important and it is recommended the sodium perchlorate as the more adequate salt for those determinations. Also it was obtained the distribution diagrams of chemical species in each one of the media studied. (Author)
Directory of Open Access Journals (Sweden)
Phillip van der Peet
Full Text Available Leishmania spp. are a medically important group of protozoan parasites that synthesize a novel intracellular carbohydrate reserve polymer termed mannogen. Mannogen is a soluble homopolymer of β-1,2-linked mannose residues that accumulates in the major pathogenic stages in the sandfly vector and mammalian host. While several steps in mannogen biosynthesis have been defined, none of the enzymes have been isolated or characterized. We report the development of a simple assay for the GDP-mannose-dependent β-1,2-mannosyltransferases involved in mannogen synthesis. This assay utilizes octyl α-D-mannopyranoside to prime the formation of short mannogen oligomers up to 5 mannose residues. This assay was used to screen a focussed library of 44 GMP-triazole adducts for inhibitors. Several compounds provided effective inhibition of mannogen β-1,2-mannosyltransferases in a cell-free membrane preparation. This assay and inhibitor compounds will be useful for dissecting the role of different mannosyltransferases in regulating de novo biosynthesis and elongation reactions in mannogen metabolism.
Plickers: A Formative Assessment Tool for K-12 and PETE Professionals
Krause, Jennifer M.; O'Neil, Kason; Dauenhauer, Brian
2017-01-01
Classroom response systems have become popular in K-12 and higher education settings in recent years in order to gauge student learning. The physical education environment is unique in that it is difficult to manage the technology associated with these systems, and therefore, student assessment can be cumbersome. A free classroom response system…
Battling Obesity in K-12 Learners from an Exercise Physiology Perspective
Rattigan, Peter; Biren, Greg
2007-01-01
Physical education practitioners and programs have the opportunity and obligation to help children become physically educated, healthy, and active adults. This article discusses the battle against obesity in K-12 learners from an exercise physiology perspective and focuses on the fact that practitioners have all the tools they need to battle this…
Fabrication and Piezoelectric Properties of Textured (Bi1/2K1/2)TiO3 Ferroelectric Ceramics
Nagata, Hajime; Saitoh, Masahiro; Hiruma, Yuji; Takenaka, Tadashi
2010-09-01
Textured (Bi1/2K1/2)TiO3 (BKT) ceramics were prepared by a reactive templated grain growth (RTGG) method to improve their piezoelectric properties. Also, a hot-pressing (HP) method was modified on the basis of RTGG method to obtain dense ceramics and promote the grain orientation. The textured BKT ceramics prepared by the RTGG and HP methods exhibited a relatively high orientation factor F of 0.82 and a high density ratio of 95-99%. Scanning electron microscopy (SEM) micrographs of the textured HP-BKT indicated a textured and poreless microstructure. In addition, the resistivity of the textured HP-BKT was 1.73×1013 Ω·cm. The piezoelectric strain constant d33 determined by means of resonance and antiresonance method was 125 pC/N for the direction parallel to the sheet-stacking direction of the RTGG process. From the measurement of field-induced stain, the normalized d33* (=Smax/Emax) at 80 kV/cm were 127 and 238 pm/V on the randomly oriented and textured samples (F=0.82) for the (∥) direction, respectively.
Thermal reactor benchmark testing of 69 group library
International Nuclear Information System (INIS)
Liu Guisheng; Wang Yaoqing; Liu Ping; Zhang Baocheng
1994-01-01
Using a code system NSLINK, AMPX master library in WIMS 69 groups structure are made from nuclides relating to 4 newest evaluated nuclear data libraries. Some integrals of 10 thermal reactor benchmark assemblies recommended by the U.S. CSEWG are calculated using rectified PASC-1 code system and compared with foreign results, the authors results are in good agreement with others. 69 group libraries of evaluated data bases in TPFAP interface file are generated with NJOY code system. The k ∞ values of 6 cell lattice assemblies are calculated by the code CBM. The calculated results are analysed and compared
Scientific Library’s Book and Media Swap Coming April 16 | Poster
By Robin Meckley, Contributing Writer The 14th annual Book and Media Swap will be held on Wednesday, April 16, from 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549. The staff is holding the swap to coincide with National Library Week, an annual celebration of libraries that occurs in April. As of April 10, the library had collected nearly 2,000 books, DVDs, and CDs for the swap. Employees who donated these items received book cards indicating the number of items donated.
Directory of Open Access Journals (Sweden)
Hartl, Margrit
2009-12-01
Full Text Available The today’s Medical University Library was established as Faculty Library of the Vienna University Library in 1986 and serves till now as the largest Medical Library in Austria. The Main Library is located in the Vienna General Hospital (University hospitals. During 1994 and 2003 it became the Austrian Central Library for Medicine. Since 2004 University Library of the newly founded Medical University of Vienna supplies literature and information for 8500 Students, 1800 scientists and 1600 doctors. The article describes the Library’s participation on projects of the Austrian Library Consortium and the Austrian Cooperation for E-media. It specifies the offers and use of the digital library (professional databases, electronic journals, document delivery, e-books but also the website and the “Van Swieten”-Blog which are the information and communication platforms of the University Library. The next part shows the supply of traditional library which consists of the Clinical Library, the Textbook Collection and the Students Reading Room. We report also on the Library for the History of Medicine, their precious medical historical holdings and their current activities connected with the digitalization of the card index. The library’s activities to the “Medizin Curriculum Wien”, trainings and tours are told in the chapter about the Teaching Library but also the Information Retrieval Service and the activities due to training, placement and projects of librarians. Another part speaks about the special activities in international projects like “subito”, “E-books on demand” and a gateway for PDAs. The Medical University Library was the first Austrian library who used the LinkOut function of PubMed. The library works on a project of “Wiedergutmachung” (NS-Provenienzforschung and a very ambitious Weblog for the remembrance of the displaced professors at the medical faculty of the University of Vienna in 1938. The last chapter
Directory of Open Access Journals (Sweden)
Daniel P Riggins
Full Text Available Escherichia coli and other enteric bacteria survive exposure to extreme acid (pH 2 or lower in gastric fluid. Aerated cultures survive via regulons expressing glutamate decarboxylase (Gad, activated by RpoS, cyclopropane fatty acid synthase (Cfa and others. But extreme-acid survival is rarely tested under low oxygen, a condition found in the stomach and the intestinal tract. We observed survival of E. coli K-12 W3110 at pH 1.2-pH 2.0, conducting all manipulations (overnight culture at pH 5.5, extreme-acid exposure, dilution and plating in a glove box excluding oxygen (10% H2, 5% CO2, balance N2. With dissolved O2 concentrations maintained below 6 µM, survival at pH 2 required Cfa but did not require GadC, RpoS, or hydrogenases. Extreme-acid survival in broth (containing tryptone and yeast extract was diminished in media that had been autoclaved compared to media that had been filtered. The effect of autoclaved media on extreme-acid survival was most pronounced when oxygen was excluded. Exposure to H2O2 during extreme-acid treatment increased the death rate slightly for W3110 and to a greater extent for the rpoS deletion strain. Survival at pH 2 was increased in strains lacking the anaerobic regulator fnr. During anaerobic growth at pH 5.5, strains deleted for fnr showed enhanced transcription of acid-survival genes gadB, cfa, and hdeA, as well as catalase (katE. We show that E. coli cultured under oxygen exclusion (<6 µM O2 requires mechanisms different from those of aerated cultures. Extreme acid survival is more sensitive to autoclave products under oxygen exclusion.
K-12 Schools: The Effect of Public School Choices on Marine Families’ Co-Location Decisions
2017-03-01
3. REPORT TYPE AND DATES COVERED Master’s thesis 4. TITLE AND SUBTITLE K-12 SCHOOLS: THE EFFECT OF PUBLIC SCHOOL CHOICES ON MARINE FAMILIES’ CO...be educated ? One theory regarding decision-making in general is the rational choice theory . This approach to explaining the process of making...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release. Distribution is unlimited. K-12 SCHOOLS
Synthesis, crystal structure and characterizations of a new red phosphor K{sub 3}EuB{sub 6}O{sub 12}
Energy Technology Data Exchange (ETDEWEB)
Zhao, Dan, E-mail: iamzd1996@163.com [College of Chemistry and Chemical Engineering, Henan Polytechnic University, Jiaozuo, Henan, 454000 (China); State Key Laboratory of Structural Chemistry, Fuzhou, Fujian, 350002 (China); Ma, Fa-Xue; Wu, Zhi-Qiang; Zhang, Lei [College of Chemistry and Chemical Engineering, Henan Polytechnic University, Jiaozuo, Henan, 454000 (China); Wei, Wei, E-mail: wwei@cnu.edu.cn [Department of Chemistry, Capital Normal University, Beijing, 100048 (China); Yang, Juan; Zhang, Rong-Hua; Chen, Peng-Fei; Wu, Shan-Xuan [College of Chemistry and Chemical Engineering, Henan Polytechnic University, Jiaozuo, Henan, 454000 (China)
2016-10-01
A new potassium europium borate K{sub 3}EuB{sub 6}O{sub 12} has been prepared using a high temperature molten salt method and structurally characterized by single crystal X-ray diffraction (SC-XRD) analyses. Its structure features a three-dimensional (3D) framework composed of isolated [B{sub 5}O{sub 10}]{sup 5−} anions that are bridged by K{sup +} and Eu{sup 3+} ions. In this structure, one crystallographic distinct atom site is mixed occupied by K/Eu at a molar ratio of 1:1. The self-activated photoluminescence (PL) of K{sub 3}EuB{sub 6}O{sub 12} was studied. The excitation spectrum covers a wide range from 322 to 466 nm, which suggests that the K{sub 3}EuB{sub 6}O{sub 12} phosphors can be effectively excited by a near-UV light source. The emission spectrum consists of groups of lines in the red spectral region due to the {sup 5}D{sub 0}→{sup 7}F{sub j} (j = 1, 2, 3, 4) electronic transitions of Eu{sup 3+} ions, with the most intense line at 611 nm. We may expect that K{sub 3}EuB{sub 6}O{sub 12} has the potential to be a red phosphor pumped by near-UV LED chips. - Highlights: • A new red phosphor K{sub 3}EuB{sub 6}O{sub 12} was prepared. • The crystal structure of K{sub 3}EuB{sub 6}O{sub 12} was determined for the first time. • The photoluminescence properties of K{sub 3}EuB{sub 6}O{sub 12} are studied. • K{sub 3}EuB{sub 6}O{sub 12} show intense self-activated red emission under near-UV light excitation.
Moeller, Babette
2010-01-01
The goal of the User-Centered Digital Library Project, conducted by the National Center for Accessible Media (NCAM) at WGBH, was to adapt the Teachers' Domain online digital library to enable teachers and students with disabilities to more readily use the resources in science classrooms. NCAM added accessibility features such as captions and audio…
Hammond, David; Wakefield, Melanie; Durkin, Sarah; Brennan, Emily
2013-04-01
Communicating the health risks of smoking remains a primary objective of tobacco-control policy. Articles 11 and 12 of the World Health Organization's Framework Convention on Tobacco Control establish standards for two important forms of communication: packaging regulations (Article 11), and mass media campaigns (Article 12). A narrative review approach was used to identify existing evidence in the areas of package labeling regulations (including health warnings, constituent and emission messages, and prohibitions on misleading information) and communication activities (including mass media campaigns and news media coverage). When available, recent reviews of the literature were used, updated with more recent high-quality studies from published literature. Implementation of Articles 11 and 12 share several important research priorities: (a) identify existing consumer information needs and gaps, (b) research on the message source to identify effective types of content for health warnings and media campaigns, (c) research on how messages are processed and the extent to which the content and form of messages need to be tailored to different cultural and geographic groups, as well as subgroups within countries, and (d) research to identify the most cost-effective mix and best practices for sustaining health communications over time. A unifying theme of effective health communication through tobacco packaging and mass media campaigns is the need to provide salient, timely, and engaging reminders of the consequences of tobacco use in ways that motivate and support tobacco users trying to quit and make tobacco use less appealing for those at risk of taking it up.
Energy Technology Data Exchange (ETDEWEB)
Ribeiro, Ana C.F., E-mail: anacfrib@ci.uc.p [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal); Gomes, Joselaine C.S., E-mail: leidygomes18@hotmail.co [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal); Barros, Marisa C.F., E-mail: marisa.barros@gmail.co [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal); Lobo, Victor M.M., E-mail: vlobo@ci.uc.p [Department of Chemistry, University of Coimbra, 3004-535 Coimbra (Portugal); Esteso, Miguel A., E-mail: miguel.esteso@uah.e [Departamento de Quimica Fisica, Facultad de Farmacia, Universidad de Alcala, 28871, Alcala de Henares (Madrid) (Spain)
2011-03-15
Binary mutual diffusion coefficients (interdiffusion coefficients) of nickel chloride in water at T = 298.15 K and T = 310.15 K, and at concentrations between (0.000 and 0.100) mol {center_dot} dm{sup -3}, using a Taylor dispersion method have been measured. These data are discussed on the basis of the Onsager-Fuoss and Pikal models. The equivalent conductance at infinitesimal concentration of the nickel ion in these solutions at T = 310.15 K has been estimated using these results. Through the same technique, ternary mutual diffusion coefficients (D{sub 11}, D{sub 22}, D{sub 12}, and D{sub 21}) for aqueous solutions containing NiCl{sub 2} and lactose, at T = 298.15 K and T = 310.15 K, and at different carrier concentrations were also measured. These data permit us to have a better understanding of the structure of these systems and the thermodynamic behaviour of NiCl{sub 2} in different media.
4-thiouridine and photoprotection in Escherichia coli K12
International Nuclear Information System (INIS)
Thomas, Gilles; Favre, Alain
1977-01-01
A high level of protection is observed in the Escherichia coli K 12 strain AB 1157 rec A 1 nuv + whose transfer RNA contains 4-thiouridine. In contrast, the photoprotection level is low and observed at higher doses in a strain which differs from the former by a single mutation nuv - , (lack of 4-thiouridine). This nucleoside is therefore an important chromophore leading to photoprotection. This conclusion is corroborated by the similarity of the action spectra for 8-13 link formation in tRNA and for photoprotection [fr
Solubility of La, Pr, Eu, Er and Lu in a media of 1M ionic force of NaCl by 303 K
International Nuclear Information System (INIS)
Ramirez G, J.J.; Solache R, M.J.; Jimenez R, M.; Rojas H, A.
2002-01-01
The solubility and the solubility product of La, Pr, Eu, Er and Lu in media of 1M ionic force of NaCl by 303 K was determined, by means of a radiochemical method and the pLn - pCH diagrams in free conditions of CO 2 were constructed. Moreover, the non saturation and the saturated zones and with them the pCH precipitation bound were determined. Finally a comparison among the obtained data in this work and those reported in the literature in several media was realized. (Author)
THE USE OF INFORMATION RESOURCES OF THE KNUKIM SCIENTIFIC LIBRARY FOR INFORMATION SERVICES PROVIDING
Directory of Open Access Journals (Sweden)
В. В. Степко
2017-10-01
Full Text Available The article highlights information resources of the scientific library of the Kiev National University of Culture and Arts and characterizes its use in the system of providing librarian and informational services for users. It is proved that the important information resource of the library is website, which provides additional opportunities for users, forming a positive image of the library in the virtual space. The site contains information on various directions of the library’s activities, librarian services, projects and media products. One of the main tasks of the library is formation and presentation on the website of the electronic catalog as a multifunctional bibliographic resource, which is the basis for informational services and the basic information product of the library. The creation of an electronic library continues as the essential element of providing qualitative and effective services to users. The article discusses the functioning of the “Virtual Help” service as an effective form of working with remote users. The authors also consider such an actual direction of the library’s activity as the presentation of the scientific and creative heritage of the university with help of “12 + books of the year” project. The aim of the project is to inform about new editions of university’s teachers published this year and presented in the library fund. The implementation of the patriotic innovation and educational project “Treasures of the Nation”, whose purpose is to study and popularize the elements of the intangible cultural heritage ofUkraine, is analyzed. The booktrails and flash presentations are considered as a means of presenting books prepared by the library staff. The preparation of longreed, a new format for submitting information on the Internet, is also considered. Thanks to the use of Tilda Publishing and ThingLink services, innovative products were created: a complex multimedia story that combined photos
Outstanding Science Trade Books for Students K-12: Books Published in 2015
Science and Children, 2016
2016-01-01
Science teachers and mentors continue to be challenged to meet the high expectations of "A Framework for K-12 Science Education" and the "Next Generation Science Standards" ("NGSS"). Indeed the "Framework" urges to help learners "[build] progressively more sophisticated explanations of natural…
About the Library - Betty Petersen Memorial Library
branch library of the NOAA Central Library. The library serves the NOAA Science Center in Camp Springs , Maryland. History and Mission: Betty Petersen Memorial Library began as a reading room in the NOAA Science Science Center staff and advises the library on all aspects of the library program. Library Newsletters
DEFF Research Database (Denmark)
Ørnager, Susanne; Lund, Haakon
This book focuses on methodologies, organization and communication of digital image collection research that utilize social media content. (“Image” is here understood as cultural, conventional and commercial - stock photos - representations.) The lecture offer expert views that provide different...... fake news, image manipulation, mobile photos etc. these issues are very complex and need a publication of their own. This book should primarily be useful for students in library and information science, psychology, and computer science....
Identity of a brand new library
Vijayakumar, J.K.
2017-03-16
King Abdullah University of Science and Technology (KAUST) Library in Saudi Arabia aspires to be one of the great new-generation libraries in the field of scientific research. Its services and systems support a digitally born collection, 97% of their collection is electronic. The spectacular library facility with lots of space for collaboration and its collections remains open twenty-four hours, every day of the year and is facilitated by a staff coming from 12 different nationalities. It has an Open Access mandate, the first in the Middle East region, and runs a successful digital research repository.
GIS in the K-12 Classroom: Research Agenda from EDGIS '96
National Center for Geographic Information and Analysis; National Council for Geographic Education (NCGE); Technical Education Research Centers (TERC)
1996-01-01
This meeting of education researchers and teachers immediately followed the November 1996 Annual Meeting of the National Council for Geographic Education (NCGE) in Santa Barbara, California. Participants explored the issues facing the use of Geographic Information Systems (GIS) in the K-12 classroom and developed a research agenda related to Pedagogy Issues, Curriculum Issues, Software Issues, and Cognitive Issues.
How Do K-12 Students' Manage Applications on Their Mobile Devices?
Aladjem, Ruthi; Hardof, Sharon
2016-01-01
Personal information management (PIM) is a research field that examines the activities by which users save, organize and retrieve personal information items. PIM is a one of the essential new literacies for learners in the 21st century. This paper reports results from a pilot study that explored PIM practices and strategies of K-12 students, on…
One-to-One Technology in K-12 Classrooms: A Review of the Literature from 2004 through 2014
Harper, Ben; Milman, Natalie B.
2016-01-01
This literature review examined empirical research conducted between 2004 and 2014 regarding 1:1 technologies in K-12 educational settings. Our overarching research question was: What does research tell us about 1:1 technology in K-12 classrooms? We used the constant-comparative method to analyze, code, and induce themes from 46 relevant articles.…
Bickham, Grandin; Saile, Lynn; Havelka, Jacque; Fitts, Mary
2011-01-01
Introduction: Johnson Space Center (JSC) offers two extensive libraries that contain journals, research literature and electronic resources. Searching capabilities are available to those individuals residing onsite or through a librarian s search. Many individuals have rich collections of references, but no mechanisms to share reference libraries across researchers, projects, or directorates exist. Likewise, information regarding which references are provided to which individuals is not available, resulting in duplicate requests, redundant labor costs and associated copying fees. In addition, this tends to limit collaboration between colleagues and promotes the establishment of individual, unshared silos of information The Integrated Medical Model (IMM) team has utilized a centralized reference management tool during the development, test, and operational phases of this project. The Enterprise Reference Library project expands the capabilities developed for IMM to address the above issues and enhance collaboration across JSC. Method: After significant market analysis for a multi-user reference management tool, no available commercial tool was found to meet this need, so a software program was built around a commercial tool, Reference Manager 12 by The Thomson Corporation. A use case approach guided the requirements development phase. The premise of the design is that individuals use their own reference management software and export to SharePoint when their library is incorporated into the Enterprise Reference Library. This results in a searchable user-specific library application. An accompanying share folder will warehouse the electronic full-text articles, which allows the global user community to access full -text articles. Discussion: An enterprise reference library solution can provide a multidisciplinary collection of full text articles. This approach improves efficiency in obtaining and storing reference material while greatly reducing labor, purchasing and
Communications and Media: Grade 7. Cluster II.
Calhoun, Olivia H.
A curriculum guide for grade 7, the document is devoted to the occupational cluster "Communications and Media." It is divided into six units: advertising, film and photography, radio and television, journalism and publishing, library and periodicals, and transocean communications. Each unit is introduced by a statement of the topic, the…
Kobayashi, Yukio
2011-01-01
The pictorial proof of the sum of [superscript n][subscript k=1] k[superscript 2] = 1/6n(n+1)(2n+1) is represented in the form of an integral. The integral representations are also applicable to the sum of [superscript n][subscript k-1] k[superscript m] (m greater than or equal to 3). These representations reveal that the sum of [superscript…
Miki, Takeyoshi; Yamamoto, Yoshihiro; Matsuda, Hideo
2008-01-01
We developed a novel, simple, high-throughput method for isolation of genome-wide transposon insertion mutants of Escherichia coli K-12. The basic idea of the method is to randomly disrupt the genes on the DNA fragments cloned on the Kohara library by inserting a mini-transposon first, and then transfer the disrupted genes from the lambda vector to the E. coli chromosome by homologous recombination. Using this method, we constructed a set of 8402 Km(r) cis-diploid mutants harboring a mini-Tn10 insertion mutation and the corresponding wild-type gene on a chromosome, as well as a set of 6954 haploid mutants derived from the cis-diploid mutants. The major advantage of the strategy used is that the indispensable genes or sites for growth can be identified. Preliminary results suggest that 415 open reading frames are indispensable for growth in E. coli cells. A total of 6404 haploid mutants were deposited to Genetic Strains Research Center, National Institute of Genetics, Japan (Chapter 26) and are available for public distribution upon request (http://shigen.lab.nig.ac.jp/ecoli/strain/nbrp/resource.jsp).
Halkides, D. J.; Larour, E. Y.; Perez, G.; Petrie, K.; Nguyen, L.
2013-12-01
Statistics indicate that most Americans learn what they will know about science within the confines of our public K-12 education system and the media. Next Generation Science Standards (NGSS) aim to remedy science illiteracy and provide guidelines to exceed the Common Core State Standards that most U.S. state governments have adopted, by integrating disciplinary cores with crosscutting ideas and real life practices. In this vein, we present a prototype ';Virtual Ice Sheet Laboratory' (I-Lab), geared to K-12 students, educators and interested members of the general public. I-Lab will allow users to perform experiments using a state-of-the-art dynamical ice sheet model and provide detailed downloadable lesson plans, which incorporate this model and are consistent with NGSS Physical Science criteria for different grade bands (K-2, 3-5, 6-8, and 9-12). The ultimate goal of this website is to improve public climate science literacy, especially in regards to the crucial role of the polar ice sheets in Earth's climate and sea level. The model used will be the Ice Sheet System Model (ISSM), an ice flow model developed at NASA's Jet Propulsion Laboratory and UC Irvine, that simulates the near-term evolution of polar ice sheets (Greenland and Antarctica) and includes high spatial resolution capabilities and data assimilation to produce realistic simulations of ice sheet dynamics at the continental scale. Open sourced since 2011, ISSM is used in cutting edge cryosphere research around the globe. Thru I-Lab, students will be able to access ISSM using a simple, online graphical interface that can be launched from a web browser on a computer, tablet or smart phone. The interface will allow users to select different climate conditions and watch how the polar ice sheets evolve in time under those conditions. Lesson contents will include links to background material and activities that teach observation recording, concept articulation, hypothesis formulation and testing, and
Elastic and inelastic scattering of 800 MeV/c K+- mesons from 12C and 40Ca
International Nuclear Information System (INIS)
Marlow, D.R.
1981-04-01
Methods and results of an experiment to study the scattering of 800 MeV/c K +- mesons from 12 C and 40 Ca are presented. The reactions under study include: the four elastic scattering reactions 12 C(K +- ,K +- ) and 40 Ca(K +- ,K +- ), and the four inelastic scattering reactions, 12 C(K +- .K +- ') to the J/sup P/ = 2 + 4.43 MeV and J/sup P/ = 3 - states. The experimental data were obtained using the Hyper-Nuclear Spectrometer and the Low Energy Separated Beam (LESB I) at the Alternating Gradient Synchrotron (AGS) of Brookhaven Laboratory (BNL). Calculations using the program PIRK, an optical potential code, are compared to the elastic data. The results of a second set of calculations, using Glauber theory are also presented. Both sets of calculations use as input: the results of partial wave analyses of kaon nucleon scattering data, and nuclear shapes as determined from the results of electron nucleus scattering experiments. The agreement between the experimental data and the theoretical predictions is reasonable over the angular range of the data, with the exception of Glauber calculations of the K + elastic scattering. In those cases, the eikonal approximation proves to be a poor approximation. Smaller discrepancies are found in some other cases, indicating the possible need for more sophisticated calculations
UFMGLIB: a multigroup library for the WIMS code
International Nuclear Information System (INIS)
Aboustta, Mohamed A.; Mello, Jair Carlos
1995-01-01
The British code WIMS is distributed by the NEA in its D4 version. It has a proper data library (Standard Library) in 69 energy groups covering, in its 1981 version, more than 100 materials with sufficient details. The Standard library was generated, basically, from the UKNDL data files and has been submitted to many alterations since the 1960's. Completely new versions such as the WIMKAL 88, generated from the basic library ENDF/B-V, were introduced and are available from the IAEA. The library UFMGLIB was generated from the ENDF/B-VI basic data library with some of the Standard data being maintained. The library contains evaluations for 131 different materials including the most common in thermal reactors. Results obtained from running the WIMS-D4 code with this library compare very well with results from the other libraries when running benchmark cases. This paper shows a general description of the library and some of the steps taken to generate it. (author). 12 refs, 2 tabs
America's Star Libraries, 2010: Top-Rated Libraries
Lyons, Ray; Lance, Keith Curry
2010-01-01
The "LJ" Index of Public Library Service 2010, "Library Journal"'s national rating of public libraries, identifies 258 "star" libraries. Created by Ray Lyons and Keith Curry Lance, and based on 2008 data from the IMLS, it rates 7,407 public libraries. The top libraries in each group get five, four, or three stars. All included libraries, stars or…
The Access Gap: Poverty and Characteristics of School Library Media Centers
Pribesh, Shana; Gavigan, Karen; Dickinson, Gail
2011-01-01
Stephen Krashen believes that schools can counter the effects of poverty in at least one area: access to books. However, little research has been done to determine whether students living in poverty have access to school library services comparable to those attending schools with low concentrations of students living in poverty. We examined the…
Directory of Open Access Journals (Sweden)
Yutaka Kurebayashi
2012-04-01
Full Text Available The PI3K-Akt-mTORC1 axis contributes to the activation, survival, and proliferation of CD4+ T cells upon stimulation through TCR and CD28. Here, we demonstrate that the suppression of this axis by deletion of p85α or PI3K/mTORC1 inhibitors as well as T cell-specific deletion of raptor, an essential component of mTORC1, impairs Th17 differentiation in vitro and in vivo in a S6K1/2-dependent fashion. Inhibition of PI3K-Akt-mTORC1-S6K1 axis impairs the downregulation of Gfi1, a negative regulator of Th17 differentiation. Furthermore, we demonstrate that S6K2, a nuclear counterpart of S6K1, is induced by the PI3K-Akt-mTORC1 axis, binds RORγ, and carries RORγ to the nucleus. These results point toward a pivotal role of PI3K-Akt-mTORC1-S6K1/2 axis in Th17 differentiation.
Featured Library: Parrish Library
Kirkwood, Hal P, Jr
2015-01-01
The Roland G. Parrish Library of Management & Economics is located within the Krannert School of Management at Purdue University. Between 2005 - 2007 work was completed on a white paper that focused on a student-centered vision for the Management & Economics Library. The next step was a massive collection reduction and a re-envisioning of both the services and space of the library. Thus began a 3 phase renovation from a 2 floor standard, collection-focused library into a single floor, 18,000s...
Path representation of su-hat (2){sub k} states I: Operators and particles for k=1,2
Energy Technology Data Exchange (ETDEWEB)
Lamy-Poirier, Joel, E-mail: jlamypoirier@perimeterinstitute.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada); Mathieu, Pierre, E-mail: pmathieu@phy.ulaval.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada)
2011-04-11
This is the first of two articles devoted to the analysis of the path description of the states in su-hat (2){sub k} WZW models, a representation well suited for constructive derivations of the fermionic characters. In this first article, the cases k=1,2 are treated in detail, emphasizing a different description in each case (operators vs particles). For k=1, we first prove, as a side result, the equivalence of two known path representations for the finitized su-hat (2){sub 1} states by displaying an explicit bijection. An immediate offshoot is the gain of a new and simple weighting for the (Kyoto) path representation that generalizes to level k. The bijection also suggests two operator constructions for the su-hat (2){sub 1} paths, a local and a nonlocal one, both interrelated. These are formal operators that map a path to another path, so that any path can be obtained by successive applications of these operators on a simple reference (ground-state) path. The nonlocal operator description is the starting point for a direct and elementary derivation of the su-hat (2){sub 1} spinon character. The second part presents an extensive study of the su-hat (2){sub 2} paths from their particle point of view, where the particles are defined as the path building blocks. The resulting generating functions appear to provide new (at least superficially) fermionic forms of the characters. In particular, a nice relationship between the sum of the j=0,1 characters at k=2 and the two ones at k=1 is unraveled.
K-12 educational outcomes of immigrant youth.
Crosnoe, Robert; Turley, Ruth N López
2011-01-01
The children from immigrant families in the United States make up a historically diverse population, and they are demonstrating just as much diversity in their experiences in the K-12 educational system. Robert Crosnoe and Ruth López Turley summarize these K-12 patterns, paying special attention to differences in academic functioning across segments of the immigrant population defined by generational status, race and ethnicity, and national origin. A good deal of evidence points to an immigrant advantage in multiple indicators of academic progress, meaning that many youths from immigrant families outperform their peers in school. This apparent advantage is often referred to as the immigrant paradox, in that it occurs despite higher-than-average rates of social and economic disadvantages in this population as a whole. The immigrant paradox, however, is more pronounced among the children of Asian and African immigrants than other groups, and it is stronger for boys than for girls. Furthermore, evidence for the paradox is far more consistent in secondary school than in elementary school. Indeed, school readiness appears to be one area of potential risk for children from immigrant families, especially those of Mexican origin. For many groups, including those from Latin America, any evidence of the immigrant paradox usually emerges after researchers control for family socioeconomic circumstances and youths' English language skills. For others, including those from Asian countries, it is at least partially explained by the tendency for more socioeconomically advantaged residents of those regions to leave their home country for the United States. Bilingualism and strong family ties help to explain immigrant advantages in schooling; school, community, and other contextual disadvantages may suppress these advantages or lead to immigrant risks. Crosnoe and Turley also discuss several policy efforts targeting young people from immigrant families, especially those of Latin
Small atomic displacements in the molybdenophosphates AMo2P3O12 (A = K, Rb, Tl)
International Nuclear Information System (INIS)
Leclaire, A.; Raveau, B.
1988-01-01
KMo 2 P 3 O 12 , M r = 515.90, orthorhombic, Pbnm, a = 17.6398(14), b = 9.1761(4), c = 12.3000(8) A, V = 1990.9(4) A 3 , Z=8, D x = 3.44 Mg m -3 , λ(Mo Kα) = 0.71069 A, μ = 3.42 mm -1 , F(000) = 1952. T = 294 K, R = 0.028 for 2123 reflections. RbMo 2 P 3 O 12 , M r = 562.26, orthorhombic, Pbcm, a = 8.8314(8), b = 9.2368(7), c = 12.3051(9) A, V = 1003.8(4) A 3 , Z=4, D x = 3.72 Mg m -3 , λ(Mo Kα) = 0.71069 A, μ = 8.08 mm -1 , F(000) = 1048, T = 294 K, R = 0.044 for 2073 reflections. The Mo 2 P 3 O 12 frameworks of the K, Rb and Tl compounds are almost the same. The main difference is in the position of the alkaline-earth ions in the tunnels, which induces, in the potassium compound, a superstructure along a. The alkaline-earth ions are slightly displaced as their size decreases in order that the A-O distances may agree with the sum of the ionic radii. (orig.)
MCNP and MATXS cross section libraries based on JENDL-3.3
International Nuclear Information System (INIS)
Kosako, Kazuaki; Konno, Chikara; Fukahori, Tokio; Shibata, Keiichi
2003-01-01
The continuous energy cross section library for the Monte Carlo transport code MCNP-4C, FSXLIB-J33, has been generated from the latest version of JENDL-3.3. The multigroup cross section library with the MATXS format, MATXS-J33, has been generated also from JENDL-3.3. Both libraries contain all nuclides in JENDL-3.3 and are processed at 300 K by the nuclear data processing system NJOY99. (author)
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys
School Library Policy and Legal Opinions of Texas Public School Principals and Certified Librarians
Andrew Shupala
2006-01-01
This study involved a survey of the attitudes of Texas public school principals and certified librarians, perceptions andexperiences with regard to school library policy for media selection, and procedures for responding to complaints againstlibrary media. Analysis of the data included a methodology of mixed-methods explanatory design. Selection of the principalsand certified librarians was proportionate and stratified according to the state's 20 Education Service Centerregions. Of the 1,036 ...
Antibiotics for acute otitis media in children
Venekamp, Roderick P.; Sanders, Sharon L.; Glasziou, Paul P.; Del Mar, Chris B.; Rovers, Maroeska M.
2015-01-01
BACKGROUND: Acute otitis media (AOM) is one of the most common diseases in early infancy and childhood. Antibiotic use for AOM varies from 56% in the Netherlands to 95% in the USA, Canada and Australia. This is an update of a Cochrane review first published in The Cochrane Library in Issue 1, 1997
Leading Effective Educational Technology in K-12 School Districts: A Grounded Theory
Hill, Lara Gillian C.
2011-01-01
A systematic grounded theory qualitative study was conducted investigating the process of effectively leading educational technology in New Jersey public K-12 school districts. Data were collected from educational technology district leaders (whether formal or non-formal administrators) and central administrators through a semi-structured online…
Multigroup cross section library; WIMS library
International Nuclear Information System (INIS)
Kannan, Umasankari
2000-01-01
The WIMS library has been extensively used in thermal reactor calculations. This multigroup constants library was originally developed from the UKNDL in the late 60's and has been updated in 1986. This library has been distributed with the WIMS-D code by NEA data bank. The references to WIMS library in literature are the 'old' which is the original as developed by the AEA Winfrith and the 'new' which is the current 1986 WIMS library. IAEA has organised a CRP where a new and fully updated WIMS library will soon be available. This paper gives an overview of the definitions of the group constants that go into any basic nuclear data library used for reactor calculations. This paper also outlines the contents of the WIMS library and some of its shortcomings
Hillman, Susan J.; Bloodsworth, Kylie H.; Tilburg, Charles E.; Zeeman, Stephan I.; List, Henrietta E.
2014-01-01
This study was launched from a National Science Foundation GK-12 grant in which graduate fellows in Science, Technology, Engineering, and Mathematics (STEM) are placed in classrooms to engage K-12 students in STEM activities. The investigation explored whether the STEM Fellows' presence impacted the K-12 students' stereotypical image of a…
Portals to the past and to the future libraries in Germany
Seefeldt, Jürgen
2011-01-01
The dawning of the digital age has raised the question of the role libraries can expect to play in the future. Are they educational and cultural institutions – or service centers? With the help of their varied media collections, their technological infrastructure and their expertise in information management, libraries will assuredly rise to meet the challenges of this balancing act. This third revised and updated English edition of “Portals to the Past and to the Future” by Jürgen Seefeldt and Ludger Syré is a precise state-of-the art report on current German librarianship. Lavishly illustrated, the book uses selected examples to show the outstanding results nationwide cooperation has achieved whilst at the same time portraying the history and the different types of German libraries. The reader will gain a revealing insight into both the cultural and educational policy underlying German library structure and the organization of professional training in librarianship. This book has been translated n...
The state of social media policies in higher education.
Pomerantz, Jeffrey; Hank, Carolyn; Sugimoto, Cassidy R
2015-01-01
This paper presents an analysis of the current state of development of social media policies at institution of higher education. Content analysis of social media policies for all institutions listed in the Carnegie Classification Data File revealed that less than one-quarter of institutions had an accessible social media policy. Analysis was done by institution and campus unit, finding that social media policies were most likely to appear at doctorate-granting institutions and health, athletics, and library units. Policies required that those affiliated with the institution post appropriate content, represent the unit appropriately, and moderate conversations with coworkers and external agencies. This analysis may inform the development and revision of social media policies across the field of higher education, taking into consideration the rapidly changing landscape of social media, issues of academic freedom, and notions of interoperability with policies at the unit and campus levels.
Evaluation of WIMS-D/4 nuclear data library used on TRIGA reactor calculation
International Nuclear Information System (INIS)
Chen Wei; Xie Zhongsheng; Jiang Xinbiao; Chen Da
1997-01-01
The 69 groups constants of H in ZrH, 166 Er and 167 Er generated by NJOY and GASKET codes are inserted into WIMS nuclear data library WIMS-CNDC and WIMS-NINT libraries used on RTIGA reactor calculation are obtained. In order to check WIMS-CNDC and WIMS-NINT libraries, the scattering cross-section is compared with that in WIMS-IJS library. The group constant, K ∞ and temperature coefficient are calculated by using WIMS-CNDC, WIMS-NINT and WIMS-IJS. The results show the both libraries are suitable for calculation of TRIGA reactor
The landscape of PreK-12 engineering online resources for teachers: global trends
Bagiati, Aikaterini; Evangelou, Demetra; Magana, Alejandra; Kaloustian, Garene; Zhu, Jiabin; Yoon, So Yoon
2014-01-01
Background: The newly formed discipline of engineering education is addressing the need to (a) enhance STEM education for precollege students and (b) identify optimum ways to introduce engineering content starting, perhaps, from the early ages. Introducing engineering at the Prekindergarten through 12th grade (PreK-12) education level requires significant changes in teacher preparation and support. It highlights the need for developing developmentally appropriate content knowledge and ped...
The socio-technical design of a library and information science collaboratory
DEFF Research Database (Denmark)
Lassi, Monica; Sonnenwald, Diane H.
2013-01-01
Introduction. We present a prototype collaboratory, a socio-technical platform to support sharing research data collection instruments in library and information science. No previous collaboratory has attempted to facilitate sharing digital research data collection instruments among library...... and information science researchers. Method. We have taken a socio-technical approach to design, which includes a review of previous research on collaboratories; an empirical study of specific needs of library and information science researchers; and a use case design method to design the prototype collaboratory....... Scenarios of future interactions, use cases, were developed using an analytically-driven approach to scenario design. The use cases guided the implementation of the prototype collaboratory in the MediaWiki software package. Results. The prototype collaboratory design is presented as seven use cases, which...
Empowered Intersectionality among Black Female K-12 Leaders: A Transcendental Phenomenological Study
McNeal, Carla
2017-01-01
Black female school leaders remain underrepresented as educational leaders in the K-12 context as marginalizing factors persist in the field. The purpose of this transcendental phenomenological study was to explore the lived experiences of Black female school leaders through the lens of intersectionality. For this research study, intersectionality…
The development of children's language and ethical media competences and media skills
Valli, Raine; Hautaviita, Janika; Meriläinen, Merja
2015-01-01
The children's developing media competences and media skills are evaluated in this article on the basis of the evaluation indicator developed by Hautaviita (2012). The indicator has been developed for measuring the 6–9-year-old children's (the preschoolers and the pupils in grades 1-2) media competences. In it, the children's developing media skills are divided into practical, social, language and ethical media competences, of which this article concentrates on the last two, language and ethi...
ZZ FENDL-2, Evaluated Nuclear Data Library for Fusion Neutronics Applications
International Nuclear Information System (INIS)
2005-01-01
Description: FENDL: Fusion Evaluated Nuclear Data Library. Materials/nuclides: H 1 , H 2 , H 3 , He 3 , He 4 , Li 6 , Li 7 , Be 9 , B 10 , B 11 , C 12 , N 14 , N 15 , O 16 , F 19 , Na 23 , Mg nat , Al 27 , Si 28 , Si 29 , Si 30 , P 31 , S nat , Cl 35 , Cl 37 , K nat , Ca nat , Ti 46 , Ti 47 , Ti 48 , Ti 49 , Ti 50 , V nat , Cr 50 , Cr 52 , Cr 53 , Cr 54 , Mn 55 , Fe 54 , Fe 56 , Fe 57 , Fe 58 , Co 59 , Ni 58 , Ni 60 , Ni 61 , Ni 62 , Ni 64 , Cu 63 , Cu 65 , Ga nat , Zr nat , Nb 93 , Mo 92 , Mo 94 , Mo 95 , Mo 96 , Mo 97 , Mo 98 , Mo 100 , Sn nat , Ta 181 , W 182 , W 183 , W 184 , W 186 , Au 197 , Pb 206 , Pb 207 , Pb 208 , Bi 209 . Photo-atomic data. IAEA1364/02: FENDL version 2.0 consists of the following sub-libraries: - ACTIVATION (FENDL/A-2.0)- neutron activation cross sections for 13006 reactions on 739 targets ranging from 1-H up to 248-Cm at incident energies up to 20 MeV. Pointwise and processed data in different formats are included. Plots are available. - DECAY (FENDL/D-2.0) - decay properties (decay type, decay energy, and half life) for 1867 nuclides and isomers. FENDL/D-2.0 sub-library is complementary to the activation sub-library. Pointwise and processed data are included. - DOSIMETRY (FENDL/DS-2.0) - neutron cross sections to be used for reactor neutron dosimetry by foil activation, radiation damage cross-sections, and benchmark neutron spectra. This sub-library is identical to the International Reactor Dosimetry File (IRDF-90). Pointwise and processed data are included. - FUSION (FENDL/C-2.0) - charged-particle cross sections for the following fusion reactions: 1-H 2 (d,n)2-He 3 , 1-H 2 (d,p)1-H 3 , 2-He 3 (d,p)2-He 4 , 1-H-3(t,2n)2-He 4 , and 1-H 3 (d,n)2-He 4 . Pointwise and processed data are included. - TRANSPORT - validated basic nuclear data (neutron-nucleus interaction including photon production, and photon-atom interaction cross sections) for 57 nuclides relevant for fusion. In addition to the pointwise data (FENDL/E-2.0), the sub-library
Directory of Open Access Journals (Sweden)
João Arlindo dos Santos Neto
2017-04-01
Full Text Available Presents a research on university libraries and forms of information mediation through web tools, especially social medias. As goal, identify and analyze the mediation of information on Facebook. As for the methodological procedures, the article is exploratory and initially uses a brief bibliographic review of the terms university library, social medias and mediation of information and, later, analyzes a collection of data from the method of documentary research. It uses as technique for data collection the observation and as analysis of the data the Content Analysis. As results, it shows the number and names of the accounts located in the social media, the characteristics of them (type of profile, number of friends or likes, number of posts made by each account and their periodicity, the content of the posts distributed in 15 themed categories, the interaction between the libraries accounts and their interlocutors, from the likings, comments and shares. It considers that the use of social medias by the units of information researched is still small, since only 31% of them use Facebook as a way to mediate the information and to interact with its public. It concludes that the number of friends in the profile, likes on the page or number of posts do not guarantee a good interlocution between the account and the users, since the moment that the users are online on the network interferes more than the other elements pointed out.
Lu, X.; Chen, S.; Zhang, Y.; Huang, Z.; Ma, Z.; Yao, Z.
2017-06-01
A 400 kV 80 mA Cockcroft-Walton power supply driven by 2.5 kHz frequency, and 12 kW isolation transformer systems are developed for an intense DD/DT neutron generator. The design, construction, and testing of the high voltage (HV) power supply and isolation transformer systems are detailed reported. The structure of step-up transformers can make the potential distribution uniform, and auxiliary coils of the isolation transformers can improve the power transmission efficiency significantly. The testing results show that the HV power supply can reach 400 kV, and the isolation transformer systems can withstand 400 kV voltages and its power transmission efficiency is about 98.1%.
Signs of the Times: Signage in the Library.
Johnson, Carolyn
1993-01-01
Discusses the use of signs in libraries and lists 12 steps to create successful signage. Highlights include consistency, location, color, size, lettering, types of material, user needs, signage policy, planning, in-house fabrication versus vendors, and evaluation, A selected bibliography of 24 sources of information on library signage is included.…
Library 3.0 intelligent libraries and apomediation
Kwanya, Tom; Underwood, Peter
2015-01-01
The emerging generation of research and academic library users expect the delivery of user-centered information services. 'Apomediation' refers to the supporting role librarians can give users by stepping in when users need help. Library 3.0 explores the ongoing debates on the "point oh” phenomenon and its impact on service delivery in libraries. This title analyses Library 3.0 and its potential in creating intelligent libraries capable of meeting contemporary needs, and the growing role of librarians as apomediators. Library 3.0 is divided into four chapters. The first chapter introduces and places the topic in context. The second chapter considers "point oh” libraries. The third chapter covers library 3.0 librarianship, while the final chapter explores ways libraries can move towards '3.0'.
The Cambridge crystallography subroutine library
International Nuclear Information System (INIS)
Brown, P.J.; Matthewman, J.C.
1981-06-01
This manual is an amalgamation of the original Cambridge Crystallography Subroutine Library Mark II manual and its supplement No I. The original Mark II system, a set of FORTRAN Subroutines which can be used for standard crystallographic calculations, has been extended to include facilities for conventional least squares refinement. Several new routines have also been added. (U.K.)
CESAME: Providing High Quality Professional Development in Science and Mathematics for K-12 Teachers
Hickman, Paul
2002-04-01
It is appropriate that after almost half a century of Science and Mathematics education reform we take a look back and a peek forward to understand the present state of this wonderfully complex system. Each of the components of this system including teaching, professional development, assessment, content and the district K-12 curriculum all need to work together if we hope to provide quality science, mathematics and technology education for ALL students. How do the state and national standards drive the system? How do state policies on student testing and teacher licensure come into play? How do we improve the preparation, retention and job satisfaction of our K-12 teachers? What initiatives have made or are making a difference? What else needs to be done? What can the physics community do to support local efforts? This job is too big for any single organization or individual but we each can contribute to the effort. Our Center at Northeastern University, with support from the National Science Foundation, has a sharply defined focus: to get high quality, research-based instructional materials into the hands of K-12 classroom teachers and provide the support they need to use the materials effectively in their classrooms.
Neutron transport simulation in high speed moving media using Geant4
Li, G.; Ciungu, B.; Harrisson, G.; Rogge, R. B.; Tun, Z.; van der Ende, B. M.; Zwiers, I.
2017-12-01
A method using Geant4 to simulate neutron transport in moving media is described. The method is implanted in the source code of the software since Geant4 does not intrinsically support a moving object. The simulation utilizes the existing physical model and data library in Geant4, combined with frame transformations to account for the effect of relative velocity between neutrons and the moving media. An example is presented involving a high speed rotating cylinder to verify this method and show the effect of moving media on neutron transport.
Croatian library leaders’ views on (their library quality
Directory of Open Access Journals (Sweden)
Kornelija Petr Balog
2014-04-01
Full Text Available The purpose of this paper is to determine and describe the library culture in Croatian public libraries. Semi-structured interviews with 14 library directors (ten public and four academic were conducted. The tentative discussion topics were: definition of quality, responsibility for quality, satisfaction with library services, familiarization with user perspective of library and librarians, monitoring of user expectations and opinions. These interviews incorporate some of the findings of the project Evaluation of library and information services: public and academic libraries. The project investigates library culture in Croatian public and academic libraries and their preparedness for activities of performance measurement. The interviews reveal that library culture has changed positively in the past few years and that library leaders have positive attitude towards quality and evaluation activities. Library culture in Croatian libraries is a relatively new concept and as such was not actively developed and/or created. This article looks into the library culture of Croatian libraries, but at the same time investigates whether there is any trace of culture of assessment in them. Also, this article brings the latest update on views, opinions and atmosphere in Croatian public and academic libraries.
Impact of Adopt-a-Classroom Partnerships between K-12 and University Faculty
Smith, Elizabeth; Kindall, Heather D.; Carter, Vinson; Beachner, Maggie
2016-01-01
There is often a disconnect between K-12 schools and postsecondary institutions. While this gap has grown consistently, the need for collaboration between systems is greater than ever. The Adopt-A-Classroom program was created to address the need for greater university faculty involvement in public schools by providing opportunities for…
Measurement Invariance of the "Servant Leadership Questionnaire" across K-12 Principal Gender
Xu, Lihua; Stewart, Trae; Haber-Curran, Paige
2015-01-01
Measurement invariance of the five-factor "Servant Leadership Questionnaire" between female and male K-12 principals was tested using multi-group confirmatory factor analysis. A sample of 956 principals (56.9% were females and 43.1% were males) was analysed in this study. The hierarchical multi-step measurement invariance test supported…
12 MeV, 4.3 kW electron linear accelerator irradiation application
International Nuclear Information System (INIS)
Hang Desheng; Lai Qiji
2000-01-01
Characteristics of an electron linear accelerator, which has 6-12 MeV energy, 4.2 kW average beam power is introduced. Results show that it has advantages on improving the characteristics of semiconductor devices such as diodes, triodes, SCR, preventing garlic from sprout, preservation of food, and so on
The Influence of Lean on K-12 District Management: A Case Study
Brown, Beverly
2011-01-01
For decades, policymakers and educators have focused on public school equity and adequacy, while paying little attention to efficiency. This qualitative single case study was designed to capture explicit information about Lean management, operations, and culture in a K-12 Michigan school district engaged in Lean training and implementation for a…
After 60 Years, Do the Arguments for K-12 Vouchers Still Hold?
Laitsch, Dan
2016-01-01
In 1955, Milton Friedman authored a foundational paper proposing a shift in funding and governance mechanisms for public K-12 schools, suggesting that parents be awarded tuition vouchers that they could use to pay for private sector education services for their children, rather than relying on government provided neighborhood schools. Friedman…
ZZ MCNPDATA, Standard Neutron, Photon and Electron Data Libraries for MCNP-4C and MCB1C
International Nuclear Information System (INIS)
2002-01-01
of data: A wide variety of continuous-energy, discrete, multigroup, thermal and dosimetry neutron data libraries are available in this release. The continuous-energy neutron data libraries available include: ENDF60, RMCCS, RMCCSA, ENDF5U, ENDF5P, NEWXS, ENDF5MT*, MISC5XS**, ENDL85, KIDMAN, 100XS, URES***, ENDF6DN***, ENDF62MT***, and ENDL92***. The discrete neutron data libraries include: NEWXSD, DRMCCS, and DRE5. The multigroup neutron data library is MGXSNP, and the thermal S(alpha, beta) libraries are TMCCS and THERXS. The neutron dosimetry libraries are 531DOS, 532DOS, and LLLDOS. The photon transport libraries are MCPLIB and MCPLIB02, and the electron libraries are EL and EL03***. The photon and electron data libraries contain data for elements having Z<95. The data libraries, as distributed, are in ASCII, or type 1, format. - The data library ENDF5MT contains data previously available in the library EPRIXS, along with the U600K data library. - The data library MISC5XS contains corrected data for ENDF/B-V based Zr as described below, and the libraries previously known as IRNAT, MISCXS, ARKRC, TM169, GDT2GP, and T2DDC. The ENDF/B-V Zr data has been corrected for five ZAID's from the libraries RMCCS, DRMCCS, ENDF5P, DRE5, and EPRIXS. Below is a summary of the changes that have been made for Zr (Previous → Corrected): RMCCS 40000.51c → 40000.57c MISC5XS 300K; DRMCCS 40000.51d → 40000.57d MISC5XS 300K; ENDF5P 40000.50c → 40000.56c MISC5XS 300K; DRE5 40000.50d → 40000.56d MISC5X 300K; EPRIXS 40000.53c → 40000.58c MISC5XS 600K. - These five data libraries (URES, ENDF6DN, ENDF62MT, ENDL92, and EL03) are newly released in DLC-200. In the February 2001 update, URES was replaced with URESA. Please consult the README file and the more detailed documentation provided for descriptions of these libraries
Social Media Data in the Academic Environment: Crimson Hexagon in the Library
Tulley, Stephanie; Dennis, Tim
2016-01-01
Social media data is a high-profile resource across academic disciplines, in areas as diverse as understanding voter behavior, tracking social communication networks, and identifying sources and effects of pollution on human health. While manual data collection and review from public social media sites can provide some insight into the content of these sources, bulk access to data is preferred for more complex and deeper analysis into the content. A certain amount of data can be accessed dire...
Managing user queries using cloud services: KAUST library experience
Ramli, Rindra M.
2017-03-01
The provision of reference and information services are one of the major activities for academic libraries. Answering questions and providing relevant and timely answers for library users are just one of such services. Questions come in many format: in person, phone, email and even on social media platforms. The type of questions may also differ from simple, directional to complicated ones. One of the challenges for libraries is the capturing and managing of these inquiries. Libraries need to address some of these points: •\\tHow the questions will be captured •\\tHow the questions will be answered •\\tWho will answer these questions •\\tWhat is the turn-around time for answering these questions •\\tWhat kind of statistics to monitor •\\tHow are these statistics communicated to internal library staff and other stakeholders This paper describe the initiatives undertaken by KAUST, a brand new Graduate Research Library located in Saudi Arabia. This initiatives include the implementation of LibAnswers to assist the library in capturing and managing all inquiries. We are tracking inquiries coming in via email or widgets (such as online form), converting received questions into FAQ entries, creating and maintaining a public knowledge base for our users. In addition, it will also describe future plans in store to expand reference services for our library users. KAUST: (King Abdullah University of Science and Technology) is a graduate research university located along the shores of the Red Sea. The university was inaugurated in September 2009. The main areas of study are: Mathematics and Computer Science, Physical Sciences and Life Sciences. The university library is situated at the heart of the campus. It is a digitally born library with collections comprising of print and electronic resources. The library has: •\\t310,000 e-book titles •\\tOver 50,000 e-journal titles •\\tOver 30 scientific databases •\\tAbout 3,500 print titles
Minkel, Walter; Milliot, Jim
2003-01-01
Includes three articles: one reviews top stories from "Library Journal" regarding budget problems, salaries and recruitment, privacy, legal issues, virtual reference, electronic books, distance education, special libraries, and scholarly innovation; one discusses school library issues, including layoffs, Internet concerns, and…
Macro testing for group constant library TPLIB-95
International Nuclear Information System (INIS)
Yao Dong; Zeng Daogui; Liu Jingbo; Wang Yingming; Li Huiyun
1996-04-01
A macro test of the group constant library TPLIB-95 was introduced. The TPLIB-95 is an updated group constant library created by China Nuclear Data Center for LWR fuel assembly calculation program package TPFAP based on the JENDL-3.1 evaluation nuclear data library. The calculations and analyses were carried out by using five thermal reactor benchmark issues, a set of PWR zero-power critical experiments, the first cycle reactor core of 300 MW Qinshan NPP as well as the first cycle reactor core of 900 MW Daya Bay NPP. The calculation results for the thermal reactor benchmark issues showed that the maximum deviation between the calculated and measured values for spectrum indexes is large, like 6.7% for ρ 28 of BAPL-2. However, the maximum deviation for k eff is only 0.29% for TRX-2. The calculation results for zero-power critical experiments showed that the calculated value of k eff obtained by using TPLIB-95 is closer to the measured value compared with the one obtained by using the original library TPLIB. The agreement between the calculated and measured values for critical boron concentration in the first cycle reactor cores in Qinshan NPP and Daya Bay NPP is quite good. The maximum deviation for the critical boron concentration is only 15 x 10 -6 /L. (8 figs., 5 tabs.)
Apps and Mobile Support Services in Canadian Academic Medical Libraries
Directory of Open Access Journals (Sweden)
Tess Grynoch
2016-12-01
Full Text Available Objective: To examine how Canadian academic medical libraries are supporting mobile apps, what apps are currently being provided by these libraries, and what types of promotion are being used. Methods: A survey of the library websites for the 17 medical schools in Canada was completed. For each library website surveyed, the medical apps listed on the website, any services mentioned through this medium, and any type of app promotion events were noted. When Facebook and Twitter accounts were evident, the tweets were searched and the past two years of Facebook posts scanned for mention of medical apps or mobile services/events. Results: All seventeen academic medical libraries had lists of mobile medical apps with a large range in the number of medical relevant apps (average=31, median= 23. A total of 275 different apps were noted and the apps covered a wide range of subjects. Five of the 14 Facebook accounts scanned had posts about medical apps in the past two years while 11 of the 15 Twitter accounts had tweets about medical apps. Social media was only one of the many promotional methods noted. Outside of the app lists and mobile resources guides, Canadian academic medical libraries are providing workshops, presentations, and drop-in sessions for mobile medical apps. Conclusion: While librarians cannot simply compare mobile services and resources between academic medical libraries without factoring in a number of other circumstances, librarians can learn from mobile resources strategies employed at other libraries, such as using research guides to increase medical app literacy.
DEFF Research Database (Denmark)
This work consists of 12 essays on different aspects of Asian media by Japanese, European, and American scholars, many of whom have themselves been involved in the production of media forms. Working in the fields of anthropology, media and cultural studies, and on the basis of hands-on research, ......, they have written a book on the social practices and cultural attitudes of people producing, reading, watching and listening to different kinds of media in Japan, China, Taiwan, Indonesia, Vietnam, Singapore and India....
How to Get Successfully Involved with K-12 Education
Duncan, D.; Fraknoi, A.; Bennett, M.
1998-05-01
Many astronomers now have some involvement in K-12 education, either through their children, through large projects with an education or outreach office, or through an educational component to their own grants. Some may need to incorporate education components into future proposals. For those new to education, it can be difficult to decide how best to use their limited resources without "re-inventing the wheel." Some astronomers are comfortable taking a direct role in the classroom or working with teachers, others prefer developing web-based or printed materials, while still others wouldrather work with local schools of education to enhance the training of future teachers. Which of these roles is most useful? In this session, participants will learn what has worked well in the past, with special attention paid to ways in which astronomers' and physicists' training and instincts may fail them when working in education. Invited teachers will describe their classrooms and how astronomers can be most helpful to them. Sample (successful) activities will be demonstrated, and information given about the wide range of existing astronomy and space-science education programs around the country. A full menu of useful ways that astronomers can get involved will be presented, as well as the organizations and institutions which can help in devising a meaningful education program. Handouts will include a catalog of national astronomy education projects, a list of educational web sites, information about the NASA OSS education brokers and facilitators, examples of successful educational materials, and a listing of roles astronomers have played or could play to enhance K-12 education. Registration is required; see the AAS Education WWW page or email aased@aas.org.
Explaining Technology Integration in K-12 Classrooms: A Multilevel Path Analysis Model
Liu, Feng; Ritzhaupt, Albert D.; Dawson, Kara; Barron, Ann E.
2017-01-01
The purpose of this research was to design and test a model of classroom technology integration in the context of K-12 schools. The proposed multilevel path analysis model includes teacher, contextual, and school related variables on a teacher's use of technology and confidence and comfort using technology as mediators of classroom technology…
Addressing the NETS*S in K-12 Classrooms: Implications for Teacher Education
Niederhauser, Dale S.; Lindstrom, Denise L.; Strobel, Johannes
2007-01-01
The National Educational Technology Standards for Students (NETS*S) were developed to provide guidelines for effective and meaningful technology use with K-12 students. In the present study we used the NETS*S as a framework to analyze ways that teachers integrated instructional technology use and provided opportunities for their students to…
California K-12 Schools and Communities Collaborate to Support Student Mental Health
Woodbridge, Michelle W.; Goldweber, Asha; Yu, Jennifer; Golan, Shari; Stein, Bradley D.
2013-01-01
Across the education, public health, and human and social services areas, there is renewed interest in bringing agency representatives together to work on the promotion of student mental health and wellness. One of the aims of California's Prevention and Early Intervention (PEI) K-12 Student Mental Health (SMH) initiative funded under Proposition…
What Is (Or Should Be) Scientific Evidence Use in K-12 Classrooms?
McNeill, Katherine L.; Berland, Leema
2017-01-01
Research and reform efforts frequently identify evidence as an essential component of science classroom instruction to actively engage students in science practices. Despite this agreement on the primacy of evidence, there is a lack of consensus around what counts as "evidence" in k-12 classrooms (e.g., ages 5-18): scholarship and…
Johnsen, Susan K., Ed.
2012-01-01
The new Pre-K-Grade 12 Gifted Education Programming Standards should be part of every school district's repertoire of standards to ensure that the learning needs of advanced students are being met. "NAGC Pre-K-Grade 12 Gifted Education Programming Standards: A Guide to Planning and Implementing High-Quality Services" details six standards that…
MATH77 - A LIBRARY OF MATHEMATICAL SUBPROGRAMS FOR FORTRAN 77, RELEASE 4.0
Lawson, C. L.
1994-01-01
OS, a Hewlett-Packard 720 computer running HP-UX, a Macintosh computer running MacOS, and an IBM PC compatible computer running MS-DOS. Accompanying the library is a set of 196 "demo" drivers that exercise all of the user-callable subprograms. The FORTRAN source code for MATH77 comprises 109K lines of code in 375 files with a total size of 4.5Mb. The demo drivers comprise 11K lines of code and 418K. Forty-four percent of the lines of the library code and 29% of those in the demo code are comment lines. The standard distribution medium for MATH77 is a .25 inch streaming magnetic tape cartridge in UNIX tar format. It is also available on a 9track 1600 BPI magnetic tape in VAX BACKUP format and a TK50 tape cartridge in VAX BACKUP format. An electronic copy of the documentation is included on the distribution media. Previous releases of MATH77 have been used over a number of years in a variety of JPL applications. MATH77 Release 4.0 was completed in 1992. MATH77 is a copyrighted work with all copyright vested in NASA.
Behind the Appearance of Reference Services at the Library University
Directory of Open Access Journals (Sweden)
Lailatur Rahmi
2016-12-01
Full Text Available This study aims to describe the development of reference services at the Library of Universitas Indonesia. The research discussed about innovation in the development of new activities in the reference services. Analyzing reference services from librarians’ point of view concerning the new activities in reference services, including attitudes and policies toward activities. This research takes a descriptive qualitative approach and uses semiotic analysis refering to Semiology of Roland Bathes concerning significance from two stage, denotation and connotation, for analyzing the result of interviews. The results showed that the Universitas Indonesia Library reference service provides some new activities. Librarians become more active, revealed to be closer to users, and transformation of information technology is seen as one of the competitive need to accompany the development of knowledge. Transfer media eventually have implications not on technology but rather to communication of reference services in the Universitas Indonesia Library.
Behind the Appearance of Reference Services at the Library University
Directory of Open Access Journals (Sweden)
Lailatur Rahmi
2018-01-01
Full Text Available This study aims to describe the development of reference services at the Library of Universitas Indonesia. The research discussed about innovation in the development of new activities in the reference services. Analyzing reference services from librarians’ point of view concerning the new activities in reference services, including attitudes and policies toward activities. This research takes a descriptive qualitative approach and uses semiotic analysis refering to Semiology of Roland Bathes concerning significance from two stage, denotation and connotation, for analyzing the result of interviews. The results showed that the Universitas Indonesia Library reference service provides some new activities. Librarians become more active, revealed to be closer to users, and transformation of information technology is seen as one of the competitive need to accompany the development of knowledge. Transfer media eventually have implications not on technology but rather to communication of reference services in the Universitas Indonesia Library.
36 CFR 702.12 - Space for meetings and special events.
2010-07-01
... special events. 702.12 Section 702.12 Parks, Forests, and Public Property LIBRARY OF CONGRESS CONDUCT ON LIBRARY PREMISES § 702.12 Space for meetings and special events. Information about the use of space for meeting and special events at the Library can be found at http://www.loc.gov/about/facilities/index.html...
Academic Library Administrators Perceive Value in Their Librarians’ Research
Directory of Open Access Journals (Sweden)
Elaine Sullo
2014-09-01
Full Text Available A Review of: Perkins, G.H. & Slowik, A.J.W. (2013. The value of research in academic libraries. College & Research Libraries, 74(2, 143-158. Retrieved from http://crl.acrl.org/content/74/2/143.full.pdf+html Abstract Objective – To explore academic library administrators’ perceived value of their librarians’ research, specifically the importance to the profession and the library community. Design – Qualitative, exploratory study using a survey questionnaire. Setting – Academic libraries in the United States of America. Subjects – 23 library administrators. Methods – During the summer of 2010, one of the authors conducted 20-30 minute telephone interviews with 23 academic library administrators. Interviews were recorded and transcribed for coding. Interview questions 1-3 and 8-19 were content-analyzed; the authors described common themes for each of these questions. Items 4-7 had Likert scale response formats, and a mean and standard deviation were computed for each of these items. Main Results – The benefits of librarians’ research included fulfilling tenure-track requirements, enriching relationships with teaching faculty, library faculty recognition, improved services and programs, collaboration with others, research result application to daily issues, development as librarians, and improved knowledge of the research field. The perceived current changes and future issues for university libraries included increased digitization of collections, scholarly communication, and expanded instructional engagement of faculty and students, as well as future economic downturn and budget cuts. Administrators noted several methods that influenced their thinking: professional meetings, reading professional journals, informal discussions with colleagues, and social media such as Facebook and Twitter. Academic library administrators used a variety of methods to support their librarians’ research. These included tenure-track requirements
International Nuclear Information System (INIS)
Mundim Filho, Luiz Martins; Carvalho, Wagner de Paula
2012-01-01
Full text: CASTOR (Centaur And Strange Object Research) is an electromagnetic (EM) and hadronic (HAD) calorimeter, based on tungsten and quartz plates, operating in the CMS Detector (Compact Muon Solenoid) at LHC. The calorimeter detects Cerenkov radiation and is positioned around the beam pipe in the very forward region of CMS (at 14.38 m from the interaction point), covering the pseudo-rapidity range between -6.6 ≤ η≤-5.1 . It is longitudinally segmented into 14 sections, 2 for the EM and 12 for the HAD parts and is 16-fold azimuthally symmetric around the beam pipe. A Shower Library is needed for CASTOR Monte Carlo simulation, as the full simulation of showers takes a long time and the high multiplicity of particles in the forward region makes this simulation very time consuming. The Shower Library is used as a look-up table in the form of a ROOT file, so that when a simulated particle enters the detector with a certain energy and direction, characterized by the azimuthal angle φ and the pseudo-rapidity η, instead of making the full simulation of the shower in CASTOR, it is substituted by one already stored in the Shower Library. Showers corresponding to two types of particles are included in the Shower Library: electrons (or photons) and charged pions. The software implemented to make the Shower Library is described, as well as the validation of this library and timing studies. This package has been developed in the context of the official software of the CMS Collaboration, CMSSW. (author)
Directory of Open Access Journals (Sweden)
Boutry Marc
2009-01-01
Full Text Available Abstract Background The industrial chicory, Cichorium intybus, is a member of the Asteraceae family that accumulates fructan of the inulin type in its root. Inulin is a low calories sweetener, a texture agent and a health promoting ingredient due to its prebiotic properties. Average inulin chain length is a critical parameter that is genotype and temperature dependent. In the context of the study of carbohydrate metabolism and to get insight into the transcriptome of chicory root and to visualize temporal changes of gene expression during the growing season, we obtained and characterized 10 cDNA libraries from chicory roots regularly sampled in field during a growing season. A leaf and a nodule libraries were also obtained for comparison. Results Approximately 1,000 Expressed Sequence Tags (EST were obtained from each of twelve cDNA libraries resulting in a 12,226 EST dataset. Clustering of these ESTs returned 1,922 contigs and 4,869 singlets for a total of 6,791 putative unigenes. All ESTs were compared to public sequence databases and functionally classified. Data were specifically searched for sequences related to carbohydrate metabolism. Season wide evolution of functional classes was evaluated by comparing libraries at the level of functional categories and unigenes distribution. Conclusion This chicory EST dataset provides a season wide outlook of the genes expressed in the root and to a minor extent in leaves and nodules. The dataset contains more than 200 sequences related to carbohydrate metabolism and 3,500 new ESTs when compared to other recently released chicory EST datasets, probably because of the season wide coverage of the root samples. We believe that these sequences will contribute to accelerate research and breeding of the industrial chicory as well as of closely related species.
Spasialisasi Dan Praktik Konglomerasi Media Kelompok Kompas Gramedia
Directory of Open Access Journals (Sweden)
Rahmawati Zulfiningrum
2014-07-01
Full Text Available This study aims to determine the spatialization and practices of media conglomeration by Kompas Gramedia group. This type of research is descriptive qualitative. In this research, data collection techniques used in-depth interviews, library research, and documentation. This study uses a technique Interactive Analysis Model Miles and Huberman. Spatialization as a process for overcoming space and time, map out the extent to which the media were able to present their products to the front of the reader, viewer, or consumers with the limits of space and time. The results indicate that the practice of spatialization conducted by Kompas Gramedia Group is to follow the model of industrial economy. It is characterized by the abundance of media and accelerate the results to get a low cost for the production or efficiency. This indicates the growth spirit of capitalism in the media industry. The media industry, which was built in the spirit of capitalism would produce media messages or product oriented capital increase. The conglomeration of media make the media do their efficiency is reflected in the value chain of media products. As the result, media also could not avoid about the content that will be the same. With equalizer for the content of these media, people in the audience do not have the freedom to select appropriate media content as what they want.
Fluid dynamics in porous media with Sailfish
Coelho, Rodrigo C. V.; Neumann, Rodrigo F.
2016-09-01
In this work we show the application of Sailfish to the study of fluid dynamics in porous media. Sailfish is an open-source software based on the lattice-Boltzmann method. This application of computational fluid dynamics is of particular interest to the oil and gas industry and the subject could be a starting point for an undergraduate or graduate student in physics or engineering. We built artificial samples of porous media with different porosities and used Sailfish to simulate the fluid flow through them in order to calculate their permeability and tortuosity. We also present a simple way to obtain the specific superficial area of porous media using Python libraries. To contextualise these concepts, we analyse the applicability of the Kozeny-Carman equation, which is a well-known permeability-porosity relation, to our artificial samples.