WorldWideScience

Sample records for julian crockford ug

  1. Julian Schwinger — Personal Recollections

    Science.gov (United States)

    Martin, Paul C.

    We're gathered here today to salute Julian Schwinger, a towering figure of the golden age of physics — and a kind and gentle human being. Even at our best universities, people with Julian's talent and his passion for discovery and perfection are rare — so rare that neither they nor the rest of us know how to take best advantage of their genius. The failure to find a happier solution to this dilemma in recent years has concerned many of us. It should not becloud the fact that over their lifetimes, few physicists, if any, have surmounted this impedance mismatch more effectively than Julian, conveying not only knowledge but lofty values and aspirations directly and indirectly to thousands of physicists…

  2. Sustainable mobility in Slovenian Julian Alps

    Directory of Open Access Journals (Sweden)

    Matej Ogrin

    2012-12-01

    Full Text Available Some mountainous areas, especially tourist areas, are facing traffc loads that exceed the carrying capacity and bring problems to local residents, visitors, public services, etc. Traf-fc problems can also cause a decrease of popularity of the tourist site and a decrease of tourist income therefore, in some Alpine areas in Slovenia, measures have begun to be taken to decrease traffc loads, and to support measures of sustainable mobility. This article deals with such measures and plans that have been taken in the Julian Alps of Slovenia to decrease the negative traffc impacts of tourism mobility in the municipalities of Kranjska Gora, Bohinj and Bovec.

  3. Percy Julian, Robert Robinson, and the Identity of Eserethole

    Science.gov (United States)

    Ault, Addison

    2008-01-01

    The Nova production "Percy Julian--Forgotten Genius" included the very public disagreement between Percy Julian, an unknown American chemist, and Robert Robinson, possibly the best known organic chemist of the day, as to the identity of "eserethole", the key intermediate for the synthesis of the alkaloid physostigmine. The Nova production,…

  4. Climate Prediction Center (CPC) Madden-Julian Oscillation (MJO) Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) Madden Julian Oscillation index (MJO) is a dataset that allows evaluation of the strength and phase of the MJO during the dataset...

  5. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  6. An epistemology of facilitation: A Julian M�ller story

    Directory of Open Access Journals (Sweden)

    H. Elmo Pienaar

    2014-08-01

    Full Text Available The article furthered an epistemology of facilitation. It was created through bringing into focus broad movements in Julian M�ller�s theoretical academic development. Rather than explaining at length the epistemological concepts characterising M�ller�s theoretical development � rightly because of the importance of narrative in Julian M�ller�s work � the article sought to link a social psychological dimension of both M�ller and the author to these concepts. Resulting from M�ller�s work, the author regarded a narrative approach, social constructionism and postfoundationalism as important epistemological conversational partners in practical theological facilitation.

  7. Teaching Margery and Julian in Anthology-Based Survey Courses

    Science.gov (United States)

    Petersen, Zina

    2006-01-01

    Recognizing that many of us teach the medieval English women mystics Margery Kempe and Julian of Norwich in survey courses, this essay attempts to put these writers in context for teachers who may have only a passing familiarity with the period. Focusing on passages of their writings found in the Longman and Norton anthologies of British…

  8. Challenges to and proposals for underground gas storage (UGS business in China

    Directory of Open Access Journals (Sweden)

    Gangxiong Zhang

    2017-05-01

    Full Text Available Underground gas storage (UGS is one of the major storage and peak-shaving means in the world among numerous storage ways via gas fields, small-scale LNG, etc. With the rapid development of natural gas industry in China, the seasonal peak-shaving issues are increasingly prominent, so how to achieve sustainable development of UGS business has become a major problem at present. In view of this, we studied the present status and trend of UGS development abroad and analyzed the following challenges encountered by UGS in China. (1 UGS construction falls behind the world and peak-shaving capacity is insufficient. (2 There is lack of quality gas sources for storage and the complicated geological conditions make the cost of UGS construction high. (3 UGS construction is still at the preliminary stage, so experience is not enough in safety and scientific operation and management. (4 UGS construction, management and operation are not unified as a whole, so its maximum efficiency fails to be exerted. (5 The economic benefit of UGS is difficult to be shown without independent cost accounting. Based on the experience of other countries, some proposals were put forward on UGS development under the actual present situation: to strengthen strategic UGS layout, intensify storage site screening in key areas and steadily promote UGS construction; to establish professional UGS technical and management teams and intensify the research of key technologies; and to set up a complete and rationally-distributed UGS construction, operation and management system.

  9. Julian Schwinger the physicist, the teacher, and the man

    CERN Document Server

    1996-01-01

    In the post-quantum-mechanics era, few physicists, if any, have matched Julian Schwinger in contributions to and influence on the development of physics. A deep and provocative thinker, Schwinger left his indelible mark on all areas of theoretical physics; an eloquent lecturer and immensely successful mentor, he was gentle, intensely private, and known for being "modest about everything except his physics". This book is a collection of talks in memory of him by some of his contemporaries and his former students: A Klein, F Dyson, B DeWitt, W Kohn, D Saxon, P C Martin, K Johnson, S Deser, R Fin

  10. ASDEX-UG. ASDEX upgrade project proposal. Phase 2

    International Nuclear Information System (INIS)

    1983-05-01

    The objective of ASDEX UG is to investigate the problems relating to tokamak divertor physics and the boundary layer of hot plasmas which cannot be covered otherwise by either ASDEX or other EUROPEAN tokamaks, including JET, but whose investigation is indispensable for NET and INTOR. The configuration of ASDEX UG is changed as compared with ASDEX due to the requirement that all poloidal field coils are located outside the toroidal field magnet. This leads to a highly elongated D-shaped plasma with an ''open'' divertor, which does not allow to close the divertor chamber by such simple means as in ASDEX. In section 2, the aims of ASDEX UG are repeated briefly and the essential features and parameters of the tokamak system are summarized. The summary includes an overview of the tokamak design, the time schedule of design and construction concluding with the estimated investment cost and manpower required. In section 3 the tokamak system components are treated. The circuits and energy supply for the different electrical components are described in section 4. Auxiliary heating requirements and methods are discussed in section 5. Section 6 presents a survey over the periphery of the tokamak system including preparation of the building and radiation shielding. Section 7 outlines the physical programme. Section 8 is devoted to diagnostics. Finally, the principal concepts for control, data acquisition and handling are outlined in section 9. (orig./AH)

  11. Herpetofaunal richness of San Julian Universitary Farm, Patulul, Suchitepequez, Guatemala

    Directory of Open Access Journals (Sweden)

    Dennis Guerra-Centeno

    2015-07-01

    Full Text Available The herpetofaunal richness of San Julian Universitary Farm (FUSJ, in Patulul, Suchitepequez, Guatemala, was investigated using three methods: (1 Capture/sighting of specimens, (2 social inquiry and (3 desk research. The field work was distributed over a 10 year period (2003-2013 at a rate of six fieldwork sessions each year. A 4.5 km long transect extending through the agricultural landscape of the farm was run repeatedly. Each fieldwork session included diurnal and nocturnal travels. The accumulated search time was 420 hr-transect. The equivalent to 337.5 of accumulated miles were traveled, including elevations between 1490 and 1833 feet above sea level. Three former hunters were interviewed and asked to identify species they think are present at the FUSJ. Published data were reviewed to determine which species were expected to occur in San Julian. Two lists (amphibians andreptiles totaling 97 species (including 95 expected, 38 found and 2 not expected was generated. The quality and significance of our data is discussed.

  12. When Will It Be ...?: U.S. Naval Observatory Sidereal Time and Julian Date Calculators

    Science.gov (United States)

    Chizek Frouard, Malynda R.; Lesniak, Michael V.; Bartlett, Jennifer L.

    2017-01-01

    Sidereal time and Julian date are two values often used in observational astronomy that can be tedious to calculate. Fortunately, the U.S. Naval Observatory (USNO) has redesigned its on-line Sidereal Time and Julian Date (JD) calculators to provide data through an Application Programming Interface (API). This flexible interface returns dates and times in JavaScript Object Notation (JSON) that can be incorporated into third-party websites or applications.Via the API, Sidereal Time can be obtained for any location on Earth for any date occurring in the current, previous, or subsequent year. Up to 9999 iterations of sidereal time data with intervals from 1 second to 1095 days can be generated, as long as the data doesn’t extend past the date limits. The API provides the Gregorian calendar date and time (in UT1), Greenwich Mean Sidereal Time, Greenwich Apparent Sidereal Time, Local Mean Sidereal Time, Local Apparent Sidereal Time, and the Equation of the Equinoxes.Julian Date can be converted to calendar date, either Julian or Gregorian as appropriate, for any date between JD 0 (January 1, 4713 BCE proleptic Julian) and JD 5373484 (December 31, 9999 CE Gregorian); the reverse calendar date to Julian Date conversion is also available. The calendar date and Julian Date are returned for all API requests; the day of the week is also returned for Julian Date to calendar date conversions.On-line documentation for using all USNO API-enabled calculators, including sample calls, is available (http://aa.usno.navy.mil/data/docs/api.php).For those who prefer using traditional data input forms, Sidereal Time can still be accessed at http://aa.usno.navy.mil/data/docs/siderealtime.php, and the Julian Date Converter at http://aa.usno.navy.mil/data/docs/JulianDate.php.

  13. Would Jule Charney Have Cracked the Madden-Julian Oscillation?

    Science.gov (United States)

    Emanuel, K.

    2017-12-01

    Jule Charney's approach to science often involved looking at old problems in new ways. One example was his theory of baroclinic instability, which followed on the heels of long-standing efforts to explain well-observed cyclones and anticyclones. He mastered the art of boiling a physical phenomenon down to its essence, throwing away many things that others had considered important while expressing that which he retained in the simplest possible way. To help honor Charney's legacy, I will review the history of another well-observed phenomenon - the Madden Julian Oscillation (MJO) - together with the many largely unsuccessful efforts to explain it, culminating finally in a satisfying explanation that Jule would have loved.

  14. Noble magnetic barriers in the ASDEX UG tokamak

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh; Vazquez, Justin

    2010-02-01

    The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest

  15. New England observed and predicted Julian day of maximum growing season stream/river temperature points

    Data.gov (United States)

    U.S. Environmental Protection Agency — The shapefile contains points with associated observed and predicted Julian day of maximum growing season stream/river temperatures in New England based on a spatial...

  16. Applications of Universal Grammar (UG) in the ESL/EFL Classroom

    Science.gov (United States)

    Kirkwold, Lorne O.

    2007-01-01

    The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…

  17. Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)

    Science.gov (United States)

    Irwandy

    2015-01-01

    The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…

  18. 46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...

  19. JULIAN THE ABJURER AND CHRISTIAN WORLD IN THE NOVEL "THE DEATH OF THE GODS" BY D. MEREZHKOVSKY

    Directory of Open Access Journals (Sweden)

    Neda Andritch

    2011-11-01

    Full Text Available The article elaborates on the concept of the protagonist in the novel The Death of the Gods, Julian the Abjurer by D. S. Merezhkovsky in the light of his attitude to Christian thought and Christians. The analysis accounts for the key religious and philosophic searches by Julian the Abjurer. Special attention is paid to the instances of "unwise wisdom" of Julian the Abjurer and reasons for his "patronizing violence" in relation to Christians.

  20. A Mechanism Denial Study on the Madden-Julian Oscillation

    Directory of Open Access Journals (Sweden)

    In-Sik Kang

    2011-12-01

    Full Text Available A series of Madden-Julian oscillation (MJO mechanism-denial experiments is performed using an atmospheric general circulation model (AGCM. Daily climatological seasonal cycles of i surface latent heat flux, ii net radiative heating rate, and iii surface wind stress are obtained from a control simulation and prescribed in place of the normal interactive computations of these fields in order to turn off the i wind-induced surface heat exchange (WISHE, ii cloud-radiation interaction (CRI, and iii frictional wave-CISK (FWC mechanisms, respectively. Dual and triple mechanism denial experiments are also conducted by switching off multiple mechanisms together. The influence of each mechanism is assessed by comparing experiments with that mechanism turned off to those in which it is not. CRI and WISHE are both found to be important to the simulated MJO amplitude and propagation speed, while FWC has weaker and less systematic effects. The MJO is weakened when CRI is turned off, but strengthened when WISHE is turned off, indicating that CRI amplifies the MJO in the control simulation while WISHE weakens it. The negative influence of WISHE is shown to result from simulated phase relationships between surface winds, surface fluxes and convection which differ significantly from those found in observations, and thus is not interpreted as evidence against a positive role for WISHE in the development and maintenance of the observed MJO. The positive influence of CRI in the model is consistent with a strong simulated relationship between daily grid-point column-integrated radiative and convective heating; the mean ratio of the latter to the former exceeds 0.2 for rain rates less than 14 mm d-1. CRI is also shown to suppress an excessive excitation of the convectively coupled Kelvin wave so that the amplitude and frequency of the MJO is maintained.

  1. Modulation of Atlantic Aerosols by the Madden-Julian Oscillation

    Science.gov (United States)

    Tian, B.; Waliser, D. E.; Kahn, Ralph A.; Wong, S.

    2010-01-01

    Much like the better-known EI Nino-Southern Oscillation, the Madden-Julian Oscillation (MJO) is a global-scale atmospheric phenomenon. The MJO involves periodic, systematic changes in the distribution of clouds and precipitation over the western Pacific and Indian oceans, along with differences in wind intensity over even more extensive areas, including the north and subtropical Atlantic Ocean. The lead authors of this paper developed a sophisticated mathematical technique for mapping the spatial and temporal behavior of changes in the atmosphere produced by the MJO. In a previous paper, we applied this technique to search for modulation of airborne particle amount in the eastern hemisphere associated with the "wet" (cloudy) vs. "dry" phases of the MJO. The study used primarily AVHRR, MODIS, and TOMS satellite-retrieved aerosol amount, but concluded that other factors, such as cloud contamination of the satellite signals, probably dominated the observed variations. The current paper looks at MJO modulation of desert dust transport eastward across the Atlantic from northern Africa, a region much less subject to systematic cloud contamination than the eastern hemisphere areas studied previously. In this case, a distinct aerosol signal appears, showing that dust is transported westward much more effectively during the MJO phase that favors westward-flowing wind, and such transport is suppressed when the MJO reduces these winds. Aside form the significant achievement in identifying such an effect, the result implies that an important component of global dust transport can be predicted based on the phase of the MJO. As a consequence, the impact of airborne dust on storm development in the Atlantic, and on dust deposition downwind of the desert sources, can also be predicted and more accurately modeled.

  2. The Madden-Julian Oscillation in NCEP Coupled Model Simulation

    Directory of Open Access Journals (Sweden)

    Wanqiu Wang Kyong-Hwan Seo

    2009-01-01

    Full Text Available This study documents a detailed analysis on the Madden-Julian Oscillation (MJO simulated by the National Centers for Environmental Prediction (NCEP using the Global Forecast System (GFS model version 2003 coupled with the Climate Forecast System model (CFS consisting of the 2003 version of GFS and the Geophysical Fluid Dynamics Laboratory (GFDL Modular Ocean Model V.3 (MOM3. The analyses are based upon a 21-year simulation of AMIP-type with GFS and CMIP-type with CFS. It is found that air-sea coupling in CFS is shown to improve the coherence between convection and large-scale circulation associated with the MJO. The too fast propagation of convection from the Indian Ocean to the maritime continents and the western Pacific in GFS is improved (slowed down in CFS. Both GFS and CFS produce too strong intraseasonal convective heating and circulation anomalies in the central-eastern Pacific; further, the air-sea coupling in CFS enhances this unrealistic feature. The simulated mean slow phase speed of east ward propagating low-wavenumber components shown in the wavenumber-frequency spectra is due to the slow propagation in the central-eastern Pacific in both GFS and CFS. Errors in model climatology may have some effect upon the simulated MJO and two possible influences are: (i CFS fails to simulate the westerlies over maritime continents and western Pacific areas, resulting in an unrealistic representation of surface latent heat flux associated with the MJO; and (ii vertical easterly wind shear from the Indian Ocean to the western Pacific in CFS is much weaker than that in the observation and in GFS, which may adversely affect the eastward propagation of the simulated MJO.

  3. Da teoria da embalagem à transparência total de Julian Assange

    Directory of Open Access Journals (Sweden)

    SILVA, Juremir Machado da

    2011-08-01

    Full Text Available This paper analyzes the radical assumption of the supremacy of pack compared to packed. Relates this hyper-real possibility with the role of Julian Assange and his Wikileaks to overcome a journalism based on control of the information delivery - broadcast content - and, paradoxically, increasingly subjected to the logic of appearance (packaging and image.

  4. Putting Ug99 on the map: An update on current and future monitoring

    DEFF Research Database (Denmark)

    Hodson, D P; Nazari, K; Park, R F

    2011-01-01

    Detection of stem rust race TTKSK (Ug99) from Uganda in 1998/99 highlighted not only the extremely high vulnerability of the global wheat crop to stem rust but also a lack of adequate global systems to monitor such a threat. Progress in the development and expansion of the Global Cereal Rust...... Monitoring System (GCRMS) is described. The current situation regarding the Ug99 lineage of races is outlined and the potential for expansion into important wheat areas is considered. The GCRMS has successfully tracked the spread and changes that are occurring within the Ug99 lineage and is now well...... capacity for race analysis is seen to be critical and integration of the Global Rust Reference Centre into the stem rust monitoring network is seen as a positive development. The current acute situation with severe epidemics of stripe rust in many countries indicates a clear need for more effective global...

  5. Creation of second order magnetic barrier inside chaos created by NTMs in the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2012-10-01

    Understanding and stabilization of neoclassical tearing modes (NTM) in tokamaks is an important problem. For low temperature plasmas, tearing modes are believed to be mainly driven by current density gradient. For collisionless plasmas, even when plasma is stable to classical tearing modes, helical reduction in bootstrap current in O-point of an island can destabilize NTMs when an initial island is seeded by other global MHD instabilities or when microturbulence triggers the transition from a linear to nonlinear instability. The onset of NTMs leads to the most serious beta limit in ASDEX UG tokamak [O. Gubner et al 2005 NF 39 1321]. The important NTMs in the ASDDEX UG are (m,n)=(3,2)+(4,3)+(1,1). Realistic parameterization of these NTMs and the safety factor in ASDEX UG are given in [O. Dumbrajs et al 2005 POP 12 1107004]. We use a symplectic map in magnetic coordinates for the ASDEX UG to integrate field lines in presence of the NTMs. We add a second order control term [H. Ali and A. Punjabi 2007 PPCF 49 1565] to this ASDEX UG field line Hamiltonian to create an invariant magnetic surface inside the chaos generated by the NTMs. The relative strength, robustness, and resilience of this barrier are studied to ascertain the most desirable noble barrier in the ASDEX UG with NTMs. We present preliminary results of this work, and discuss its implications with regard to magnetic transport barriers for increasing strength of magnetic perturbations. This work is supported by the grants DE-FG02-01ER54624 and DE-FG02-04ER54793.

  6. Julian Lennon Is Global Ambassador for the Lupus Foundation of America | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... research. In 2009, he and musician James Scott Cook released the song "Lucy" in honor of Vodden. Proceeds from the song benefited the LFA and the Saint Thomas' Lupus Trust in London. Julian Lennon agreed to ...

  7. Development of convection along the SPCZ within a Madden-Julian oscillation

    OpenAIRE

    Matthews, Adrian J.; Hoskins, Brian J.; Slingo, Julia M.; Blackburn, Mike

    1996-01-01

    A subtropical Rossby-wave propagation mechanism is proposed to account for the poleward and eastward progression of intraseasonal convective anomalies along the South Pacific convergence zone (SPCZ) that is observed in a significant proportion of Madden–Julian oscillations (MJOs). Large-scale convection, associated with an MJO, is assumed to be already established over the Indonesian region. The latent heating associated with this convection forces an equatorial Rossby-wave response with an u...

  8. Development of convection along the SPCZ within a Madden-Julian oscillation

    OpenAIRE

    Matthews, AJ; Hoskins, BJ; Slingo, JM; Blackburn, M

    1996-01-01

    A subtropical Rossby wave propagation mechanism is proposed to account for the poleward and eastward progression of intraseasonal convective anomalies along the South Pacific Convergence Zone (SPCZ) that is observed in a significant proportion of Madden-Julian Oscillations (MJOs). Large scale convection, associated with an MJO, is assumed to be already established over the Indonesian region. The latent heating associated with this convection forces an equatorial Rossby wave response with an u...

  9. Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat

    Science.gov (United States)

    In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...

  10. Intraseasonal response of the northern Indian Ocean coastal waveguide to the Madden-Julian Oscillation

    Digital Repository Service at National Institute of Oceanography (India)

    Vialard, J.; Shenoi, S.S.C.; Mc; Shankar, D.; Durand, F.; Fernando, V.; Shetye, S.R.

    Author version: Geophys. Res. Lett.: 36(14); 2009; doi:10.1029/2009GL038450; 5 pp Intraseasonal response of Northern Indian Ocean coastal waveguide to the Madden-Julian Oscillation J. Vialard 1 2 , S.S.C Shenoi 2 , J.P. McCreary 3 , D. Shankar 2... involving both equatorial wave dynamics and coastal wave propagation around the perimeter of the northern Indian Ocean [McCreary et al., 1993]. The East India Coastal Current (EICC), for example, is strongly influenced by remote wind forcing from...

  11. Electromagnetic Radiation : Variational Methods, Waveguides and Accelerators Including seminal papers of Julian Schwinger

    CERN Document Server

    Milton, Kimball A

    2006-01-01

    This is a graduate level textbook on the theory of electromagnetic radiation and its application to waveguides, transmission lines, accelerator physics and synchrotron radiation. It has grown out of lectures and manuscripts by Julian Schwinger prepared during the war at MIT's Radiation Laboratory, updated with material developed by Schwinger at UCLA in the 1970s and 1980s, and by Milton at the University of Oklahoma since 1994. The book includes a great number of straightforward and challenging exercises and problems. It is addressed to students in physics, electrical engineering, and applied mathematics seeking a thorough introduction to electromagnetism with emphasis on radiation theory and its applications.

  12. 'Great is Darwin and Bergson his poet': Julian Huxley's other evolutionary synthesis.

    Science.gov (United States)

    Herring, Emily

    2018-01-01

    In 1912, Julian Huxley published his first book The Individual in the Animal Kingdom which he dedicated to the then world-famous French philosopher Henri Bergson. Historians have generally adopted one of two attitudes towards Huxley's early encounter with Bergson. They either dismiss it entirely as unimportant or minimize it, deeming it a youthful indiscretion preceding Huxley's full conversion to Fisherian Darwinism. Close biographical study and archive materials demonstrate, however, that neither position is tenable. The study of the Bergsonian elements in play in Julian Huxley's early works fed into Huxley's first ideas about progress in evolution and even his celebrated theories of bird courtship. Furthermore, the view that Huxley rejected Bergson in his later years needs to be revised. Although Huxley ended up claiming that Bergson's theory of evolution had no explanatory power, he never repudiated the descriptive power of Bergson's controversial notion of the élan vital. Even into the Modern Synthesis period, Huxley represented his own synthesis as drawing decisively on Bergson's philosophy.

  13. Atmospheric Radiation Measurement Madden-Julian Oscillation Investigation Experiment Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Long, Chuck [National Oceanic and Atmospheric Administration (NOAA), Boulder, CO (United States). Earth System Research Lab.

    2016-07-01

    Every 30–90 days during the Northern Hemisphere winter, the equatorial tropical atmosphere experiences pulses of extraordinarily strong deep convection and rainfall. This phenomenon is referred to as the Madden–Julian Oscillation, or MJO, named after the scientists who identified this cycle. The MJO significantly affects weather and rainfall patterns around the world (Zhang 2013). To improve predictions of the MJO—especially about how it forms and evolves throughout its lifecycle—an international group of scientists collected an unprecedented set of observations from the Indian Ocean and western Pacific region from October 2011 through March 2012 through several coordinated efforts. The coordinated field campaigns captured six distinct MJO cycles in the Indian Ocean. The rich set of observations capturing several MJO events from these efforts will be used for many years to study the physics of the MJO. Here we highlight early research results using data from the Atmospheric Radiation Measurement (ARM) Madden-Julian Oscillation Investigation Experiment (AMIE), sponsored by the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility.

  14. Analysis of the sediments of the Julian Adame Alatorre dam by the INAA; Analisis de sedimentos de la presa Julian Adame Alatorre por la tecnica de AANI

    Energy Technology Data Exchange (ETDEWEB)

    Oliva, J.E.; Lugo, J.F.; Mireles, F.; Quirino, L.L.; Davila, J.I.; Pinedo, J.L.; Rios, C. [UAZ, Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Miller, W.H. [Nuclear Science and Engineering Institute, E2433 Engineering Building East, University of Missouri-Columbia, MO 65211 (United States)]. e-mail: jeolivag@yahoo.com.mx

    2003-07-01

    Its were taken eight samples of sediment of the Julian Adame Alatorre dam located in the Villanueva municipality, in the State of Zacatecas, Mexico; with the end of determining the presence of elements of anthropogenic origin, as well as the concentration of the same ones. It was used the Instrumental neutron activation analysis (AANI) with a flow of thermal neutrons of 8 x 10{sup 13} and 5 x 10{sup 13} n cm{sup -2} s{sup -1}. With the purpose of determining the concentration of these elements at level of traces; finding presence of 32 elements among which its were find elements in greater concentrations and others at level of traces. Of these 32 elements, five of anthropogenic origin were identified which its were: Cr, Co, Zn, As and Mn; but that whose concentration is very low, in comparison with the one reported in other places of the world. In this work there are presented the obtained results of the elementary analysis of this samples. (Author)

  15. Relationships between the Antarctic oscillation, the Madden-Julian oscillation, and ENSO, and consequences for rainfall analysis

    CSIR Research Space (South Africa)

    Pohl, B

    2010-01-01

    Full Text Available range, it is not unambiguously related to the global-scale Madden–Julian oscillation (MJO) activity, with in particular no coherent phase relationship with the MJO index. Moreover, in the high southern latitudes, the MJO-associated anomaly fields do...

  16. 78 FR 37792 - Mario Julian Martinez-Bernache, Inmate Number #95749-279, CI Big Spring, Corrections Institution...

    Science.gov (United States)

    2013-06-24

    ... DEPARTMENT OF COMMERCE Bureau of Industry and Security Mario Julian Martinez-Bernache, Inmate... Order with the Under Secretary of Commerce for Industry and Security. The appeal must be filed within 45... the Internal Security Act of 1950 (50 U.S.C. 783(b)), or section 38 of the Arms Export Control Act (22...

  17. Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.

    Science.gov (United States)

    Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder

    2014-01-01

    Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.

  18. Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

    International Nuclear Information System (INIS)

    Terry, S.S.; Cunningham, M.J.

    1975-11-01

    The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

  19. Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells

    Directory of Open Access Journals (Sweden)

    Peter Sovius

    2006-10-01

    Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.

  20. A Madden-Julian oscillation event realistically simulated by a global cloud-resolving model.

    Science.gov (United States)

    Miura, Hiroaki; Satoh, Masaki; Nasuno, Tomoe; Noda, Akira T; Oouchi, Kazuyoshi

    2007-12-14

    A Madden-Julian Oscillation (MJO) is a massive weather event consisting of deep convection coupled with atmospheric circulation, moving slowly eastward over the Indian and Pacific Oceans. Despite its enormous influence on many weather and climate systems worldwide, it has proven very difficult to simulate an MJO because of assumptions about cumulus clouds in global meteorological models. Using a model that allows direct coupling of the atmospheric circulation and clouds, we successfully simulated the slow eastward migration of an MJO event. Topography, the zonal sea surface temperature gradient, and interplay between eastward- and westward-propagating signals controlled the timing of the eastward transition of the convective center. Our results demonstrate the potential making of month-long MJO predictions when global cloud-resolving models with realistic initial conditions are used.

  1. The Madden-Julian Oscillation and the Indo-Pacific Warm Pool

    Science.gov (United States)

    Raymond, David J.; Fuchs, Željka

    2018-04-01

    A minimal model of the interaction of the Madden-Julian oscillation (MJO) with the Indo-Pacific warm pool is presented. This model is based on the linear superposition of the flow associated with a highly simplified treatment of the MJO plus the flow induced by the warm pool itself. Both of these components parameterize rainfall as proportional to the column water vapor, which in turn is governed by a linearized moisture equation in which WISHE (wind induced surface heat exchange) plays a governing role. The MJO component has maximum growth rate for planetary wavenumber 1 and is equatorially trapped with purely zonal winds. The warm pool component exhibits a complex flow pattern, differing significantly from the classical Gill model as a result of the mean easterly flow. The combination of the two produce a flow that reproduces many aspects of the observed global flow associated with the MJO.

  2. Using AMIE data to study cloud processes within the Madden-Julian Oscillation

    Energy Technology Data Exchange (ETDEWEB)

    Houze, Robert A. [Univ. of Washington, Seattle, WA (United States). Dept. of Atmospheric Sciences

    2015-12-17

    This study uses AMIE data to show how the small clouds in the Madden-Julian Oscillation first organize into lines and other patterns, how they develop the first rainshowers, how those showers deposit cool air over the ocean surface, how this cool air spreads and triggers deeper convection, how the deep convection develops into mesoscale systems, how the mesoscale systems modify the heating profile through the depth of the troposphere, and how the development of the clouds responds to and interacts with large-scale waves circumnavigating the globe at upper levels, and how equatorial trapped waves at lower levels modulates the development of the cloud population. The techniques used to analyze the radar and sounding data collected in AMIE to achieve the above results are innovative, and to obtain more general results we have used regional modeling with a variety of cloud microphysical schemes in combination with the data analyses.

  3. Julian Assange, Jacob Appelbaum, Andy Müller-Maguhn, Jérémie

    OpenAIRE

    Boenisch, Gilles

    2014-01-01

    En 2009, Amnesty International a attribué un prix à Julian Assange, En 2010, il a été nommé homme de l’année par Time Magazine et Le Monde ; Forbes Magazine l’a placé pour la première fois parmi les 68 personnalités les plus influentes au monde. Retranché depuis plus d’un an à l’ambassade d’Équateur qui lui a accordé l’asile politique à Londres, le fondateur de Wikileaks propose un ouvrage, fruit d’un dialogue avec Jacob Appelbaum, Andy Müller-Maguhn et Jérémie Zimmermann, tous très soucieux ...

  4. Commentary: "An Evaluation of Universal Grammar and the Phonological Mind"-UG Is Still a Viable Hypothesis.

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.

  5. Commentary: “An Evaluation of Universal Grammar and the Phonological Mind”—UG Is Still a Viable Hypothesis

    Science.gov (United States)

    Berent, Iris

    2016-01-01

    Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480

  6. An investigation into breast imaging as part of the undergraduate (UG) education of diagnostic radiography students in the UK

    International Nuclear Information System (INIS)

    Strudwick, R.M.; Taylor, K.

    2017-01-01

    Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in

  7. The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG

    Science.gov (United States)

    Ali, Halima; Punjabi, Alkesh

    2013-05-01

    Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83

  8. Revisiting Noah’S Ark in Julian Barnes’ A History of the World in 10 ½ Chapters

    Directory of Open Access Journals (Sweden)

    Muthu Liana

    2014-03-01

    Full Text Available Considering that intertextuality is the text’s property of being connected to other previous texts, Julian Barnes’ novel, “A History of the World in 10 ½ Chapters”, rewrites the Biblical story of Noah’s Ark. Besides the narration accounted in the Bible, new elements are encountered here: e.g. the Ark wasn’t a simple vessel, but a small fleet; Noah butchered the animals from the Ark, animals selected initially to be saved from the Deluge; the woodworms, creatures that symbolize decay, were also present on the Ark, etc. Then, new versions of the Biblical story, all having connections with Noah, the Ark and the Sea are present. Therefore, Julian Barnes fructifies Noah’s story, readjusting it to other spaces and historic times.

  9. Root cause analysis of the fatigue failures of the pulsation dampers of a large underground gas storage (UGS) system

    NARCIS (Netherlands)

    Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.

    2014-01-01

    Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke

  10. Identification and validation of single nucleotide polymorphic markers linked to Ug99 stem rust resistance in spring wheat

    Science.gov (United States)

    Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...

  11. Genomic analysis of a novel gene conferring resistance to Ug99 stem rust in Triticum turgidum ssp. dicoccum

    Science.gov (United States)

    Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...

  12. Low and high frequency Madden-Julian oscillations in austral summer: interannual variations

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Takeshi [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); LOCEAN, IRD-CNRS-UPMC, Paris (France); Masson, Sebastien; Vialard, Jerome; Madec, Gurvan [LOCEAN, IRD-CNRS-UPMC, Paris (France); Boyer Montegut, Clement de [IFREMER, Brest (France); Behera, Swadhin K. [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); Takahashi, Keiko [Earth Simulator Center (JAMSTEC), Yokohama (Japan); Yamagata, Toshio [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); University of Tokyo, Tokyo (Japan)

    2010-09-15

    The Madden-Julian oscillation (MJO) is the main component of intraseasonal variability of the tropical convection, with clear climatic impacts at an almost-global scale. Based on satellite observations, it is shown that there are two types of austral-summer MJO events (broadly defined as 30-120 days convective variability with eastward propagation of about 5 m/s). Equatorial MJO events have a period of 30-50 days and tend to be symmetric about the equator, whereas MJO events centered near 8 S tend to have a longer period of 55-100 days. The lower-frequency variability is associated with a strong upper-ocean response, having a clear signature in both sea surface temperature and its diurnal cycle. These two MJO types have different interannual variations, and are modulated by the Indian Ocean Dipole (IOD). Following a negative IOD event, the lower-frequency southern MJO variability increases, while the higher-frequency equatorial MJO strongly diminishes. We propose two possible explanations for this change in properties of the MJO. One possibility is that changes in the background atmospheric circulation after an IOD favour the development of the low-frequency MJO. The other possibility is that the shallower thermocline ridge and mixed layer depth, by enhancing SST intraseasonal variability and thus ocean-atmosphere coupling in the southwest Indian Ocean (the breeding ground of southern MJO onset), favour the lower-frequency southern MJO variability. (orig.)

  13. Prediction of North Pacific Height Anomalies During Strong Madden-Julian Oscillation Events

    Science.gov (United States)

    Kai-Chih, T.; Barnes, E. A.; Maloney, E. D.

    2017-12-01

    The Madden Julian Oscillation (MJO) creates strong variations in extratropical atmospheric circulations that have important implications for subseasonal-to-seasonal prediction. In particular, certain MJO phases are characterized by a consistent modulation of geopotential height in the North Pacific and adjacent regions across different MJO events. Until recently, only limited research has examined the relationship between these robust MJO tropical-extratropical teleconnections and model prediction skill. In this study, reanalysis data (MERRA and ERA-Interim) and ECMWF ensemble hindcasts are used to demonstrate that robust teleconnections in specific MJO phases and time lags are also characterized by excellent agreement in the prediction of geopotential height anoma- lies across model ensemble members at forecast leads of up to 3 weeks. These periods of enhanced prediction capabilities extend the possibility for skillful extratropical weather prediction beyond traditional 10-13 day limits. Furthermore, we also examine the phase dependency of teleconnection robustness by using Linear Baroclinic Model (LBM) and the result is consistent with the ensemble hindcasts : the anomalous heating of MJO phase 2 (phase 6) can consistently generate positive (negative) geopotential height anomalies around the extratropical Pacific with a lead of 15-20 days, while other phases are more sensitive to the variaion of the mean state.

  14. Essential-Oil Variability in Natural Populations of Pinus mugo Turra from the Julian Alps.

    Science.gov (United States)

    Bojović, Srdjan; Jurc, Maja; Ristić, Mihailo; Popović, Zorica; Matić, Rada; Vidaković, Vera; Stefanović, Milena; Jurc, Dušan

    2016-02-01

    The composition and variability of the terpenes and their derivatives isolated from the needles of a representative pool of 114 adult trees originating from four natural populations of dwarf mountain pine (Pinus mugo Turra) from the Julian Alps were investigated by GC-FID and GC/MS analyses. In total, 54 of the 57 detected essential-oil components were identified. Among the different compound classes present in the essential oils, the chief constituents belonged to the monoterpenes, comprising an average content of 79.67% of the total oil composition (74.80% of monoterpene hydrocarbons and 4.87% of oxygenated monoterpenes). Sesquiterpenes were present in smaller amounts (average content of 19.02%), out of which 16.39% were sesquiterpene hydrocarbons and 2.62% oxygenated sesquiterpenes. The most abundant components in the needle essential oils were the monoterpenes δ-car-3-ene, β-phellandrene, α-pinene, β-myrcene, and β-pinene and the sesquiterpene β-caryophyllene. From the total data set of 57 detected compounds, 40 were selected for principal-component analysis (PCA), discriminant analysis (DA), and cluster analysis (CA). The overlap tendency of the four populations suggested by PCA, was as well observed by DA. CA also demonstrated similarity among the populations, which was the highest between Populations I and II. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  15. Optimal Initial Perturbations for Ensemble Prediction of the Madden-Julian Oscillation during Boreal Winter

    Science.gov (United States)

    Ham, Yoo-Geun; Schubert, Siegfried; Chang, Yehui

    2012-01-01

    An initialization strategy, tailored to the prediction of the Madden-Julian oscillation (MJO), is evaluated using the Goddard Earth Observing System Model, version 5 (GEOS-5), coupled general circulation model (CGCM). The approach is based on the empirical singular vectors (ESVs) of a reduced-space statistically determined linear approximation of the full nonlinear CGCM. The initial ESV, extracted using 10 years (1990-99) of boreal winter hindcast data, has zonal wind anomalies over the western Indian Ocean, while the final ESV (at a forecast lead time of 10 days) reflects a propagation of the zonal wind anomalies to the east over the Maritime Continent an evolution that is characteristic of the MJO. A new set of ensemble hindcasts are produced for the boreal winter season from 1990 to 1999 in which the leading ESV provides the initial perturbations. The results are compared with those from a set of control hindcasts generated using random perturbations. It is shown that the ESV-based predictions have a systematically higher bivariate correlation skill in predicting the MJO compared to those using the random perturbations. Furthermore, the improvement in the skill depends on the phase of the MJO. The ESV is particularly effective in increasing the forecast skill during those phases of the MJO in which the control has low skill (with correlations increasing by as much as 0.2 at 20 25-day lead times), as well as during those times in which the MJO is weak.

  16. Analysis of the sediments of the Julian Adame Alatorre dam by the INAA

    International Nuclear Information System (INIS)

    Oliva, J.E.; Lugo, J.F.; Mireles, F.; Quirino, L.L.; Davila, J.I.; Pinedo, J.L.; Rios, C.; Miller, W.H.

    2003-01-01

    Its were taken eight samples of sediment of the Julian Adame Alatorre dam located in the Villanueva municipality, in the State of Zacatecas, Mexico; with the end of determining the presence of elements of anthropogenic origin, as well as the concentration of the same ones. It was used the Instrumental neutron activation analysis (AANI) with a flow of thermal neutrons of 8 x 10 13 and 5 x 10 13 n cm -2 s -1 . With the purpose of determining the concentration of these elements at level of traces; finding presence of 32 elements among which its were find elements in greater concentrations and others at level of traces. Of these 32 elements, five of anthropogenic origin were identified which its were: Cr, Co, Zn, As and Mn; but that whose concentration is very low, in comparison with the one reported in other places of the world. In this work there are presented the obtained results of the elementary analysis of this samples. (Author)

  17. Extratropical Forcing Triggered the 2015 Madden-Julian Oscillation-El Niño Event.

    Science.gov (United States)

    Hong, Chi-Cherng; Hsu, Huang-Hsiung; Tseng, Wan-Ling; Lee, Ming-Ying; Chow, Chun-Hoe; Jiang, Li-Chiang

    2017-04-24

    In this paper, we report the triggering effect of extratropical perturbation on the onset of an atypical Madden-Julian Oscillation (MJO) and onset of the 2015-16 El Niño in March 2015. The MJO exhibited several unique characteristics: the effect of extratropical forcing, atypical genesis location and timing in the equatorial western Pacific, and the extremity of amplitudes in many aspects. The southward-penetrating northerly associated with the extratropical disturbances in the extratropical western North Pacific contributed to triggering the deep convection and westerly wind burst (WWB) and onset of the MJO over the anomalously warm tropical western Pacific in early March. The persisting strong WWB forced downwelling Kelvin wave-like oceanic perturbation that propagated eastward and led to the onset of the 2015-16 El Niño. The proposed novel extratropical forcing mechanism explaining the unique extratropics-MJO-El Niño association, based on both data diagnostics and numerical experiments, warrants further attention for a more detailed understanding of the onset of the MJO and its potential effect on El Niño.

  18. The boreal winter Madden-Julian Oscillation's influence on summertime precipitation in the greater Caribbean

    Science.gov (United States)

    Curtis, Scott; Gamble, Douglas W.

    2016-07-01

    Precipitation totals in the greater Caribbean are known to be affected by interannual variability. In particular, dry conditions in the spring-summer have been physically linked to the positive phase of North Atlantic Oscillation (NAO) in the literature. In this study, it was found through regression analysis that an active Madden-Julian Oscillation (MJO) in winter geographically focused over the Maritime Continent contributes to a positive NAO in March via the generation of Rossby waves in the Northern Hemisphere. Specifically, a negative Pacific-North American pattern develops in the winter and transitions to an Atlantic pattern in spring. The positive NAO is a transient feature of this evolving wave train, but a center of significant positive 200 hPa geopotential heights is entrenched over the southeast U.S. throughout the February to May time period and is manifested as high pressure at the surface. The southern flank of this system increases the speeds of the trade winds and leads to a cooling of the Caribbean sea surface temperatures and, thus, convection suppression and reduced precipitation. Thus, this study advances our understanding of the climate of the greater Caribbean by using climate teleconnections to relate the MJO to rainfall in the region.

  19. Book review: Julian Thomas The Birth of Neolithic Britain: An Interpretive Account.

    Directory of Open Access Journals (Sweden)

    Marko Sraka

    2014-12-01

    Full Text Available The Birth of Neolithic Britain is the fourth major work by the acclaimed Julian Thomas, one of the leading proponents of interpretive archaeology or archaeology informed by philosophy, anthropology and discussions in the arts and social sciences in general. After exposing the assumption and prejudices of archaeologists’ narratives of the Neolithic and presenting innovative explanations of the shift from hunting-gathering to farming as well as other issues in Rethinking the Neolithic (1991; reworked and updated version Understanding the Neolithic in 1999, questioning Western conceptualisations of time, identity, materiality with the help of archaeological case studies in the ‘Heideggerian’ Time, Culture and Identity (1996 and further contextualised archaeology as part of a (postmodern worldview in Archaeology and Modernity (2004, this book seems to be a relevant continuation of Thomas’s work. This is probably the first significant work on Neolithisation since Graeme Barker’s global overview The Agricultural Revolution in Prehistory (2006, Oxford: Oxford University Press, this time with a focus on Europe and particularly Britain.

  20. Role of Longwave Cloud-Radiation Feedback in the Simulation of the Madden-Julian Oscillation

    Science.gov (United States)

    Kim, Daehyun; Ahn, Min-Seop; Kang, In-Sik; Del Genio, Anthony D.

    2015-01-01

    The role of the cloud-radiation interaction in the simulation of the Madden-Julian oscillation (MJO) is investigated. A special focus is on the enhancement of column-integrated diabatic heating due to the greenhouse effects of clouds and moisture in the region of anomalous convection. The degree of this enhancement, the greenhouse enhancement factor (GEF), is measured at different precipitation anomaly regimes as the negative ratio of anomalous outgoing longwave radiation to anomalous precipitation. Observations show that the GEF varies significantly with precipitation anomaly and with the MJO cycle. The greenhouse enhancement is greater in weak precipitation anomaly regimes and its effectiveness decreases monotonically with increasing precipitation anomaly. The GEF also amplifies locally when convection is strengthened in association with the MJO, especially in the weak precipitation anomaly regime (less than 5 mm day(exp -1)). A robust statistical relationship is found among CMIP5 climate model simulations between the GEF and the MJO simulation fidelity. Models that simulate a stronger MJO also simulate a greater GEF, especially in the weak precipitation anomaly regime (less than 5 mm day(exp -1)). Models with a greater GEF in the strong precipitation anomaly regime (greater than 30 mm day(-1)) represent a slightly slower MJO propagation speed. Many models that lack the MJO underestimate the GEF in general and in particular in the weak precipitation anomaly regime. The results herein highlight that the cloud-radiation interaction is a crucial process for climate models to correctly represent the MJO.

  1. Identification and characterization of Sr13, a tetraploid wheat gene that confers resistance to the Ug99 stem rust race group

    Science.gov (United States)

    The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...

  2. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    International Nuclear Information System (INIS)

    Osborne, P.E.

    2002-01-01

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance

  3. Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, P.E.

    2002-09-11

    The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.

  4. Simulations of the Madden-Julian oscillation in four pairs of coupled and uncoupled global models

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chidong; Dong, Min [RSMAS, University of Miami, Miami, FL (United States); Gualdi, Silvio [National Institute of Geophysics and Volcanology, Bologna (Italy); Hendon, Harry H. [BMRC, Melbourne, VIC (Australia); Maloney, Eric D. [Oregon State University, Corvallis, OR (United States); Marshall, Andrew [Monash University, Melbourne, VIC (Australia); Sperber, Kenneth R. [PCMDI, Lawrence Livermore National Laboratory, Livermore, CA (United States); Wang, Wanqiu [CPC/NCEP/NOAA, Camp Springs, MD (United States)

    2006-11-15

    The status of the numerical reproduction of the Madden-Julian Oscillation (MJO) by current global models was assessed through diagnoses of four pairs of coupled and uncoupled simulations. Slow eastward propagation of the MJO, especially in low-level zonal wind, is realistic in all these simulations. However, the simulated MJO suffers from several common problems. The MJO signal in precipitation is generally too weak and often eroded by an unrealistic split of an equatorial maximum of precipitation into a double ITCZ structure over the western Pacific. The MJO signal in low-level zonal wind, on the other hand, is sometimes too strong over the eastern Pacific but too weak over the Indian Ocean. The observed phase relationship between precipitation and low-level zonal wind associated with the MJO in the western Pacific and their coherence in general are not reproduced by the models. The seasonal migration in latitude of MJO activity is missing in most simulations. Air-sea coupling generally strengthens the simulated eastward propagating signal, but its effects on the phase relationship and coherence between precipitation and low-level zonal wind, and on their geographic distributions, seasonal cycles, and interannual variability are inconsistent among the simulations. Such inconsistency cautions generalization of results from MJO simulations using a single model. In comparison to observations, biases in the simulated MJO appear to be related to biases in the background state of mean precipitation, low-level zonal wind, and boundary-layer moisture convergence. This study concludes that, while the realistic simulations of the eastward propagation of the MJO are encouraging, reproducing other fundamental features of the MJO by current global models remains an unmet challenge. (orig.)

  5. Thermodynamics in the Suppressed Phase of the Madden-Julian Oscillation Using a Multiplatform Strategy

    Science.gov (United States)

    Roberts, J. Brent; Robertson, Franklin R.; Clayson, Carol Anne; Taylor, Patrick

    2014-01-01

    The Madden-Julian Oscillation (MJO) represents a prominent mode of intraseasonal tropical variability. It is manifest by coherent large-scale changes in atmospheric circulation, convection, and thermodynamic processes. Preconditioning of the environment prior to the active phase of the MJO has been noted, but the balance of theorized mechanisms to accomplish this process remains unresolved. Further, there is a lack of consensus on the means by which primary initiation of an MJO event occurs. Observational and modeling efforts have recently been undertaken to advance our understanding of the physical underpinnings governing MJO development. However these intensive studies are often limited in space and/or time and are potentially subject to model deficiencies. Satellite observations, especially those providing vertical resolution of temperature and moisture, provide an opportunity to expand our knowledge of processes critical to MJO initiation and preconditioning. This work will provide an analysis of suppressed phase thermodynamics with an emphasis on the use of a complementary suite of satellite observations including AIRS/AMSU-A profiles, CERES radiative fluxes, and cloud properties observed by MODIS. Emphasis of this work will regard the distribution of cloud regimes, their radiative-convective effects, and their relationship to moist static energy during the recharge and suppressed stages of MJO initiation and eastward propagation. The analyses will make use of cloud regimes from MODIS observations to provide a compositing technique that enables the identification of systematic connections between different cloud regimes and the larger scale environment. Within these cloud regimes, the relationship between the associated cloud-radiative effects observed by CERES, vertically-resolved and vertically-integrated thermodynamics using AIRS/AMSU-A observations, and atmospheric boundary layer fluxes will be demonstrated.

  6. The role of unattended ground sensors (UGS) in regional confidence building and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Vannoni, M.; Duggan, R.

    1997-03-01

    Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.

  7. Protection of Children's Human Rights and Health: A Legacy of Julian Kramsztyk, Janusz Korczak, and Ludwik Rajchman.

    Science.gov (United States)

    Woltanowski, Piotr; Wincewicz, Andrzej; Sulkowski, Stanisław

    2018-01-01

    Tutor of generations of Warsaw medical doctors, Julian Kramsztyk (1851-1926) was son of Rabbi Izaak Kramsztyk, Polish patriot and fighter for independent Poland. Julian Kramsztyk graduated in medicine from Warsaw University in 1873 to soon work as a supervisor of the Internal Diseases Department of Bersohns and Baumans Children's Hospital from 1878 to 1910, and despite of refusing professorship from Imperial Warsaw University, he worked as a lecturer of pediatric disorders from 1880 with strong association of his medical practice with scientific and editorial tasks as well as engaging in charity. This article focuses on selective retrieval of biographical data of social and scientific achievements of followers of Julian Kramsztyk: his student, pioneer of children human rights, and pioneer of healthy patterns of nutrition of children, pediatrician Janusz Korczak (Henryk Goldszmit; 1878 or 1879-1942); and a skilled bacteriologist and a brilliant epidemiologist who was a prominent activist of the League of Nations (later United Nations Organization), cofounder of the UNICEF (United Nations Children's Emergency Fund), and the first chairman of the Organization from 1946 to 1950, which was primarily dedicated to "provide emergency food and health care to children in postwar time," Ludwik Rajchman (1881-1965). Janusz Korczak works laid foundation for international recognition of children rights to health, respect, education, privacy, and all the other human rights to be included in the United Nations Convention on the Rights of the Child (UNCRC). In 1989, nutrition and vaccination issues were the main medical interests of these medical doctors and still remain major fields of UNICEF actions.

  8. Most Dominated Problems of Mass Media Dialogism in National Dailies during the Trial Process of Wikileaks Grounder Julian Assange

    OpenAIRE

    Sandra Veinberg

    2014-01-01

    This paper examines media mediation, media effects and their impact on the literacy of the public sphere. To examine the medial text and media mediation's impact on various journalistic fields in different countries, I analyse during the current moment of ¡°the global hunting¡± around WikiLeaks¡¯ founder Julian Assange. As the source, I use 764 published articles in newspapers and online media from six different countries: Sweden, UK, Ecuador, Russia, Latvia and Malaysia. The objective was to...

  9. Impact of Madden–Julian Oscillation upon Winter Extreme Rainfall in Southern China: Observations and Predictability in CFSv2

    OpenAIRE

    Hong-Li Ren; Pengfei Ren

    2017-01-01

    The impact of Madden–Julian oscillation (MJO) upon extreme rainfall in southern China was studied using the Real-time Multivariate MJO (RMM) index and daily precipitation data from high-resolution stations in China. The probability-distribution function (PDF) of November–March rainfall in southern China was found to be skewed toward larger (smaller) values in phases 2–3 (6–7) of MJO, during which the probability of extreme rainfall events increased (reduced) by 30–50% (20–40%) relative to all...

  10. From Satis House to Newgate: Manipulation and Repression in the Adaptation of Great Expectations by Julian Jarrold

    Directory of Open Access Journals (Sweden)

    Claudia Cao

    2012-12-01

    Full Text Available This article analyzes a serial of Great Expectations in two parts directed by Julian Jarrold for the BBC in 1999. Through the semiotic approach proposed by Nicola Dusi in his essay Il cinema come traduzione. Da un medium all’altro (2003, this paper wants to highlight the translation strategies employed in the target text in comparison with the hypotext. The aim of this article is to show how the dominant isotopies – Pip’s repression and manipulation – are figurativized in the representation of the main places of power in the adaptation: Satis House, Little Britain and Newgate.

  11. A political-culture case from late antiquity: the emperor julian and his concept of education - doi: 10.4025/actascieduc.v32i1.9488

    Directory of Open Access Journals (Sweden)

    Margarida Maria de Carvalho

    2010-08-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} In this article, I propose to appraise Emperor Julian's conception of Paidéia or education. To this end, I will work from the meanings of the Christian Logos and the Greek Logos making use also of Gregory Nazianzen's Against Julian, verifying whether the clash that occurred between Gregory Nazianzen and Julian was not only religious but politico-religious, taking into account that at that point of the 4th century AD no separation of these spheres had yet existed. The text is divided into Preliminary Considerations, where I argue that the conflict between the two authors is political-cultural; The Emperor Julian and the Historiography about his times, in which I demonstrate that since the Emperor Julian's own time there was a myth built around him, and finally about Nazianzen's purpose of writing Against Julian. All of these interlinked points lead to the comprehension of this specific political moment of Late Antiquity.

  12. The Madden-Julian oscillation in ECHAM4 coupled and uncoupled general circulation models

    Energy Technology Data Exchange (ETDEWEB)

    Sperber, Kenneth R. [Lawrence Livermore National Laboratory, Program for Climate Model Diagnosis and Intercomparison, Livermore, CA (United States); Gualdi, Silvio [National Institute of Geophysics and Volcanology, Bologna (Italy); Legutke, Stephanie; Gayler, Veronika [Max Planck Institute of Meteorology, Models and Data Group, Hamburg (Germany)

    2005-08-01

    The Madden-Julian oscillation (MJO) dominates tropical variability on timescales of 30-70 days. During the boreal winter/spring, it is manifested as an eastward propagating disturbance, with a strong convective signature over the eastern hemisphere. The space-time structure of the MJO is analyzed using simulations with the ECHAM4 atmospheric general circulation model run with observed monthly mean sea-surface temperatures (SSTs), and coupled to three different ocean models. The coherence of the eastward propagation of MJO convection is sensitive to the ocean model to which ECHAM4 is coupled. For ECHAM4/OPYC and ECHO-G, models for which 100 years of daily data is available, Monte Carlo sampling indicates that their metrics of eastward propagation are different at the 1% significance level. The flux-adjusted coupled simulations, ECHAM4/OPYC and ECHO-G, maintain a more realistic mean-state, and have a more realistic MJO simulation than the nonadjusted scale interaction experiment (SINTEX) coupled runs. The SINTEX model exhibits a cold bias in Indian Ocean and tropical West Pacific Ocean sea-surface temperature of 0.5 C. This cold bias affects the distribution of time-mean convection over the tropical eastern hemisphere. Furthermore, the eastward propagation of MJO convection in this model is not as coherent as in the two models that used flux adjustment or when compared to an integration of ECHAM4 with prescribed observed SST. This result suggests that simulating a realistic basic state is at least as important as air-sea interaction for organizing the MJO. While all of the coupled models simulate the warm (cold) SST anomalies that precede (succeed) the MJO convection, the interaction of the components of the net surface heat flux that lead to these anomalies are different over the Indian Ocean. The ECHAM4/OPYC model in which the atmospheric model is run at a horizontal resolution of T42, has eastward propagating zonal wind anomalies and latent heat flux anomalies

  13. Intraseasonal interaction between the Madden-Julian Oscillation and the North Atlantic Oscillation.

    Science.gov (United States)

    Cassou, Christophe

    2008-09-25

    Bridging the traditional gap between the spatio-temporal scales of weather and climate is a significant challenge facing the atmospheric community. In particular, progress in both medium-range and seasonal-to-interannual climate prediction relies on our understanding of recurrent weather patterns and the identification of specific causes responsible for their favoured occurrence, persistence or transition. Within this framework, I here present evidence that the main climate intra-seasonal oscillation in the tropics-the Madden-Julian Oscillation (MJO)-controls part of the distribution and sequences of the four daily weather regimes defined over the North Atlantic-European region in winter. North Atlantic Oscillation (NAO) regimes are the most affected, allowing for medium-range predictability of their phase far exceeding the limit of around one week that is usually quoted. The tropical-extratropical lagged relationship is asymmetrical. Positive NAO events mostly respond to a mid-latitude low-frequency wave train initiated by the MJO in the western-central tropical Pacific and propagating eastwards. Precursors for negative NAO events are found in the eastern tropical Pacific-western Atlantic, leading to changes along the North Atlantic storm track. Wave-breaking diagnostics tend to support the MJO preconditioning and the role of transient eddies in setting the phase of the NAO. I present a simple statistical model to quantitatively assess the potential predictability of the daily NAO index or the sign of the NAO regimes when they occur. Forecasts are successful in approximately 70 per cent of the cases based on the knowledge of the previous approximately 12-day MJO phase used as a predictor. This promising skill could be of importance considering the tight link between weather regimes and both mean conditions and the chances of extreme events occurring over Europe. These findings are useful for further stressing the need to better simulate and forecast the tropical

  14. Rachunek kosztów działańjako podstawa wyceny usług

    Directory of Open Access Journals (Sweden)

    Gertruda Krystyna Świderska

    2009-03-01

    Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.

  15. The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety

    International Nuclear Information System (INIS)

    Forster, Brian P.

    2014-01-01

    The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease

  16. Quantification of African cassava mosaic virus (ACMV) and East African cassava mosaic virus (EACMV-UG) in single and mixed infected Cassava (Manihot esculenta Crantz) using quantitative PCR.

    Science.gov (United States)

    Naseem, Saadia; Winter, Stephan

    2016-01-01

    The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Discovery of a Novel Stem Rust Resistance Allele in Durum Wheat that Exhibits Differential Reactions to Ug99 Isolates

    Directory of Open Access Journals (Sweden)

    Jayaveeramuthu Nirmala

    2017-10-01

    Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.

  18. Prediction of the Midlatitude Response to Strong Madden-Julian Oscillation Events on S2S Time Scales

    Science.gov (United States)

    Tseng, K.-C.; Barnes, E. A.; Maloney, E. D.

    2018-01-01

    The Madden-Julian Oscillation (MJO) forces strong variations in extratropical atmospheric circulations that have important implications for subseasonal-to-seasonal (S2S) prediction. In particular, certain MJO phases are characterized by a consistent modulation of geopotential height in the North Pacific and adjacent regions across different MJO events. Until recently, only limited research has examined the relationship between these robust MJO tropical-extratropical teleconnections and model prediction skill. In this study, reanalysis data and numerical forecast model ensemble hindcasts are used to demonstrate that robust teleconnections in specific MJO phases and time lags are also characterized by excellent agreement in the prediction of geopotential height anomalies across model ensemble members at forecast leads of up to 3 weeks. These periods of enhanced prediction capabilities extend the possibility for skillful extratropical weather prediction beyond traditional 10-13 day limits.

  19. Steve Boardman and Julian Goodare, eds., Kings, Lords and Men in Scotland and Britain, 1300–1625: Essays in Honour of Jenny Wormald. Edinburgh: Edinburgh University Press, 2014. Pp. 368. ISBN: 9780748691500. £75.00.

    Directory of Open Access Journals (Sweden)

    Lucinda Dean

    2015-08-01

    Full Text Available Steve Boardman and Julian Goodare, eds., Kings, Lords and Men in Scotland and Britain, 1300–1625: Essays in Honour of Jenny Wormald. Edinburgh: Edinburgh University Press, 2014. Pp. 368. ISBN: 9780748691500. £75.00.

  20. New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA

    International Nuclear Information System (INIS)

    2013-01-01

    Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that

  1. Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.

    Science.gov (United States)

    Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M

    2015-04-01

    A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.

  2. Impact of Madden–Julian Oscillation upon Winter Extreme Rainfall in Southern China: Observations and Predictability in CFSv2

    Directory of Open Access Journals (Sweden)

    Hong-Li Ren

    2017-09-01

    Full Text Available The impact of Madden–Julian oscillation (MJO upon extreme rainfall in southern China was studied using the Real-time Multivariate MJO (RMM index and daily precipitation data from high-resolution stations in China. The probability-distribution function (PDF of November–March rainfall in southern China was found to be skewed toward larger (smaller values in phases 2–3 (6–7 of MJO, during which the probability of extreme rainfall events increased (reduced by 30–50% (20–40% relative to all days in the same season. Physical analysis indicated that the favorable conditions for generating extreme rainfall are associated with southwesterly moisture convergence and vertical moisture advection over southern China, while the direct contributions from horizontal moisture advection are insignificant. Based on the above results, the model-based predictability for extreme rainfall in winter was examined using hindcasts from the Climate Forecast System version 2 (CFSv2 of NOAA. It is shown that the modulations of MJO on extreme rainfall are captured and forecasted well by CFSv2, despite the existence of a relatively small bias. This study suggests the feasibility of deriving probabilistic forecasts of extreme rainfall in southern China based on RMM indices.

  3. Major, trace and rate earth elements in sediments of the Julian Adame-Alatorre dam by instrumental neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Mireles, F.; Pinedo, J. L.; Davila, J. I.; Oliva, J. E. [Universidad Autonoma de Zacatecas, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Speakman, R. J. [Museum Conservation Institute, Smithsonian Institution, Suitland, MD 20746 (United States); Glascock, M. D., E-mail: fmireles@uaz.edu.m [Research Reactor Center, University of Missouri, Columbia, MO 65211 (United States)

    2010-10-15

    The rapid industrial development in regions of Mexico during recent years has had the side effect of introducing toxic metals, fertilizers, and pesticides into the ecosystem. Sediment cores were collected from eight locations around the Julian Adame-Alatorre dam located in Municipality of Villanueva in the Zacatecas State, Mexico. The cores were analyzed for 32 major, trace, and rare earth elements (As, La, Lu, Nd, Sm, U, Yb, Ce, Co, Cr, Cs, Eu, Fe, Hf, Rb, Sb, Sc, Sr, Ta, Tb, Th, Zn, Zr, Al, Ba, Ca, Dy, K, Mn, Na, Ti, V) in order to estimate the health risk. The samples were analyzed by instrument neutron activation analysis using thermal neutron fluxes of 8 x 10{sup 13} and 5 x 10{sup 13} n cm{sup -2} s{sup -1} for short and long irradiations, respectively. The results of the contamination levels for elements such as As, Ba, Cr, Fe, Mn, Ta, V, and Zn were compared with the Mexican regulations and the guidelines of US EPA. (Author)

  4. Major, trace and rate earth elements in sediments of the Julian Adame-Alatorre dam by instrumental neutron activation analysis

    International Nuclear Information System (INIS)

    Mireles, F.; Pinedo, J. L.; Davila, J. I.; Oliva, J. E.; Speakman, R. J.; Glascock, M. D.

    2010-10-01

    The rapid industrial development in regions of Mexico during recent years has had the side effect of introducing toxic metals, fertilizers, and pesticides into the ecosystem. Sediment cores were collected from eight locations around the Julian Adame-Alatorre dam located in Municipality of Villanueva in the Zacatecas State, Mexico. The cores were analyzed for 32 major, trace, and rare earth elements (As, La, Lu, Nd, Sm, U, Yb, Ce, Co, Cr, Cs, Eu, Fe, Hf, Rb, Sb, Sc, Sr, Ta, Tb, Th, Zn, Zr, Al, Ba, Ca, Dy, K, Mn, Na, Ti, V) in order to estimate the health risk. The samples were analyzed by instrument neutron activation analysis using thermal neutron fluxes of 8 x 10 13 and 5 x 10 13 n cm -2 s -1 for short and long irradiations, respectively. The results of the contamination levels for elements such as As, Ba, Cr, Fe, Mn, Ta, V, and Zn were compared with the Mexican regulations and the guidelines of US EPA. (Author)

  5. Atmospheric study of the impact of Borneo vortex and Madden-Julian oscillation over Western Indonesian maritime area

    Science.gov (United States)

    Saragih, R. M.; Fajarianti, R.; Winarso, P. A.

    2018-03-01

    During the Asian winter Monsoon (November-March), the Indonesia Maritime Continent is an area of deep convection. In that period, there is a synoptic scale disturbance over Northwest of Borneo Island called Borneo vortex. In addition to the impact of Asian Winter Monsoon, Madden-Julian Oscillation (MJO) also have an impact on deep convection during an active period. This study aims to study the impact of interaction Borneo vortex and MJO (during MJO active period in phase 3, 4 and 5) and rainfall condition over the western part of Indonesia Maritime Continent using compositing technique in the period of November-March 2015/2016. The parameters used to identify the incidence of Borneo vortex, MJO, and its interaction is vertical velocity. When MJO is active, Borneo vortex occurs most often in phase 5 and at least in phase 3. However, Borneo vortex occurs most often when the MJO is inactive. The interaction between Borneo vortex and MJO seems may affect not so much rainfall occurrence in the western part of IMC.

  6. Identifying a key physical factor sensitive to the performance of Madden-Julian oscillation simulation in climate models

    Science.gov (United States)

    Kim, Go-Un; Seo, Kyong-Hwan

    2018-01-01

    A key physical factor in regulating the performance of Madden-Julian oscillation (MJO) simulation is examined by using 26 climate model simulations from the World Meteorological Organization's Working Group for Numerical Experimentation/Global Energy and Water Cycle Experiment Atmospheric System Study (WGNE and MJO-Task Force/GASS) global model comparison project. For this, intraseasonal moisture budget equation is analyzed and a simple, efficient physical quantity is developed. The result shows that MJO skill is most sensitive to vertically integrated intraseasonal zonal wind convergence (ZC). In particular, a specific threshold value of the strength of the ZC can be used as distinguishing between good and poor models. An additional finding is that good models exhibit the correct simultaneous convection and large-scale circulation phase relationship. In poor models, however, the peak circulation response appears 3 days after peak rainfall, suggesting unfavorable coupling between convection and circulation. For an improving simulation of the MJO in climate models, we propose that this delay of circulation in response to convection needs to be corrected in the cumulus parameterization scheme.

  7. Enhancement of vegetation-rainfall feedbacks on the Australian summer monsoon by the Madden-Julian Oscillation

    Science.gov (United States)

    Notaro, Michael

    2018-01-01

    A regional climate modeling analysis of the Australian monsoon system reveals a substantial modulation of vegetation-rainfall feedbacks by the Madden Julian Oscillation (MJO), both of which operate at similar sub-seasonal time scales, as evidence that the intensity of land-atmosphere interactions is sensitive to the background atmospheric state. Based on ensemble experiments with imposed modification of northern Australian leaf area index (LAI), the atmospheric responses to LAI anomalies are composited for negative and positive modes of the propagating MJO. In the regional climate model (RCM), northern Australian vegetation feedbacks are characterized by evapotranspiration (ET)-driven rainfall responses, with the moisture feedback mechanism dominating over albedo and roughness feedback mechanisms. During November-April, both Tropical Rainfall Measuring Mission and RCM data reveal MJO's pronounced influence on rainfall patterns across northern Australia, tropical Indian Ocean, Timor Sea, Arafura Sea, and Gulf of Carpentaria, with the MJO dominating over vegetation feedbacks in terms of regulating monsoon rainfall variability. Convectively-active MJO phases support an enhancement of positive vegetation feedbacks on monsoon rainfall. While the MJO imposes minimal regulation of ET responses to LAI anomalies, the vegetation feedback-induced responses in precipitable water, cloud water, and rainfall are greatly enhanced during convectively-active MJO phases over northern Australia, which are characterized by intense low-level convergence and efficient precipitable water conversion. The sub-seasonal response of vegetation-rainfall feedback intensity to the MJO is complex, with significant enhancement of rainfall responses to LAI anomalies in February during convectively-active MJO phases compared to minimal modulation by the MJO during prior and subsequent calendar months.

  8. Influences of the ENSO, oscillation Madden-Julian, waves of the east, hurricanes and moon phases on the diurnal cycle of precipitation at the tropical Andes of Colombia

    International Nuclear Information System (INIS)

    Poveda, German; Mesa, Oscar; Agudelo, Paula; Alvarez, Juan; Arias, Paola; Moreno, Hernan; Salazar, Luis; Toro, Vladimir; Vieira, Sara

    2002-01-01

    We study the effects of large-scale ocean-atmospheric, astronomic phenomena on the diurnal cycle of precipitation at the tropical Andes of Colombia. Such phenomena include both phases of El Nino/Southern Oscillation (ENSO), namely El Nino and La Nina, the intra seasonal Madden-Julian oscillation, tropical easterly waves (4-8 days), moon phases and hurricanes over the Atlantic and eastern pacific oceans. We found a clear-cut effect of both ENSO phases: El Nino is associated with a diminished rainfall diurnal cycle, and La Nina intensifies it. Thus, ENSO modulates precipitation in Colombia at timescales ranging from hours to decades. We identified a close association with different phases of the Madden-Julian oscillation, as the diurnal cycle is intensified (larger amplitude) during its westerly phase, but it gets decreased during its easterly phase. For both ENSO and the Madden-Julian oscillation we identified a clear-cut influence on the amplitude of the diurnal cycle, yet the phase is conserved for the most part. Tropical easterly waves appear to affect the diurnal cycle, but no clear overall signal is pervasive throughout the region. We al so found a significant statistical association with hurricanes occurring over the northeastern pacific ocean with the diurnal cycle of precipitation at rain gages located over the eastern slope of the eastern range of the Colombian Andes. Rainfall at all the remaining slopes of the Andes is statistically associated with hurricanes occurring at the tropical north Atlantic and the Caribbean Sea. Moon phases are not statistically associated with the diurnal cycle and daily total rainfall

  9. The Modulation of Tropical Storm Activity in the Western North Pacific by the Madden-Julian Oscillation in GEOS-5 AGCM Experiments

    Science.gov (United States)

    Kim, Dongmin; Lee, Myong-In; Kim, Hye-Mi; Schubert, Siegfried D.; Yoo, Jin Ho

    2014-01-01

    This study examines the influence of the Madden-Julian Oscillation (MJO) on tropical storm (TS) activity in the western North Pacific, using observations and GEOS-5 simulations at 50-km horizontal resolution. While GEOS-5 produces an MJO of faster propagation and weaker amplitude, it nevertheless reproduces the observed modulation of TS activity by the MJO with the highest TS genesis and increased track density in the active phases of MJO. The study suggests that the simulation of the sub-seasonal variability of TS activity could be improved by improving the simulations of the MJO in climate models.

  10. Underground gas storage Uelsen: Findings from planning, building and commissioning the surface buildings and structures; Untertagegasspeicher (UGS) Uelsen: Erkenntnisse aus Planung, Bau und Inbetriebnahme der obertaegigen Anlagen

    Energy Technology Data Exchange (ETDEWEB)

    Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)

    1998-12-31

    The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)

  11. Creation of a magnetic barrier at a noble q close to physical midpoint between two resonant surfaces in the ASDEX UG tokamak

    Science.gov (United States)

    Vazquez, Justin; Ali, Halima; Punjabi, Alkesh

    2009-11-01

    Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.

  12. The Influence of the Madden-Julian Oscillation (mjo) on Extreme Rainfall Over the Central and Southern Peruvian Andes

    Science.gov (United States)

    Heidinger, H.; Jones, C.; Carvalho, L. V.

    2015-12-01

    Extreme rainfall is important for the Andean region because of the large contribution of these events to the seasonal totals and consequent impacts on water resources for agriculture, water consumption, industry and hydropower generation, as well as the occurrence of floods and landslides. Over Central and Southern Peruvian Andes (CSPA), rainfall exceeding the 90th percentile contributed between 44 to 100% to the total Nov-Mar 1979-2010 rainfall. Additionally, precipitation from a large majority of stations in the CSPA exhibits statistically significant spectral peaks on intraseasonal time-scales (20 to 70 days). The Madden-Julian Oscillation (MJO) is the most important intraseasonal mode of atmospheric circulation and moist convection in the tropics and the occurrence of extreme weather events worldwide. Mechanisms explaining the relationships between the MJO and precipitation in the Peruvian Andes have not been properly described yet. The present study examines the relationships between the activity and phases of the MJO and the occurrence of extreme rainfall over the CSPA. We found that the frequency of extreme rainfall events increase in the CSPA when the MJO is active. MJO phases 5, 6 and 7 contribute to the overall occurrence of extreme rainfall events over the CSPA. However, how the MJO phases modulate extreme rainfall depends on the location of the stations. For instance, extreme precipitation (above the 90th percentile) in stations in the Amazon basin are slightly more sensitive to phases 2, 3 and 4; the frequency of extremes in stations in the Pacific basin increases in phases 5, 6 and 7 whereas phase 2, 3 and 7 modulates extreme precipitation in stations in the Titicaca basin. Greater variability among stations is observed when using the 95th and 99th percentiles to identify extremes. Among the main mechanisms that explain the increase in extreme rainfall events in the Peruvian Andes is the intensification of the easterly moisture flux anomalies, which

  13. Processes controlling the surface temperature signature of the Madden-Julian oscillation in the thermocline ridge of the Indian Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Jayakumar, A.; Gnanaseelan, C. [Indian Institute of Tropical Meteorology, Pune (India); Vialard, Jerome; Lengaigne, M. [CNRS, UPMC, IRD, Case 100, Universite P. et M. Curie, Laboratoire d' Oceanographie Experimentation et Approches Numeriques, LOCEAN, Paris Cedex 05 (France); National Institute of Oceanography, Goa (India); McCreary, Julian P. [University of Hawaii, International Pacific Research Centre, Hawaii (United States); Praveen Kumar, B. [National Institute of Oceanography, Goa (India)

    2011-12-15

    During boreal winter, there is a prominent maximum of intraseasonal sea-surface temperature (SST) variability associated with the Madden-Julian Oscillation (MJO) along a Thermocline Ridge located in the southwestern Indian Ocean (5 S-10 S, 60 E-90 E; TRIO region). There is an ongoing debate about the relative importance of air-sea heat fluxes and oceanic processes in driving this intraseasonal SST variability. Furthermore, various studies have suggested that interannual variability of the oceanic structure in the TRIO region could modulate the amplitude of the MJO-driven SST response. In this study, we use observations and ocean general circulation model (OGCM) experiments to quantify these two effects over the 1997-2006 period. Observational analysis indicates that Ekman pumping does not contribute significantly (on average) to intraseasonal SST variability. It is, however, difficult to quantify the relative contribution of net heat fluxes and entrainment to SST intraseasonal variability from observations alone. We therefore use a suite of OGCM experiments to isolate the impacts of each process. During 1997-2006, wind stress contributed on average only about 20% of the intraseasonal SST variability (averaged over the TRIO region), while heat fluxes contributed about 70%, with forcing by shortwave radiation (75%) dominating the other flux components (25%). This estimate is consistent with an independent air-sea flux product, which indicates that shortwave radiation contributes 68% of intraseasonal heat flux variability. The time scale of the heat-flux perturbation, in addition to its amplitude, is also important in controlling the intraseasonal SST signature, with longer periods favouring a larger response. There are also strong year-to-year variations in the respective role of heat fluxes and wind stress. Of the five strong cooling events identified in both observations and the model (two in 1999 and one in 2000, 2001 and 2002), intraseasonal-wind stress dominates

  14. Role of the atmospheric mean state on the initiation of the Madden-Julian oscillation in a tropical channel model

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Pallav; Zhang, Chidong [University of Miami, RSMAS/MPO, Miami, FL (United States); Moncrieff, Mitchell W.; Dudhia, Jim; Caron, Julie M.; Bruyere, Cindy [National Center for Atmospheric Research, Boulder, CO (United States); Ruby Leung, L. [Pacific Northwest National Laboratory, Richland, WA (United States)

    2011-01-15

    Tropical channel models, defined as models that are global in the zonal direction but bounded in the meridional direction, are particularly useful for simulating the Madden-Julian oscillation (MJO) and understanding its physical and dynamical basis. Influences from the extratropics through the lateral boundaries have been found to be essential to the reproduction of the initiation of certain MJO events. This led to a hypothesis that multi-year simulations using a tropical channel model would reproduce reasonable MJO statistics under the influence of prescribed lateral boundary conditions derived from global reanalyses. Interestingly, the MJO statistics in such a multi-year simulation by a high-resolution tropical channel model are not better than those from global climate models. The error in the atmospheric mean state is found to be a possible reason for the poor MJO statistics in the simulation. Nevertheless, even with a large error in the mean state, the multi-year simulation captures two MJO events previously found to be initiated by extratropical influences. However, the model does not reproduce a third event, whose initiation is not directly influenced by the extratropics. This implies that in the absence of dynamical interactions between the MJO and the lateral boundary conditions, the error in the mean state could be sufficient to prevent the MJO initiation. To explore this third MJO event further, a series of sensitivity tests are conducted. These tests show that the simulation of this event is neither critically influenced by the cumulus parameterization employed, nor the initial conditions when the model is integrated 2 weeks prior to the MJO initiation. The model captures this event when the MJO signal is already present in the initial conditions. The use of high-resolution sea surface temperature does not improve the simulation of the third MJO event. A higher-resolution nested domain covering the Indo-Pacific warm pool region and including a cloud

  15. Advanced MicroObserver UGS integration with and cueing of the BattleHawk squad level loitering munition and UAV

    Science.gov (United States)

    Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean

    2014-06-01

    Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro

  16. Dohmen, Dieter, Erbes, Annegret, Fuchs, Kathrin & Günzel, Juliane (2008). Was wissen wir über Nachhilfe? Sachstand und Auswertung der Forschungsliteratur zu Angebot, Nachfrage und Wirkungen. Bielefeld: Bertelsmann, 150 S. [Rezension

    OpenAIRE

    Mayr, Thomas

    2014-01-01

    Rezension von Dohmen, Dieter, Erbes, Annegret, Fuchs, Kathrin & Günzel, Juliane (2008). Was wissen wir über Nachhilfe? Sachstand und Auswertung der Forschungsliteratur zu Angebot, Nachfrage und Wirkungen. Bielefeld: Bertelsmann, 150 S. 29,90 EUR, ISBN 978-3763936656

  17. Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów

    OpenAIRE

    Idzik, Beata

    2014-01-01

    Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...

  18. Rezension zu: Juliane Witzke: Paratext Literaturkritik Markt. Inszenierungspraktiken der Gegenwart am Beispiel Judith Hermanns. Würzburg: Verlag Königshausen & Neumann 2017.

    Directory of Open Access Journals (Sweden)

    Sandra Folie

    2017-06-01

    Full Text Available Juliane Witzke untersucht am Beispiel von Judith Hermanns Œuvre (1998–2014 die paratextuellen Inszenierungsstrategien der Gegenwart. Ihre Monographie schließt nicht nur eine Forschungslücke im Hinblick auf die wissenschaftliche Auseinandersetzung mit der Autorin, sondern bereichert auch die methodologische Fachdiskussion innerhalb der Literaturwissenschaften; ihr Analyseinstrumentarium ist vielseitig einsetzbar. Eine besondere Stärke der Untersuchung stellt zudem die umfassende Berücksichtigung medialer Veränderungen (z. B. Leser_innen als Kritiker_innen dar. Die immer wieder angesprochenen Genderaspekte – insbesondere die Interpretation von Hermanns gewandelter Strategie als erfolgreiche Inszenierung von ‚Natürlichkeit‘ – hätten stellenweise einer eingehenderen gendertheoretischen Reflexion bedurft.

  19. Wpływ informatyzacji Biblioteki Uniwersyteckiej w Poznaniu na zmiany organizacyjne i rozwój usług bibliotecznych

    Directory of Open Access Journals (Sweden)

    Piotr Karwasiński

    2015-12-01

    Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.

  20. Molecular Cytogenetic Characterization of two Triticum-Secale-Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99.

    Science.gov (United States)

    Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin

    2017-01-01

    Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  1. Les relations du sculpteur américain George Julian Zolnay avec la Roumanie, son pays natal

    Directory of Open Access Journals (Sweden)

    Adrian-Silvan Ionescu

    2011-01-01

    Full Text Available Born on 4th of July 1862 in Bucharest, of a former 1848 Hungarian revolutionist father, and a Romanian mother, George Julian Zolnay was a graduate of the School of Fine Arts and a good violin player too. While following the sculpture classes of the Vienna Fine Arts Academy his professor recommended him to go to the United States to give a helping hand to the completion of the 1893 Chicago Columbian Exhibition. He settled there and in 1897 received his American citizenship. Zolnay eventually became a reputed American sculptor but he had never forgotten his native country. On the contrary, he kept a constant correspondence with former friends, colleagues and army comrades. As a tribute to his native country, in 1899, he offered to the Art Museum in Bucharest a gesso model of his most recent sculpture. Called Grief, his work was a funerary monument for Winnie Davis’s tomb in Hollywood Cemetery in Richmond, Virginia. His gift was gratefully received and King Carol I awarded him the Bene Merenti Medal. This distinction made a great sensation among his American colleagues from the Arts Club in New York who offered a dinner in his honor. In 1902, while paying a visit to Romania, he was received by King Carol in a private audience at the Peleș Castle in Sinaia. Years later, in 1929, Zolnay wrote a comprehensive autobiography for his two daughters in which he described this important event in his life. King Carol seemed interested in everything American and asked him a lot of questions on various topics thus prolonging the meeting to more than an hour, a fact which was unheard at the Romanian Court where stern rules where duly observed.In 1911 he planned another visit to Romania, to show it to his wife and introduce her to his family. The young lady prepared a Romanian folk costume, precious wedding gift from her mother-in-low, to wear at the audience to the Royal Court. But a cholera epidemic prevented the Zolnays to travel down the Danube and all

  2. A novel Robertsonian translocation event leads to transfer of a stem rust resistance gene (Sr52) effective against race Ug99 from Dasypyrum villosum into bread wheat.

    Science.gov (United States)

    Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S

    2011-06-01

    Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.

  3. Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

    DEFF Research Database (Denmark)

    Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

    2004-01-01

    Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

  4. Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

    Directory of Open Access Journals (Sweden)

    Teresa Kiziukiewicz

    2009-03-01

    Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

  5. Identification and mapping of Sr46 from Aegilops tauschii accession CIae 25 conferring resistance to race TTKSK (Ug99) of wheat stem rust pathogen.

    Science.gov (United States)

    Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S

    2015-03-01

    Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.

  6. Molecular Cytogenetic Characterization of two Triticum–Secale–Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99

    Directory of Open Access Journals (Sweden)

    Yi Dai

    2017-05-01

    Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

  7. Playing with Quantum Toys: Julian Schwinger's Measurement Algebra and the Material Culture of Quantum Mechanics Pedagogy at Harvard in the 1960s

    Science.gov (United States)

    Gauvin, Jean-François

    2018-03-01

    In the early 1960s, a PhD student in physics, Costas Papaliolios, designed a simple—and playful—system of Polaroid polarizer filters with a specific goal in mind: explaining the core principles behind Julian Schwinger's quantum mechanical measurement algebra, developed at Harvard in the late 1940s and based on the Stern-Gerlach experiment confirming the quantization of electron spin. Papaliolios dubbed his invention "quantum toys." This article looks at the origins and function of this amusing pedagogical device, which landed half a century later in the Collection of Historical Scientific Instruments at Harvard University. Rendering the abstract tangible was one of Papaliolios's demonstration tactics in reforming basic teaching of quantum mechanics. This article contends that Papaliolios's motivation in creating the quantum toys came from a renowned endeavor aimed, inter alia, at reforming high-school physics training in the United States: Harvard Project Physics. The pedagogical study of these quantum toys, finally, compels us to revisit the central role playful discovery performs in pedagogy, at all levels of training and in all fields of knowledge.

  8. Overview of Proposal on High Resolution Climate Model Simulations of Recent Hurricane and Typhoon Activity: The Impact of SSTs and the Madden Julian Oscillation

    Science.gov (United States)

    Schubert, Siegfried; Kang, In-Sik; Reale, Oreste

    2009-01-01

    This talk gives an update on the progress and further plans for a coordinated project to carry out and analyze high-resolution simulations of tropical storm activity with a number of state-of-the-art global climate models. Issues addressed include, the mechanisms by which SSTs control tropical storm. activity on inter-annual and longer time scales, the modulation of that activity by the Madden Julian Oscillation on sub-seasonal time scales, as well as the sensitivity of the results to model formulation. The project also encourages companion coarser resolution runs to help assess resolution dependence, and. the ability of the models to capture the large-scale and long-terra changes in the parameters important for hurricane development. Addressing the above science questions is critical to understanding the nature of the variability of the Asian-Australian monsoon and its regional impacts, and thus CLIVAR RAMP fully endorses the proposed tropical storm simulation activity. The project is open to all interested organizations and investigators, and the results from the runs will be shared among the participants, as well as made available to the broader scientific community for analysis.

  9. Madden-Julian Oscillation (MJO) Signal over Kototabang, West Sumatera Based on the Mini Automatic Weather Station (MAWS) Data Analysis Using the Wavelet Technique

    Science.gov (United States)

    Hermawan, E.

    2018-04-01

    This study is mainly concerned an application of Mini Automatic Weather Station (MAWS) at Kototabang, West Sumatera nearby the location of an Equatorial Atmosphere Radar (EAR) side. We are interest to use this data to investigate the propagation of the Madden-Julian Oscillation (MJO). We examined of daily MAWS data for 3 years observations started from January 2001 to Mei 2004. By applying wavelet analysis, we found the MJO at Kototabang have 32 days oscillations as shown in Fig.1 below. In this study, we concentrate just for local mechanis only. We will show in this paper that at the phase of the MJO with a dipole structure to the convection anomalies, there is enhanced tropical convection over the eastern Indian Ocean and reduced convection over the western Pacific. Over the equatorial western Indian Ocean, the equatorial Rossby wave response to the west of the enhanced convection includes a region of anomalous surface divergence associated with the anomalous surface westerlies and pressure ridge. This tends to suppress ascent in the boundary layer and shuts off the deep convection, eventually leading to a convective anomaly of the opposite sign. Over the Indonesian sector, the equatorial Kelvin wave response to the east of the enhanced convection includes a region of anomalous surface convergence into the anomalous equatorial surface easterlies and pressure trough, which will tend to favour convection in this region. The Indonesian sector is also influenced by an equatorial Rossby wave response (of opposite sign) to the west of the reduced convection over the western Pacific, which also has a region of anomalous surface convergence associated with its anomalous equatorial surface easterlies and pressure trough. Hence, convective anomalies of either sign tend to erode themselves from the west and initiate a convective anomaly of opposite sign via their equatorial Rossby wave response, and expand to the east via their equatorial Kelvin wave response.

  10. Variability of Oceanic Mesoscale Convective System Vertical Structures Observed by CloudSat in Indo-Pacific Regions Associated with the Madden-Julian Oscillation

    Science.gov (United States)

    Yuan, J.

    2016-12-01

    Vertical structures of mesoscale convective systems (MCSs) during the Madden-Julian-Oscillation (MJO) are investigated using 2006-2011 CloudSat radar measurements for Indo-Pacific oceanic areas. In active phases of the MJO relatively more large MCSs and connected MCSs occur. The frequency of occurrence of connected MCSs peaks in the onset phase, a phase earlier than separated MCSs. Compared to separated MCSs, connected MCSs in all sizes have weaker reflectivity above 8 km in their deep precipitating portions and thick anvil clouds closely linked to them, suggesting more "stratiform" physics associated with them. Separated MCSs and connected MCSs together produce relatively the least anvil clouds in the onset phase while their deep precipitating portions show stronger/weaker reflectivity above 8 km before/after the onset phase. Thus after the onset phase of the MJO, MCSs shift toward more "convective" organization because separated MCSs maximize after the onset, while their internal structures appear more "stratiform" because internally they have weaker reflectivity above 8km. Connected MCSs coincide with a more humid middle troposphere spatially, even at the same places a few days before they occur. Middle-tropospheric moistening peaks in the onset phase. Moistening of the free troposphere around deep convective systems shows relatively stronger moistening/drying below the 700 hPa before/after the onset phase compared to domain-mean averages. Lower-topped clouds occur most frequently around CMCSs and in active phases, consistent with the presence of a moister free troposphere. Coexistence of these phenomena suggests that the role of middle troposphere moisture in the formation of CMCSs needs to be better understood.

  11. Variability of oceanic deep convective system vertical structures observed by CloudSat in Indo-Pacific regions associated with the Madden-Julian oscillation

    Science.gov (United States)

    Yuan, Jian

    2016-09-01

    Vertical structures of deep convective systems during the Madden-Julian oscillation (MJO) are investigated using CloudSat radar measurements in Indo-Pacific oceanic areas. In active phases of the MJO, relatively more large systems and connected mesoscale convective systems (CMCSs) occur. The occurrence frequency of CMCSs peaks in the onset phase, a phase earlier than separated mesoscale convective systems (SMCSs). Compared with SMCSs, CMCSs of all sizes have weaker reflectivity above 8 km in their deep precipitating portions and thick anvil clouds closely linked to them, suggesting more "stratiform" physics associated with them. SMCSs and CMCSs together produce relatively the least anvil clouds in the onset phase, while their deep precipitating portions show stronger/weaker reflectivity above 8 km before/after the onset phase. Thus, after the onset phase of the MJO, mesoscale convective systems shift toward a more "convective" organization because SMCSs maximize after the onset, while their internal structures appear more stratiform because internally they have weaker reflectivity above 8 km. CMCSs coincide with a more humid middle troposphere spatially, even at the same locations a few days before they occur. Middle-tropospheric moistening peaks in the onset phase. Moistening of the free troposphere around deep convective systems shows relatively stronger moistening/drying below 700 hPa before/after the onset phase than domain-mean averages. Low-topped clouds occur most frequently around CMCSs and in active phases, consistent with the presence of a moister free troposphere. Coexistence of these phenomena suggests that the role of middle troposphere moisture in the formation of CMCSs should be better understood.

  12. Intraseasonal variability of upper-ocean currents and photosynthetic primary production along the U.S. west coast associated with the Madden-Julian Oscillation

    Science.gov (United States)

    Barrett, B.; Davies, A. R.; Steppe, C. N.; Hackbarth, C.

    2017-12-01

    In the first part of this study, time-lagged composites of upper-ocean currents from February to May of 1993-2016 were binned by active phase of the leading atmospheric mode of intraseasonal variability, the Madden-Julian Oscillation (MJO). Seven days after the convectively active phase of the MJO enters the tropical Indian Ocean, anomalously strong south-southeastward upper-ocean currents are observed along the majority of U.S. west coast. Seven days after the convectively active phase enters the tropical western Pacific Ocean, upper-ocean current anomalies reverse along the U.S. west coast, with weaker southward flow. A physical pathway to the ocean was found for both of these: (a) tropical MJO convection modulates upper-tropospheric heights and circulation over the Pacific Ocean; (b) those anomalous atmospheric heights adjust the strength and position of the Aleutian Low and Hawaiian High; (c) surface winds change in response to the adjusted atmospheric pressure patterns; and (d) those surface winds project onto upper-ocean currents. In the second part of this study, we investigated if the MJO modulated intraseasonal variability of surface wind forcing and upper-ocean currents projected onto phytoplankton abundance along the U.S. west coast. Following a similar methodology, time-lagged, level 3 chlorophyll-a satellite products (a proxy for photosynthetic primary production) were binned by active MJO phase and analyzed for statistical significance using the Student's t test. Results suggest that intraseasonal variability of biological production along the U.S. west coast may be linked to the MJO, particularly since the time scale of the life cycle of phytoplankton is similar to the time scale of the MJO.

  13. Um caso político-cultural na antiguidade tardia: o Imperador Juliano e seu conceito de educação = A political-culture case from late antiquity: the emperor julian and his concept of education

    Directory of Open Access Journals (Sweden)

    Margarida Maria de Carvalho

    2010-01-01

    Full Text Available Nesse artigo tenho como propósito conceituar o que é Paideiaou educação na concepção do Imperador Juliano. Para tanto trabalharei o significado de Logos cristão e Logos grego me utilizando também do discurso Contra Juliano de Gregório de Nazianzo. Verificar se a que o embate ocorrido entre Gregório Nazianzeno e Juliano foi político-religioso e, não somente religioso, pois nesse momento do século IV d. C. não havia separação dessas esferas. O texto está dividido em Considerações Preliminares, onde disserto que o conflito entre os dois autores é político-cultural; O Imperador Juliano e a Historiografia sobre seu Tempo, no qual demonstro que desde o próprio período do Imperador Juliano há uma construção mítica em torno de sua pessoa e, finalmente, sobre o propósito de Nazianzo em escreverContra Juliano. Todos esses pontos interligados levam à compreensão deste momento político específico da Antiguidade Tardia.In this article, I propose to appraise Emperor Julian’s conception of Paideiaor education. To this end, I will work from the meanings of theChristian Logos and the Greek Logos making use also of Gregory Nazianzen’s Against Julian, verifying whether the clash that occurred between Gregory Nazianzen and Julian was not only religious but politico-religious, taking into account that at that point of the 4th century AD no separation of these spheres had yet existed. The text is divided into Preliminary Considerations, where I argue that the conflict between the two authors is political-cultural; The Emperor Julian and the Historiography about his times, in which I demonstrate that since the Emperor Julian’s own time there was a myth built around him, and finally about Nazianzen’s purpose of writing Against Julian. All of these interlinked points lead to the comprehension of this specific political moment of Late Antiquity.

  14. Extratropical response to Fast and Slow episodes of Madden-Julian Oscillation in observation and using intervention experiments with CFSv2

    Science.gov (United States)

    Yadav, P.; Straus, D. M.

    2017-12-01

    The Madden-Julian Oscillation (MJO) is a potential source of predictability in the extratropics in extended range weather forecasting. The nature of MJO is sporadic and therefore, the mid-latitude response may depend on the nature of the MJO event, in particular the phase speed. We discuss the results of our observational and modeling study of mid-latitude circulation response to Fast and Slow MJO episodes using wintertime ERA-Interim reanalysis data and the CFSv2 coupled model of NOAA. The observational study shows that the mid-latitude response to different propagating speeds is not the same. The propagation speed is defined by the time the OLR takes to propagate from phase 3 to phase 6. The mid-latitude response is assessed in terms of composite maps and frequency of occurrence of robust circulation regimes. Fast episode composite anomalies of 500hPa height show a developing Rossby wave in the mid-Pacific with downstream propagation through MJO phases 2- 4. Development of NAO+ teleconnection pattern is stronger in Slow that in Fast MJO episodes, and occurs with a greater time lag after MJO heating is in the Indian Ocean (phase 3). Previous results find an increase in occurrence of NAO- regime following phase 6. We have found that much of this behavior is due to the slow episodes. Based on these observational results, intervention experiments using CFSv2 are designed to better understand the impact of heating/cooling and to estimate mid-latitude response to Fast and Slow MJO episodes. The added heating experiments consist of 31 year reforecasts for December 1 initial conditions from CFS reanalysis (1980-2011) in which the identical MJO evolution of three-dimensional diabatic heating has been added, thus producing fast and slow MJO episodes with well-defined phase speeds. We will discuss the results of these experiments with a focus on understanding the role of phase speed and interference in setting up the response, and to understand the mechanisms that

  15. Precipitation in Santa Barbara, CA on varying timescales and the relationships with the El Niño Southern Oscillation, the Madden-Julian Oscillation, and atmospheric rivers

    Science.gov (United States)

    Harris, S. M.; Carvalho, L. V.; Jones, C.

    2013-12-01

    This study aimed to understand the patterns and variations of extreme precipitation events that occur in Santa Barbara County and determine the relationships with various phenomena that affect the region. Santa Barbara, CA is an area with complex topography that is disposed to numerous hazard events including landslides and flooding, particularly during the region's rainy season (Nov.-Apr.). These incidents are especially frequent in the seasons after fire-events, another hazard common to the region. In addition, Santa Barbara is affected by several tropical phenomena that influence precipitation on varying timescales including the El Niño Southern Oscillation (ENSO), the Madden-Julian Oscillation (MJO), and atmospheric rivers (ARs). It is well known that ENSO and the MJO influence storms that occur in southern California through processes such as the modulation of the upper level jet and the low level moisture flux. ARs have been revealed to be responsible for the movement of large quantities of water vapor from tropical areas to the midlatitudes and have been linked to high-intensity storms throughout the western coast of North America. We examined rainy season (Nov.-Apr.) precipitation within Santa Barbara County using hourly rainfall data spanning approximately forty years (~1971-2010) from seven, local, rain gauge stations. The distributions as well as totals of precipitation on varying timescales (hourly, daily, seasonal, and yearly) were defined for specified intensities of rainfall based upon the 75th, 90th, 95th, and 99th percentiles. Persistence, expressed as the number of consecutive hours (or days) including intense precipitation defined according to the percentiles, was investigated on the hourly and daily timescales. In addition, specified storm episodes identified in this study were examined with data from the Tropical Rainfall Measurement Mission in order to assess the spatial features of high-intensity storms. Results from this analysis will be

  16. Oil use of the effluent plant ETEO (Effluent Station of Oil Treatment) as combustible for generation of energy in the power plant UG-50Hz; Utulizacao de oleo da ETEO (Estacao de Tratamento de Efluentes Oleosos) para geracao de energia na UG-50Hz

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Jose Francisco de; Nascimento, Jose Maria do; Silva, Luiz Antonio da; Salazar, Marcos Vinicios; Baptista, Reinaldo Lopes; Barros, Sueli Aguiar [Companhia Siderurgica Nacional (CSN), Volta Redonda, RJ (Brazil)

    2009-11-01

    The areas of finishing products of CSN Steel Plant generate contaminated effluents with oil and grease , that are treated in ETEO (Effluent Station of Oil Treatment). In this plant, the oil is processed to be sold for the consuming market. However, some seasons of the year, the market does not absorb the oil, and CSN is obliged to defray the burning of this oil, to not interrupt the productive process and cause an environmental impact. Because of this situation, we search alternatives for the viable use of this oil inside CSN steel plant, taking care for the security of the processes and the impact to the environment. This paper describes the details of the work and the implantation of the burning of this oil of the ETEO with BPF oil (type of petrochemical oil) as combustible in the boiler 7 of the power plant UG 50 Hz. For the implantation of this project, operational contingencies of security for equipment was prepared . Moreover, the work included chemical analyses of the oil and the conditions of the boiler using this mixing of oils. The reached results demonstrate the total viability of this project and it was proved another alternative of the use of this residue, with reduction of the fuel costs , steam costs and the electric energy generated in the power plant of CSN. (author)

  17. Effect of high-dose ginsenoside complex (UG0712 supplementation on physical performance of healthy adults during a 12-week supervised exercise program: A randomized placebo-controlled clinical trial

    Directory of Open Access Journals (Sweden)

    Eon Sook Lee

    2018-04-01

    Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial

  18. Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI

    Directory of Open Access Journals (Sweden)

    Halina Waniak-Michalak

    2017-06-01

    Full Text Available Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI The involvement of corporations in corporate social responsibility (CSR activities with respect for work- ers' rights and ethical principles brings tangible benefits to the enterprise. CSR activities can therefore be considered as an investment, the effects of which should be measured. CSR benefits derive from im- proved assessment of the corporation by the stakeholders and increased social trust. However, in order to achieve the desired results of CSR activities, it is necessary to provide adequate information to customers, employees and owners. Moreover, the measurement of CSR results is necessary to determine the effec- tiveness of the actions taken. The aim of the article was to answer the question if companies present the same measures in successive CSR reports and whether it is possible to compare the CSR activity results for successive years. Examination of 31 CSR reports for two consecutive editions of the reporting showed that companies change the number and type of disclosed measures.

  19. Language specific bootstraps for UG categories

    NARCIS (Netherlands)

    van Kampen, N.J.

    2005-01-01

    This paper argues that the universal categories N/V are not applied to content words before the grammatical markings for reference D(eterminers) and predication I(nflection) have been acquired (van Kampen, 1997, contra Pinker, 1984). Child grammar starts as proto-grammar with language-specific

  20. Email: pattuquayefio@ug.edu.gh

    African Journals Online (AJOL)

    Apusigah

    making. ... study, the article hints at possible implications of the co-optation of human ... shortage, health challenges such as the Human Immunodeficiency Virus (HIV), and the causes ... appropriate framework for considering such challenges.

  1. Obituary: Thomas Julian Ahrens (1936-2010)

    Science.gov (United States)

    Jeanloz, Raymond; Asimow, Paul

    2011-12-01

    Thomas J. Ahrens, a leader in the use of shock waves to study planetary interiors and impact phenomena, died at his home in Pasadena, California on November 24, 2010, at the age of 74. He was the California Institute of Technology's Fletcher Jones Professor of Geophysics, formally emeritus since 2005 but professionally active to the end. Tom was a pioneer in experimental and numerical studies of the effects of hypervelocity impact, arguably the most important geophysical process in the formation, growth and - in many cases - surface evolution of planets. As a professor at Caltech, he established the foremost university laboratory for shock wave experiments, where students and research associates from around the world pursued basic research in geophysics, planetary science and other disciplines. Previously, high-pressure shock experiments were primarily conducted in national laboratories, where they were initially associated with development of nuclear weapons. The shock wave laboratory at Caltech was noted for key measurements addressing major questions in planetary geophysics. Equation-of-state studies on silicate melts showed that magma deep in Earth's mantle could be denser than the coexisting crystals, implying downward transport of melts (and associated heat) rather than the upward eruption of lavas observed in volcanic regions at Earth's surface. Shock-melting experiments on iron at pressures of Earth's core provide a crucial constraint on the temperature at the center of our planet. And studies of hydrous, carbonate and sulphate minerals under shock compression document how climate-altering molecules can be released by major impacts, such as the K/T event associated with the most recent mass extinction of biota in Earth history. In addition, Tom was a leader in numerical simulation of cratering, bringing the most recent laboratory measurements into the modeling of planetary impacts. Tom's training was in geophysics and applied experimental physics, as exemplified by the ultrasonic wave-velocity measurements of his Ph.D. research at Rensselaer Polytechnic Institute (geophysics Ph.D. in 1962, following a B.S. in geology and geophysics from Massachusetts Institute of Technology in 1957, and M.S. in geophysics from Caltech in 1958). He served in the U.S. Army (1959-60) and was employed at Stanford Research Institute (1962-67), where he conducted shock wave experiments, before joining the faculty at Caltech in 1967. With such a broad background, Tom combined condensed-matter physics, continuum mechanics, petrology and seismology, for instance in characterizing polymorphic phase transformations in Earth's mantle (1967 J. Geophys. Res. Paper with Y. Syono); using shock wave measurements to interpret seismological data on Earth's deep interior (1969 Rev. Geophysics paper with D. L. Anderson and A. E. Ringwood); modeling geodynamic effects of phase-transition kinetics (1975 Rev. Geophysics paper with G. Shubert); characterizing the effects of gravity and crustal strength on crater formation (1981 Rev. Geophysics paper with J. D. O'Keefe); and quantifying impact erosion of terrestrial planetary atmospheres (1993 Annual Review of Earth and Planetary Sciences). The span of his science was also reflected in collaborations with - among others - Paul D. Asimow, George R. Rossman and Edward M. Stolper at Caltech, as well as Arthur C. Mitchell and William J. Nellis at Lawrence Livermore National Laboratory. His accomplishments included conducting the first shock-wave experiments on lunar samples and solid hydrogen; measuring the first absorption spectra of minerals under shock loading; discovering major phase changes in CaO, FeO, KAlSi3O8, and KFeS2; measuring shock temperatures in silicates, metals, and oxides; conducting the first planetary cratering calculations for mass of melted and vaporized material, and mass and energy of ejecta as a function of planetary escape velocity; experimentally documenting shock vaporization on volatile-bearing minerals, and applying the results to understanding the formation of oceans and atmospheres; conducting the first dynamic-compression experiments on molten silicates, with applications to characterizing the maximum depth of volcanism on terrestrial planets, as well as the crystallization sequence of magma oceans; performing the first thermodynamic calculations delineating the impact-shock conditions for melting and vaporization of planetary materials; carrying out the first smoothed particle hydrodynamic calculations to investigate energy partitioning upon impact in self-gravitating planetary systems; and conducting the first quantitative tensile failure studies for brittle media, relating crack-density to elastic velocity deficits and the onset of damage. Tom was also Co-Investigator on the NASA Cosmic Dust Analyzer Experiment, and the NASA/ESA Cassini Mission to Saturn. Honors included the AGU Hess Medal, Geological Society of America Day Medal, Meteoritical Society Barringer Medal, APS Shock Compression of Condensed Matter' Topical Groups's Duvall Medal and AAAS Newcomb-Cleveland Prize. He had been President of AGU's Tectonophysics Section, Editor of Journal of Geophysical Research, founding member of both the Mineral and Rock Physics and Study of Earth's Deep Interior focus groups, and Editor - more like key driving force - for AGU's Handbook of Physical Constants. He was a fellow of the AGU, American Academy of Arts and Sciences, American Association for the Advancement of Science, and Geochemical Society; and member of the U.S. National Academy of Sciences, as well as Foreign Associate of the Russian Academy of Sciences. Main-belt asteroid 4739 Tomahrens (1985 TH1) was named after him. Tom made it clear, however, that it was his students (more than 30), research associates (15 or more) and many collaborators who were the real mark of success. No doubt driven by the need to sustain a major, expensive research facility, as well as to satisfy an inner drive, he maintained a daunting work schedule - including evenings, weekends and holidays - that challenged and stimulated so many around him, perhaps even frightening or frustrating some. He could play as hard as he worked, enjoying sailing, skiing and other outdoor activities over the years.

  2. Op-Ug TD Optimizer Tool Based on Matlab Code to Find Transition Depth From Open Pit to Block Caving / Narzędzie Optymalizacyjne Oparte O Kod Matlab Wykorzystane Do Określania Głębokości Przejściowej Od Wydobycia Odkrywkowego Do Wybierania Komorami

    Science.gov (United States)

    Bakhtavar, E.

    2015-09-01

    In this study, transition from open pit to block caving has been considered as a challenging problem. For this purpose, the linear integer programing code of Matlab was initially developed on the basis of the binary integer model proposed by Bakhtavar et al (2012). Then a program based on graphical user interface (GUI) was set up and named "Op-Ug TD Optimizer". It is a beneficial tool for simple application of the model in all situations where open pit is considered together with block caving method for mining an ore deposit. Finally, Op-Ug TD Optimizer has been explained step by step through solving the transition from open pit to block caving problem of a case ore deposit. W pracy tej rozważano skomplikowane zagadnienie przejścia od wybierania odkrywkowego do komorowego. W tym celu opracowano kod programowania liniowego w środowisku MATLAB w oparciu o model liczb binarnych zaproponowany przez Bakhtavara (2012). Następnie opracowano program z wykorzystujący graficzny interfejs użytkownika o nazwie Optymalizator Op-Ug TD. Jest to niezwykle cenne narzędzie umożliwiające stosowanie modelu dla wszystkich warunków w sytuacjach gdy rozważamy prowadzenie wydobycia metodą odkrywkową oraz wydobycie komorowe przy eksploatacji złóż rud żelaza. W końcowej części pracy podano szczegółową instrukcję stosowanie programu Optymalizator na przedstawionym przykładzie przejścia od wydobycia rud żelaza metodami odkrywkowymi poprzez wydobycie komorami.

  3. Wpływy polskie w jidysz według "History of the Yiddish Language" Maxa Weinreicha – przegląd i próby weryfikacji

    Directory of Open Access Journals (Sweden)

    Michał Gajek

    2016-12-01

    Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish.   Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa

  4. NEOEVOLUCIONISMO Y ECOLOGÍA CULTURAL. LA OBRA DE JULIAN STEWARD Y LA RENOVACIÓN DE LA ENSEÑANZA DE LA ANTROPOLOGÍA EN LA ARGENTINA / Neo-evolutionism and cultural ecology. The Argentine Renovation of Anthropology Teaching under the influence of J. Steward

    Directory of Open Access Journals (Sweden)

    Gastón Julián Gil

    2010-12-01

    Full Text Available La introducción de la obra del antropólogo norteamericano Julian Haynes Steward (1902-1972 produjo una parcial renovación de la enseñanza de la antropología en la Argentina desde mediados de la década del cincuenta. Principalmente en arqueología (y más tarde en lo que comenzaría a llamarse antropología social, el enfoque materialista, neoevolucionista y ecológico entró en tensión con la corriente histórico-cultural alemana que había hegemonizado el campo antropológico nacional liderado por el italiano José Imbelloni desde la Universidad de Buenos Aires. La circulación de estas nuevas ideas -que también provocaron fuertes polémicas en su ámbito de gestación original- es abordada principalmente a partir de la labor transformadora y revitalizadora de Alberto Rex González, posgraduado en la Universidad de Columbia y alumno de Steward a fines de los años cuarenta. De este modo, se propone un análisis de las maneras en que nuevos postulados conceptuales provenientes de una tradición metropolitana se difundieron en un contexto periférico.Palabras Clave: Antropología argentina; Neoevolucionismo; Ecología cultural; UniversidadAbstractThe introduction of the U.S. anthropologist Julian Haynes Steward (1902-1972 to the Argentine courses of Anthropology in the mid-50´s, launched a process of partial renovation in Argentine anthropology.  His materialistic, neoevolutionist, and ecological scope applied to Archeology and, later, to what would become Social Anthropology, differed from more established views such as German historical-cultural theory led by Italian anthropologist José Imbelloni and Austrian archaeologist Oswald Menghin. This paper describes and analyzes the arrival of Steward’s ideas to some Argentine schools of Anthropology (Córdoba, Litoral/Rosario and La Plata in the late 40s, by means of archaeologist Alberto Rex González, a Columbia Ph.D. and one of Steward’s students. In fact, studying Steward

  5. Language: UG or not to be, that is the question.

    Science.gov (United States)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    2015-02-01

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  6. UG311, An Oncofetal Marker Lost with Prostate Cancer Progression

    Science.gov (United States)

    2001-04-01

    resulted in neonatal lethality and further exacerbation of the dwarfism to about 30% of control size [28]. By contrast, the overexpression of GH or IGF-1...inhibitory as retinoic acid (RA) treatment initiates rapid degradation of IGFBP-2 and an increased synthesis of IGF-2 [127]. As RA promotes cell growth both...upregulation of IGFBP-2 mRNA in response to low dose androgen treatment in the LNCaP human prostate cancer cell line. It is not clear 19 whether this is

  7. Stworzenie świata według Leibniza

    Directory of Open Access Journals (Sweden)

    Michał Heller

    2008-06-01

    Full Text Available Leibniz's idea of creation is best epitomized by a note written by him on the margin of his work entitled 'Dialogus'. The note reads:'When God thinks things through and calculates, the world is made'. Simple calculations are almost mechanical. The true mathematical thinking begins when one is confronted with a problem that has to be solved, when starting from the known mathematical structure one has to construct a new structure, to comprehend its intricacies, the ways of its functioning, and its connections with other mathematical structures. And when one successfully applies the new mathematical structure to a physical theory, the new world is made. This was Leibniz's experience when he was discovering calculus and tried to apply it to mechanical problems. Leibniz's doctrine that our world is the best of all possible words is often ridiculed, but this attitude is the result of a very superficial reading of Leibniz's texts. In fact, God's calculations to choose the best possible world are similar to solving the variational problem in mathematics. Leibniz claims that in mathematical reasoning if there is neither 'maximum' nor 'minimum' nothing can happen. Similarly, if there were no world better that other possible worlds, God's wisdom would have not been able to create anything. Some consequences of this doctrine, concerning the nature of space, time and causality, are also considered.

  8. Module Cluster: UG - 001.00 (GSC) Urban Geography.

    Science.gov (United States)

    Currier, Wade R.

    This is one of several module clusters developed for the Camden Teacher Corps project. This module cluster is designed to introduce students to urban studies through the application of a geographic approach. Although geography shares with other social sciences many concepts and methods, it has contributed a distinctive set of viewpoints and a…

  9. Language: UG or not to be, that is the question.

    Directory of Open Access Journals (Sweden)

    Johan J Bolhuis

    2015-02-01

    Full Text Available Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  10. Language : UG or not to be, that is the question

    NARCIS (Netherlands)

    Bolhuis, Johan J; Tattersall, Ian; Chomsky, Noam; Berwick, Robert C

    Language is not the same as speech or communication; rather, it is a computational cognitive system. It has appeared very recently, consistent with a minimalist view of language's hierarchical syntactic structure.

  11. Kunstnik Julian Schnabel vallutab Soome kahel rindel / Jukka Kiho

    Index Scriptorium Estoniae

    Kiho, Jukka

    2008-01-01

    Tamperes esilinastub kunstniku film "Lou Reed's Berlin", mis valmis Ameerikas 2006. a. ja kus laulja Lou Reed mängib esimest korda tervikuna ära 1973. aastal ilmunud plaadi. Kiasmas Helsingis avatakse kunstniku maalinäitus "Noorte kartlike nunnade pühendunud vaade"

  12. Madden-Julian Oscillation: Western Pacific and Indian Ocean

    Science.gov (United States)

    Fuchs, Z.; Raymond, D. J.

    2016-12-01

    The MJO has been and still remains a "holy grail" of today's atmospheric science research. Why does the MJO propagate eastward? What makes it unstable? What is the scaling for the MJO, i.e. why does it prefer long wavelengths or planetary wavenumbers 1-3? The MJO has the strongest signal in the Indian ocean and in the West Pacific, but the average vertical structure is very different in each of those basins. We look at the reanalysis/analysis FNL, ERAI vertical structure of temperature and moisture as well as the surface zonal winds for two ocean basins. We also look at data from DYNAMO and TOGA_COARE in great detail (saturation fraction, temperature, entropy, surface zonal winds, gross moist stability, etc). The findings from observations and field projects for the two ocean basins are then compared to a linear WISHE model on an equatorial beta plane. Though linear WISHE has long been discounted as a plausible model for the MJO, the version we have developed explains many of the observed features of this phenomenon, in particular, the preference for large zonal scale, the eastward propagation, the westward group velocity, and the thermodynamic structure. There is no need to postulate large-scale negative gross moist stability, as destabilization occurs via WISHE at long wavelengths only. This differs from early WISHE models because we take a moisture adjustment time scale of order one day in comparison to the much shorter time scales assumed in earlier models. Linear modeling cannot capture all of the features of the MJO, so we are in the process of adding nonlinearity.

  13. Homocysteine-lowering effect of 500 ug folic acid every other day versus 250 ug/day

    NARCIS (Netherlands)

    Brouwer, I.A.; Rooij, van I.A.L.M.; Dusseldorp, van M.; Thomas, C.M.G.; Blom, H.J.; Hautvast, J.G.A.J.; Eskes, T.K.A.B.

    2000-01-01

    Elevated plasma total homocysteine (tHcy) concentrations are a risk factor for neural tube defects and vascular diseases. Supplementation with folic acid decreases tHcy. We investigated whether supplementation with 500 ?g folic acid every other day is as effective in lowering tHcy as 250 ?g folic

  14. Rola negacji w opisie świata według arystotelesowskiej Metafizyki

    Directory of Open Access Journals (Sweden)

    Jan BIGAJ

    2012-12-01

    Full Text Available The notions of „being” and „non-being” have entered philosophical language, forming thebasis of ontology and meontology, as the counterparts of the Greek expressions to o]n and tomh o]n (nominalised forms, affirmative and negative, of the participle of the verb ei=nai.Originally, however, these expressions did not have any objectifying meaning, but played therole of meta-language names, representing the copula ei=nai in all its forms, most generallyin its affirmative and negative forms. The copula itself, which in later philosophy took on theexistential meaning, had functioned only as a semantically empty connective of predicates.Over time the participle o]n has been used as a universal name of all predicates.The above-mentioned expressions became central in Greek philosophical terminologythanks to the debates, initiated by Parmenides, on the role of negation in the description of theworld. Parmenides himself proposed a complete excision of negative sentences as describing byelimination, and created a positive-monistic system which abandoned multiplicity, divisibility,and variability. Later philosophers defended negation, fighting back against the paradoxesformulated by the Eleatics and later by the Sophists.Plato observed that without negation it is impossible to describe the multiplicity of things.He also distinguished a relative negation which does not eliminate anything but makes it possibleto confront some things with others. According to the atomists, the divisibility of physicalthings forces us to accept that they consist of a positive element in the form of an impenetrablebody, and of another element lacking any characteristics, i.e. the void. Finally, Aristotle, whenanalysing the process of change, justified the consistency of the statement that something comesout of “not being” and “being”, under the assumption that the former is understood as beingactual, and the latter as being potential. In all these conceptions there is nothing non-existent,there are only proposals of how to identify the aspects of reality whose explanation justifiesthe use of negation.The affirmative and negative forms of the above expressions have also provoked reflectionon the problem of truth and falsity. It has been observed that they are used in everyday language not only to state an agreement or disagreement with the actual facts of the matter, but also toaffirm or deny something.

  15. Gender Studies Course at UG/PG Levels and Gender Awareness Training to Teachers

    Science.gov (United States)

    Kuruvilla, Moly

    2014-01-01

    While the UGC is committed to the cause of promoting gender equity through higher education and is in the process of reviewing the existing arrangements in the campuses of higher learning to ensure the freedom, safety and security of girls and women, the proactive role of teachers in solving the problems of gender based violence and other…

  16. Inheritance of resistance to Ug99 stem rust pathogen in selected ...

    African Journals Online (AJOL)

    13 × 08-UT-86 (χ2 0.05 = 0.480, P ≥ 0.488), HKBL-1385-13 × 09-N2-19 (χ2 0.05 = 0.641, P ≥ 0.424), ND2649 × 09-AB-78 (χ2 0.05 = 1.05, P ≥ 0.309) and ND25882 × 09-AB-78 (χ2 0.05 = 3.599, P ≥ 0.058) exhibited Mendelian segregation ...

  17. Sequencing Ug99 and Other Stem Rust Races: Progress and Results

    Science.gov (United States)

    Over the last decade a number of different molecular methods have been used to characterize genetic diversity in Puccinia graminis. Multilocus DNA fingerprinting methods (AFLPs, RAPDs, SAMs and S-SAPs) have proven to be useful, but limited to phenotypic analysis due to the dikaryotic nature of rust ...

  18. Somatic recombination in wheat stem rust leads to virulence for Ug99-effective SR50 resistance

    Science.gov (United States)

    Race-specific resistance genes protect much of the global wheat crop from stem rust disease caused by Puccinia graminis f. sp. tritici (Pgt), but often break down due to evolution of new virulent pathogen races. To understand the molecular mechanisms of virulence evolution in Pgt we identified the p...

  19. Odnowa filozofii według Hilarego Putnama (Hilary Putnam's Renewal of Philosophy

    Directory of Open Access Journals (Sweden)

    Tadeusz Szubka

    2011-09-01

    Full Text Available Hilary Putnam is widely considered as one of the most distinguished and important philosophers in the analytic tradition of the last fifty years. However, in his most recent publications he has started to emphasize various shortcomings and limitations of that powerful tradition, connected especially with its scientism andnaturalism. He has also insisted that what we really need is a serious renewal and transformation of philosophy, drawing upon other philosophical traditions, including pragmatism. We should realize that although philosophy overlaps in some parts with science, it cannot be turned into a science. It is a humanistic enterprise havingtwo dimensions, theoretical and moral, and it is unfortunate when we tend to forget about either of them.

  20. Analytical study on U/G coal mine CPT and inferences

    Energy Technology Data Exchange (ETDEWEB)

    Dey, N.C.; Mukhopadhyay, S. [Bengal Engineering College, Howrath (India). Dept. of Mining and Geology

    1999-08-01

    The analytical aspects of underground CPT (coal mine cost per tonne), which varies from mine to mine due to the different weightages of various contributing factors, are described. The CPT is not only dictated by the increasing wages but also by the availability of man-hour and accountability of machine utilization. An optimal blend of labour-intensive and machine-intensive methods involving least investment and operating cost, is a challenge for the coal industry. Technology upgradation and implementation, higher skill and morale, excellence in planning and monitoring, optimization in capacity utilization, and better consumer acceptability of coal will consistently improve the financial health of the coal mining sector. Other factors which will help improve the financial health of coal mining industries are (1) cost propaganda like safety week celebration; (2) cost consciousness at all levels; (3) noticeboard comprising the cost of man-hour and machine- hour; (4) no idle time for men as well as machine; (5) care to increase the life of machines; (6) scope of target amendment in a year; (7) prior to introducing costly machines, due weightage to be given on coal grade, mine life, geo-mining conditions; and (8) award to most economic mine and punishment to others rated below the BEP (break- even point). 2 refs., 3 figs.

  1. Reliable discrimination of high explosive and chemical/biological artillery using acoustic UGS

    Science.gov (United States)

    Hohil, Myron E.; Desai, Sachi

    2005-10-01

    The Army is currently developing acoustic overwatch sensor systems that will provide extended range surveillance, detection, and identification for force protection and tactical security on the battlefield. A network of such sensors remotely deployed in conjunction with a central processing node (or gateway) will provide early warning and assessment of enemy threats, near real-time situational awareness to commanders, and may reduce potential hazards to the soldier. In contrast, the current detection of chemical/biological (CB) agents expelled into a battlefield environment is limited to the response of chemical sensors that must be located within close proximity to the CB agent. Since chemical sensors detect hazardous agents through contact, the sensor range to an airburst is the key-limiting factor in identifying a potential CB weapon attack. The associated sensor reporting latencies must be minimized to give sufficient preparation time to field commanders, who must assess if an attack is about to occur, has occurred, or if occurred, the type of agent that soldiers might be exposed to. The long-range propagation of acoustic blast waves from heavy artillery blasts, which are typical in a battlefield environment, introduces a feature for using acoustics and other disparate sensor technologies for the early detection and identification of CB threats. Employing disparate sensor technologies implies that warning of a potential CB attack can be provided to the solider more rapidly and from a safer distance when compared to that which conventional methods allow. This capability facilitates the necessity of classifying the types of rounds that have burst in a specified region in order to give both warning and provide identification of CB agents found in the area. In this paper, feature extraction methods based on the discrete wavelet transform (DWT) and multiresolution analysis facilitate the development of a robust classification algorithm that affords reliable discrimination between conventional and simulated chemical/biological artillery rounds using acoustic signals produced during detonation. Distinct characteristics arise within the different airburst signatures because high explosive warheads emphasize concussive and shrapnel effects, while chemical/biological warheads are designed to disperse their contents over large areas, therefore employing a slower burning, less intense explosive to mix and spread their contents. The ensuing blast waves are readily characterized by variations in the corresponding peak pressure and rise time of the blast, differences in the ratio of positive pressure amplitude to the negative amplitude, and variations in the overall duration of the resulting waveform. We show that, highly reliable discrimination (> 98%) between conventional and potentially chemical/biological artillery is achieved at ranges exceeding 3km. A feedforward neural network classifier, trained on a feature space derived from the distribution of wavelet coefficients found within different levels of the multiresolution decomposition yields.

  2. Remotely sensing the thickness of the bushveld complex UG2 platinum reef using borehole rada.

    CSIR Research Space (South Africa)

    Simmat, CM

    2006-03-01

    Full Text Available The planar, 80 cm thick, lousy dielectric reefs of the Bushveld are embedded in rocks that are almost transparent at ground penetrating radar frequencies of 10–125 MHz. Pothole sensing practices are based largely on using borehole radars to observe...

  3. Kontemplacja i ekspresja – Śakuntala Kalidasy według Jerzego Grotowskiego

    OpenAIRE

    Kołdrzak, Elżbieta

    2012-01-01

    Zrealizowana przez Jerzego Grotowskiego w Teatrze 13 Rzędów, już ponad 50 lat temu, Śakuntala Kalidasy przeszła do historii nie tylko jako kolejna z zachodnich scenicznych wersji tego słynnego dramatu indyjskiego, ale przede wszystkim jako wyznacznik poszukiwań teatralnych oraz poszukiwań nowego paradygmatu techniki aktorskiej prowadzonych przez zespół Grotowskiego. Zarówno sposób opracowania oryginalnego tekstu Kalidasy (Prolog zawierający mantry śiwaickie, redukcja akcji do w...

  4. Etiologia, objawy i leczenie infekcyjnego zapalenia wsierdzia według aktualnych wytycznych Europejskiego Towarzystwa Kardiologicznego

    Directory of Open Access Journals (Sweden)

    Anna Adamska-Wełnicka

    2013-04-01

    Full Text Available Infekcyjne zapalenie wsierdzia (IZW cechuje niejednorodny obraz kliniczny, z pogranicza przewlekłych, nie‑ sprecyzowanych chorób infekcyjnych, autoimmunologicznych, reumatologicznych oraz nowotworowych. Szybka diagnostyka i włączenie leczenia celowanego IZW są konieczne z uwagi na poważne rokowanie i bez‑ pośrednie zagrożenie życia pacjenta. W procesie IZW w obrębie zastawek serca tworzą się konglomeraty bak‑ terii, komórek zapalnych, płytek krwi i włóknika, zwane wegetacjami. Dotyczą najczęściej zastawek lewej strony serca. Wegetacje doprowadzają do miejscowej destrukcji wsierdzia oraz stanowią źródło zatorowości obwo‑ dowej. Najczęstszym objawem IZW jest gorączka, natomiast w badaniu przedmiotowym zwraca uwagę nowy szmer wysłuchiwany nad sercem, świadczący o uszkodzeniu zastawek lub nici ścięgnistych. Zdarza się, że pierwszym symptomem choroby są zaburzenia neurologiczne spowodowane udarem mózgu powstałym w mechanizmie zatorowym. W ostatnim czasie wzrasta liczba zachorowań na IZW związanych ze stosowa‑ nymi procedurami inwazyjnymi wewnątrzsercowymi z implantacją sztucznych zastawek oraz elektrod. Szczególną grupę chorych stanowią również narkomani, u których najczęściej dochodzi do zajęcia zastawek prawej strony serca. Głównym czynnikiem etiologicznym zapalenia wsierdzia są bakterie, wśród nich obecnie dominują zakażenia gronkowcowe. Rozpoznanie choroby opiera się na danych klinicznych, obrazie echokar‑ diograficznym oraz badaniach bakteriologicznych krwi. Leczeniem przyczynowym IZW jest antybiotykotera‑ pia wielolekowa prowadzona w warunkach szpitalnych. Konieczne jest ścisłe monitorowanie choroby i roz‑ ważenie wskazań do leczenia kardiochirurgicznego. Istotnym zagadnieniem są również metody zapobiegania zakażeniom wsierdzia. Zasady profilaktyki IZW na przestrzeni ostatnich lat uległy znacznym modyfikacjom. Infekcyjne zapalenie wsierdzia wciąż pozostaje chorobą o poważnym rokowaniu, niejednokrotnie kończącą się zgonem pacjenta, a podstawowa wiedza o tym schorzeniu wydaje się niezbędna dla każdego lekarza.

  5. Polish students at the Académie Julian until 1919

    Directory of Open Access Journals (Sweden)

    Zgórniak, Marek

    2012-08-01

    Full Text Available The subject of the article is the presence of Polish students in the most important private artistic school in Paris in the second half of the 19thcentury. The extant records regarding the atelier for male students made it possible to compile a list of about 165 Polish painters and sculptors studying there in the period from 1880 to 1919. The text presents the criteria used when preparing the list and the diagrams show the fluctuations in registration and the number of Polish artists in particular ateliers in successive years. The observations contained in the article have a summary nature and are illustrated only with selected examples.

  6. Hotel Online Marketing: The Bugibba Hotel, Radisson Blu Resort Malta, St. Julian's, Preluna Hotel & SPA

    OpenAIRE

    Dinh Quynh, Mai

    2013-01-01

    The thesis covers the study of online marketing theory, a very popular trend of marketing nowadays, especially Search Engine Optimization (SEO) and Google Adwords Campaign in the analyses of the online marketing practices of three hotels from different areas and standards in Malta, namely The Bugibba Hotel, Preluna Hotel & SPA and Radisson Blu Resort Malta, St. Julian’s. From the analyses, the thesis aims at suggesting Preluna Hotel & SPA optimal online marketing practices and answering t...

  7. Application of terrestrial photogrammetry for the mass balance calculation on Montasio Occidentale Glacier (Julian Alps, Italy)

    Science.gov (United States)

    Piermattei, Livia; Carturan, Luca; Calligaro, Simone; Blasone, Giacomo; Guarnieri, Alberto; Tarolli, Paolo; Dalla Fontana, Giancarlo; Vettore, Antonio

    2014-05-01

    Digital elevation models (DEMs) of glaciated terrain are commonly used to measure changes in geometry and hence infer the mass balance of glaciers. Different tools and methods exist to obtain information about the 3D geometry of terrain. Recent improvements on the quality and performance of digital cameras for close-range photogrammetry, and the development of automatic digital photogrammetric processing makes the 'structure from motion' photogrammetric technique (SfM) competitive for high quality 3D models production, compared to efficient but also expensive and logistically-demanding survey technologies such as airborn and terrestrial laser scanner (TLS). The purpose of this work is to test the SfM approach, using a consumer-grade SLR camera and the low-cost computer vision-based software package Agisoft Photoscan (Agisoft LLC), to monitor the mass balance of Montasio Occidentale glacier, a 0.07km2, low-altitude, debris-covered glacier located in the Eastern Italian Alps. The quality of the 3D models produced by the SfM process has been assessed by comparison with digital terrain models obtained through TLS surveys carried out at the same dates. TLS technique has indeed proved to be very effective in determining the volume change of this glacier in the last years. Our results shows that the photogrammetric approach can produce point cloud densities comparable to those derived from TLS measurements. Furthermore, the horizontal and vertical accuracies are also of the same order of magnitude as for TLS (centimetric to decimetric). The effect of different landscape characteristics (e.g. distance from the camera or terrain gradient) and of different substrata (rock, debris, ice, snow and firn) was also evaluated in terms of SfM reconstruction's accuracy vs. TLS. Given the good results obtained on the Montasio Occidentale glacier, it can be concluded that the terrestrial photogrammetry, with the advantageous features of portability, ease of use and above all low costs, allows to obtain high-resolution DEMs which enable good mass balance estimations on glaciers with similar characteristics.

  8. Introduction : sur les traces de Julian Pitt-Rivers en Andalousie

    Directory of Open Access Journals (Sweden)

    Antoinette Molinié

    2008-07-01

    Full Text Available Je voudrais avant tout remercier Françoise Pitt-Rivers de l’honneur et de la confiance faits au Laboratoire d’ethnologie et de sociologie comparative en attribuant à la Bibliothèque Éric-de-Dampierre et à sa directrice Marie-Dominique Mouton la responsabilité des archives de son époux. Cette acquisition a permis d’ouvrir des perspectives nouvelles à la construction d’un véritable objet ethnologique à partir d’archives ethnographiques, soit le projet essentiel de notre programme d’aci. Nous a...

  9. PENGEMBANGAN MODEL PREDIKSI MADDEN-JULIAN OSCILLATION (MJO BERBASIS HASIL ANALISIS DATA WIND PROFILER RADAR (WPR

    Directory of Open Access Journals (Sweden)

    Naziah Madani

    2014-07-01

    Full Text Available Latar belakang penelitian ini adalah pentingnya kajian mengenai MJO sebagai salah satu osilasi dominan di kawasan ekuator. Penelitian ini bertujuan untuk membuat model prediksi MJO berdasarkan analisis data WPR. Pada penelitian ini kejadian MJO diidentifikasi dari data kecepatan angin zonal pada lapisan 850 mb di kawasan Pontianak, Manado, dan Biak. Sebelum data angin zonal ini dimanfaatkan untuk melihat perilaku MJO, maka data angin tersebut  terlebih dahulu dibandingkan dengan data indeks MJO yaitu RMM1 dan RMM2. RMM1 dan RMM2 merupakan sepasang indeks untuk memonitor kejadian MJO secara realtime. Hasil analisis Power Spectral Density (PSD data kecepatan angin zonal lapisan 850 mb menunjukkan adanya sinyal MJO kuat yang dicirikan dengan adanya osilasi sekitar 45 harian. Hasil korelasi dan regresi juga menunjukkan bahwa terdapat keterkaitan yang signifikan antara kedua data tersebut. Hal tersebut mengindikasikan bahwa data kecepatan angin zonal lapisan 850 mb dapat digunakan untuk analisis MJO. Pada penelitian ini, prediksi MJO didasarkan pada data kecepatan angin zonal menggunakan metode ARIMA Box-Jenkins. Melalui metode ini, model yang mendekati data deret waktu kecepatan angin zonal pada lapisan 850 mb di Pontianak adalah ARIMA(2,0,0, model prediksi untuk Manado adalah ARIMA(2,1,2, sedangkan untuk Biak adalah ARIMA(0,1,3. Model-model tersebut bermanfaat untuk melihat perilaku sinyal MJO pada data angin zonal berkaitan dengan pola curah hujan di wilayah kajian.   Background of this research is to study the importance of MJO as one of the predominant peak oscillation in the equator area. This study aims to make prediction models of MJO based on the analysis of zonal wind speed data observed by WPR that compared by the MJO index data, namely RMM1 and RMM2. The results of PSD show strong MJO signal of 45 day periods oscillations. The result of corrrelation and regression analyses also show significant relationship between both data. Therefore, it is suggested that the observed 850 mb zonal wind speed data can be used to analyze the MJO phenomenon. The MJO prediction models were developed by using ARIMA. Then we found the ARIMA model for Pontianak is ARIMA(2,0,0, Manado ARIMA(2,1,2, and Biak ARIMA(0,1,3. Those models used to see the MJO event from zonal wind data that effect to rainfall pattern in study area.

  10. for indoor residuAl sprAying in rAkAi district, ugAndA

    African Journals Online (AJOL)

    2011-11-11

    Nov 11, 2011 ... for irs and factors associated with willingness to accept use of ddt. Results: ... system alone (1) accounting for 30 to 50 percent of outpatient ... 9 to 14 percent of inpatient deaths; making Uganda ... a long residual effect and has lower operational cost .... reasons for their decision: fear of health effects from.

  11. Handling the problem of the brine tubing bend on the basis of experiences gained during UGS - Mogilno construction

    International Nuclear Information System (INIS)

    Zola, P.; Skwarczynski, S.

    2005-01-01

    In the article problems of brine tubing bending and bent string cutting methods in the well conditions has been described. Implementation of safety joint in the brine string as an alternative solution that eliminates the need of cutting has been presented as well. (authors)

  12. Odmiany rozumu ludzkiego według Emila Ciorana [Types on human reason according to Emil Cioran

    Directory of Open Access Journals (Sweden)

    Paweł Wójs

    2014-12-01

    Full Text Available Scattered remarks on different types of reason can be found in Emil Cioran’s books. In the here presented essay it was shown that all the distinguished varieties of reason are connected to each other and it is possible to talk about emerging of another type from the previous one. These types are: naïve reason, rationalistic reason, negating reason, doubtful reason and expanded reason. Naïve reason is the one that serves life without self-consciousness. Rationalistic reason makes decrees on reality. In his critical remarks Cioran describes rationalistic reason as being dangerous. Two other types of reason are the negating and the doubtful one. Cioran proves that affirmation leads human beings to giving up themselves and that liberation always comes through constant fight for negation. Negating reason is always turned towards something external to itself. Doubtful reason goes much further by actually turning against itself, it is in constant struggle against itself. Cioran describes this process as separating the reason and standing face to face with yourself. Therefore he is aware that only the reason itself can become a judge of reason. The fifth type of reason which can be distinguished in Cioran’s philosophy might be called the extended reason as it is a demand for unfolding the reason. When one realizes that there is nothing permanent in the world and cognition can’t bring any permanent results either, the reason according to Cioran might become active again by turning back towards reality – however without any further dogma of objective truth – and by using “flowing” ideas it can unite with reality.

  13. Discovery of a novel stem rust resistance allele in durum wheat that exhibits differential reactions to Ug99 isolates

    Science.gov (United States)

    Wheat stem rust, caused by Puccinia graminis f. sp. tritici Erikss. & E. Henn, can incur yield losses on susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf.) Husnot. Though several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effec...

  14. Jakość usług sportowo-rekreacyjnych = The quality of sport-recreation services

    Directory of Open Access Journals (Sweden)

    Agnieszka Widawska-Stanisz

    2015-11-01

    Abstract There is a description of sport- recreation services and their quality presented in this article. The most important factors determining the high quality of providing services and the meaning of quality standards in the process of providing sport- recreation services are shown. There are some research results conducted among residents of Silesia province on the offers of sport – recreation companies and the qualities of their services.       Key words: the quality of services, sport- recreation services, purchaser.

  15. Filozofia informatyki – młoda dyscyplina z długą historią

    Directory of Open Access Journals (Sweden)

    Paweł Polak

    2016-12-01

    Full Text Available In this publication R. Murawski's anthology of philosophy of computing was reviewed. This review shows that this branch of philosophy is considered as quite new, but it has a long history. Murawski's book is a very good introduction to philosophy of computing - both for IT professionals and students of philosophy.

  16. 46 CFR 54.15-15 - Relief devices for unfired steam boilers, evaporators, and heat exchangers (modifies UG-126).

    Science.gov (United States)

    2010-10-01

    ... atmospheric type designed for vapor discharge direct to a distiller with no shutoff valve in the discharge line. The distiller connected to atmospheric evaporators shall be fitted with a vent to prevent a...

  17. Processes controlling the surface temperature signature of the Madden–Julian Oscillation in the thermocline ridge of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Jayakumar, A.; Vialard, J.; Lengaigne, M.; Gnanaseelan, C.; McCreary, J.P.; PraveenKumar, B.

    to quantify the relative contribution of net heat fluxes and entrainment to SST intraseasonal variability from observations alone. We therefore use a suite of OGCM experiments to isolate the impacts of each process. During 1997−2006, wind stress... the intraseasonal SST signature, with longer periods favouring a larger response. There are also strong year-to-year variations in the respective role of heat fluxes and wind stress. Intraseasonal-wind stress dominates the SST signature for one (in 2001...

  18. 'To Make the Enemy Immortal by the Sheer Play on Words' – on Julian Tuwim’s Pamphlets

    OpenAIRE

    Stępień, Tomasz

    2016-01-01

    The article presents both the formal aspects of the poetics of Tuwim’s pamphlets (enumeration, hyperbole, grotesque, irony) and the figures of those who are the targets of his satirical addresses. Tuwim used verse satires to create polemical and ironic portraits of individual people (the main figure being a nationalist journalist and literary critic Stanisław Pieńkowski) as well as to ridicule state institutions, ideologies and political parties. The author also analyses pamphlet-like lyrical...

  19. Steve Clarke, Julian Savulescu, Tony Coady, Alberto Giubilini, and Sagar Sanyal: the ethics of human enhancement: understanding the debate

    NARCIS (Netherlands)

    Frank, L.E.

    2017-01-01

    A decade of research on the ethics of human enhancement has produced a vast literature. This collection is an excellent contribution to the field; it fulfills and exceeds the promises of its two subsections: understanding and advancing the debate. Section 1, Understanding the Debate includes eight

  20. Current status of iodine deficiency-related disorders prophylaxis in Slovakia - the life's work of Julian Podoba remained unfinished.

    Science.gov (United States)

    Podoba, J; Racova, K; Urbankova, H; Srbecky, M

    2016-01-01

    Prophylaxis of iodine deficiency-related disorders with iodized salt in Slovakia was introduced in 1951. This prophylactic measure yielded remarkably good results. Endemic goiter and endemic cretinism disappeared. Sufficient iodine intake, mainly in children and adolescents, was confirmed in several local and international studies carried out in the period 1991-95. Unfortunately, since seventies, there has been no institution which would have dealt with iodine prophylaxis in such an extent as this important measure of Slovak preventive medicine would require. Neither systematic monitoring of iodine intake nor systematic population epidemiological studies have been carried out. We do not have any data on the iodine intake in pregnant women, the most vulnerable population group in relation to the iodine deficiency. During the period June 2014 - October 2015, we examined iodine excretion in 426 probands from three regions of Slovakia with an emphasis on the pregnant women. Iodine intake was found to be sufficient, even more than adequate, in all age groups of Slovak population. The only population group with iodine intake borderline or very mild iodine deficiency are pregnant women. 1/ Iodine nutrition in Slovakia is generally sufficient, even oversteps the requirement, with the exception of pregnant women. Iodine intake in pregnant women should be fortified by iodine containing multivitamin preparations. 2/ We recommend to include the examination of urinary iodine into the screening of thyropathies in early pregnancy. 3/ It is not enough to implement the iodine deficiency-related disorders prevention programs, it is also necessary to stabilize such programs over time and balance the benefits with possible side effects of this program.

  1. Čeština známá i neznámá - zemče, čugárek, strboulí.

    Czech Academy of Sciences Publication Activity Database

    Ireinová, Martina

    Č. 10 (2017), s. 8-8 Institutional support: RVO:68378092 Keywords : Czech Linguistic Atlas * dialectology * Czech dialects * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics www.brno-komín.cz/kominsky.zpravodaj

  2. Całościowa ocena przewlekłej obturacyjnej choroby płuc według raportu GOLD 2011

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-06-01

    Full Text Available Autorzy omawiają nowe podejście do przewlekłej obturacyjnej choroby płuc, przedstawione w raporcie GOLD 2011. Przewlekła obturacyjna choroba płuc jest ogólnoświatowym problemem zdrowotnym. Badanie BOLD ujawniło, że rozpowszechnienie choroby jest różne w poszczególnych krajach i będzie czwartą przy‑ czyną zgonów w 2030 roku. Główną przyczyną przewlekłej obturacyjnej choroby płuc jest nałóg palenia tytoniu. Raport GOLD 2011 zaleca, aby postawienie diagnozy rozważyć, jeśli pacjent prezentuje takie obja‑ wy, jak: duszność, kaszel i odkrztuszanie wydzieliny z ekspozycją na czynniki ryzyka oraz z obecnością obtu‑ racji potwierdzonej wartością FEV1/ FVC < 0,70. Wskaźnik FEV1 okazał się niedostatecznym deskryptorem wpływu przewlekłej obturacyjnej choroby płuc na pacjenta. Jest to choroba złożona i różnorodna, zbadanie jej wpływu na zdrowie pacjenta wymaga walidowanych testów, takich jak BODE, ADO, DOSE. Raport GOLD 2011 zaleca stosowanie dwóch walidowanych testów: mMRC i CAT. Wskaźniki wentylacyjne są skla‑ syfikowane jako GOLD 1 i 2 (zaburzenia łagodne i umiarkowane oraz GOLD 3 i 4 (zaburzenia ciężkie i bar‑ dzo ciężkie. Zaostrzenia przewlekłej obturacyjnej choroby płuc są ustalane na podstawie wywiadu lub war‑ tości FEV1. Ostatecznie pacjentów można zakwalifikować do kategorii A, B, C lub D. Leczenie farmakologiczne powinno być ustalane po dokonaniu zindywidualizowanej oceny.

  3. Gruźlica – od diagnostyki do leczenia według standardów dla krajów Unii Europejskiej

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-09-01

    Full Text Available Autorzy przedstawiają dane epidemiologiczne odnoszące się do gruźlicy w niektórych krajach, w tym w Polsce. Gruźlica ciągle pozostaje priorytetowym wyzwaniem dla zdrowia publicznego. Obecnie stosowana chemioterapia jest skuteczna, ale długotrwała i kompleksowa. Poważny problem stanowią szczepy Mycobacterium tuberculosis oporne na leki przeciwprątkowe, szczególnie szczepy oporne na wiele leków (MDR-TB i te o rozszerzonej opor‑ ności (XDR-TB, oraz zakażenia HIV wśród chorych na gruźlicę. W październiku 2011 roku zostały sfinalizowane standardy dotyczące gruźlicy dla krajów Unii Europejskiej (European Union Standards for Tuberculosis Care, ESTC. Dokument ten pozostaje w zgodzie z definicjami i rekomendacjami WHO. ESTC składają się z czterech sekcji: diagnozowanie, leczenie, HIV i choroby współistniejące, zdrowie publiczne, które korespondują z Między‑ narodowymi Standardami Opieki nad Chorymi na Gruźlicę (ISTC z 2009 roku. W 2013 roku zostały opubliko‑ wane polskie rekomendacje. Autorzy komentują wszystkie odnoszące się do gruźlicy rekomendacje. Przedstawio‑ no objawy kliniczne gruźlicy i wybrane problemy gruźlicy utajonej (latent tuberculosis. Próbki wydzieliny oskrzelowej powinny być poddane badaniu mikroskopowemu, hodowli i testom lekowraźliwości. WHO rekomen‑ duje szybki test molekularny, który należy wykonać w dniu bakteriologicznej diagnozy gruźlicy. Wszyscy chorzy (w tym osoby zakażone HIV, którzy nie byli wcześniej leczeni i u których nie występują czynniki ryzyka oporności na leki, powinni otrzymywać przez 2 miesiące izoniazyd, ryfampicynę, pirazynamid i etambutol, a przez 4 miesiące izoniazyd i ryfampicynę. Niektóre standardy odnoszą się do gruźlicy dziecięcej. Infekcja wywołana przez Mycobacterium tuberculosis powinna zostać wykryta za pomocą testu tuberkulinowego lub testu uwalniania interferonu gamma (IGRA. Dzieci poniżej 5. roku życia i osoby zakażone HIV, u których stwierdzono gruźlicę utajoną, należy leczyć izoniazydem, jeśli nie stwierdza się u nich aktywnej gruźlicy.

  4. Classification of agricultural assets on the international accounting standard 41 Agriculture Klasyfikacja aktywów pochodzenia rolniczego według MSR 41 Rolnictwo

    Directory of Open Access Journals (Sweden)

    Dorota Czerwińska-Kayzer

    2011-12-01

    Full Text Available Agricultural activity is characterised by dissimilarity and complexity of economic events. Therefore, the assets related to agricultural activity, should be properly classified, as it affects the method of valuation and the company assessment. In the article the classification of agricultural assets has been presented in respect of IAS/IFRS 41 Agriculture.

  5. Raportowanie banków na temat zrównoważonego rozwoju według standardów Global Reporting Initiative

    Directory of Open Access Journals (Sweden)

    Ana Novokmet

    2016-09-01

    Full Text Available Rachunkowość zrównoważonego rozwoju, z jej ostatecznym produktem – raportami społecznej odpo-wiedzialności, jest nową dziedziną rachunkowości i koncentruje się na ocenie i monitorowaniu działań w zakresie zarządzania firmą, ochrony środowiska i integracji społecznej oraz interakcji z otoczeniem. Wśród kilku standardowych ram, firmy na całym świecie często wybierają wytyczne Sustainability Re-porting Global Reporting Initiative (GRI. Od roku 2000 wytyczne GRI ewoluowały i obecnie jest do-stępna czwarta ich generacja. Celem tego artykułu jest ocena raportowania społecznego w ramach zinte-growanych raportów w sektorze bankowym na przykładzie UniCredit Group, która działa w 15 krajach. Raportowanie zrównoważonego rozwoju stanie się obowiązkowe w Unii Europejskiej dla dużych firm, notowanych na giełdach spółek i jednostek interesu publicznego (na przykład banków ze średnim za-trudnieniem co najmniej 500 pracowników, począwszy od roku 2018 (dla działalności w 2017 r.. Wniniejszym artykule skoncentrowano się na krytycznej analizie treści raportu społecznego banku.

  6. Informatics Tools and Methods to Enhance U.S. Cancer Surveillance Research, UG3/UH3 | Informatics Technology for Cancer Research (ITCR)

    Science.gov (United States)

    The goal of this Funding Opportunity Announcement (FOA) is to advance surveillance science by supporting the development of new and innovative tools and methods for more efficient, detailed, timely, and accurate data collection by cancer registries. Specifically, the FOA seeks applications for projects to develop, adapt, apply, scale-up, and validate tools and methods to improve the collection and integration cancer registry data and to expand the data items collected. Population-based central cancer registries (a partnership must involve at least two different registries).

  7. Badania wartości ekonomicznej usług biblioteczno-informacyjnych i ich wpływu na otoczenie

    Directory of Open Access Journals (Sweden)

    Ewa Głowacka

    2011-01-01

    Full Text Available Biblioteki pełnią różnorodne funkcje we współczesnym otoczeniu społecznym. Uczestniczą w tworzeniu kapitału intelektualnego i społecznego, wpływają na wzrost korzyści ekonomicznych użytkowników i całego społeczeństwa. W artykule omówiono główne podejścia i metody badawcze w zakresie oceny korzyści ekonomicznych płynących z funkcjonowania bibliotek. Skupiono się na metodzie analizy kosztów w stosunku do korzyści (ang. CBA – cost-benefit analysis, metodzie analizy warunkowej (ang. CVM – contigent valuation method, określaniu wartości dodanej dla użytkownika (ang. consumer surplus method i metodologii oceny stopy wzrostu z inwestycji (ang. ROI – return of investment. Przeanalizowano również różne projekty badań prowadzone na świecie w tym zakresie.

  8. Registration of 'Linkert' spring wheat with good straw strength and field resistance to the Ug99 family of stem rust races

    Science.gov (United States)

    Straw strength is one of the most important criteria for spring wheat cultivar selection in the north central U.S. ‘Linkert’ (PI 672164) hard red spring wheat was released by the University of Minnesota Agricultural Experiment Station in 2013 and has very good straw strength, high grain protein con...

  9. First Report of the Ug99 race group of Wheat Stem Rust, Puccinia graminis f. sp. tritici, in Egypt in 2014

    DEFF Research Database (Denmark)

    Patpour, Mehran; Hovmøller, Mogens; Shahin, Atef

    2016-01-01

    , Kenya, Ethiopia, Sudan, Tanzania, Eritrea, Rwanda, South Africa, Zimbabwe, Mozambique, Yemen, and Iran (Patpour et al. 2015). In the 2014 crop season, the presence of virulence to Sr31 in Egypt was suspected based on preliminary field observations of high infection on sources of Sr31 planted...

  10. https://drive.google.com/file/d/138qVlHQbLvtZ8WhmKIoUgBQATnzNXztg/view

    Directory of Open Access Journals (Sweden)

    Zenia Isabel Castro-Borunda

    2017-07-01

    Full Text Available The objective of this research was to know the viability of project investment evaluation using a simulation strategy for financial projection, which incorporates quantitative primary data to go through the evaluation process and extract financial indicators for decision making and give an opinion which serves for obtaining a credit; the recent investigation was applied to students of Mexico National Technological Institue (TecNM, specifically at the campus (ITLM, in Los Mochis, Sinaloa in the course of Formulation and Evaluation of Investment Projects which belongs to the bachelor’s Degree in Business Administration. For this effect it’s important to give feedback that at present any company that needs to use a bank and not bank source of financing requires an investment project; this is the importance of this topic, for its relevance and opportunity; the loan institutions demand formality and presentation in the project for obtaining a credit, combined with the innovative or important of the business idea, this turns out to be a highly positive binomial, allowing that the small and medium enterprises (SMEs participate for getting a financial source for their business; depending the case, the companies could be in the stage of growth or in the stage of maturity, but the needs will be the same: they require cash flow to correct some specific needs and it only will be able by obtaining a credit from a bank or a government institution, such as the “Fideicomiso de Riesgo Compratido FIRCO” (Shared Risk Trust, “Fideicomiso instituido en Relación a la Agricultura FIRA” (Institutional Trust Regarding Agriculture, “Secretaría de Economía SE” (Ministry of Economy, “Secretaría de Agricultura y Ganadería, Desarrollo Rural, Pesca y Alimentación SAGARPA” (Ministry of Agriculture and Livestock, Rural Development, Fishing and Feeding, among others; these institutions guide in their varied programs to these companies in the process of consolidation or growth, but they require that their participation can be taken to develop and evaluate an investment to know their viability.

  11. The self-organizing map, a new approach to apprehend the Madden–Julian Oscillation influence on the intraseasonal variability of rainfall in the southern African region

    CSIR Research Space (South Africa)

    Oettli, P

    2013-11-01

    Full Text Available -linear classification method, the self-organizing map (SOM), a type of artificial neural network used to produce a low-dimensional representation of high-dimensional datasets, to capture more accurately the life cycle of the MJO and its global impacts...

  12. Do Native American Culture, Life Experiences, Physics and the Bible Provide Supportive Evidence For Julian Barbour's Thesis About Anachronisms Relating to The End of Time?

    Science.gov (United States)

    Mears, Paul C.; Mc Leod, Roger D.

    2002-10-01

    Historic, and current Native American attitude considers that time can be considered in a cyclic sense that contrasts against a majority view of physicists that time varies in a linear algebraic sense. Precognition experiences offer evidence that time has a more subtle substance. The Bible clearly delineates "prophetic awareness of the future." Embedded "Bible codes" are touted as mathematical evidence for the existence of God. His existence is better served if "past-tense" information of events can propagate backward relative to our "present-tense" time. Barbour, p39: [some] " physicists entertain the idea time truly does not exist applies to motion .suggestion; it too is pure illusion." The concept of prophecy has been interpreted as evidence or "proof" of the existence of "Manitou" or God. Our interpretation is that, according to Native American legends, or the Bible, for as yet unspecified reasons, time behaves as though it can convey information in a backward, or forward, sense. It is like an f (t ± ti).

  13. Zur Beteiligung des Bundestages an gemischten völkerrechtlichen Abkommen. Internationale Freihandelsabkommen als Herausforderung des deutschen Europa- und Außenverfassungsrechts / Bernd Grzeszick, Juliane Hettche

    Index Scriptorium Estoniae

    Grzeszick, Bernd

    2016-01-01

    Jagatud pädevusest ELi kaubanduspoliitikas ja liikmesriigi parlamentide osalusest rahvusvaheliste vabakaubanduslepingute sõlmimisel Saksamaa näitel (põhiseaduse artiklite 23 lg 2 ja 59 lg 2 tõlgendamine ning konstitutsioonikohtu hinnang). Kokkuvõte inglise keeles. Samal teemal artikkel ka lk. 268-282.

  14. ASSANGE, Julian. Cypherpunks: liberdade e o futuro da internet. Tradução Cristina Yamagami. São Paulo: Boitempo, 2013.

    Directory of Open Access Journals (Sweden)

    Ramon Taniguchi Piretti Brandão

    2015-10-01

    Full Text Available Em Cypherpunks: Liberdade e o Futuro da Internet o leitor se depara com um alerta. Alerta, uma vez que o livro defende o sentido de liberdade como valor inalienável ao homem. Isto posto, podemos afirmar que o livro é composto de foros de denúncia no qual o Estado (garantidor de direitos e regulador de deveres intervém com sofisticados mecanismos de vigilância. No presente caso, tudo acontece por meio de uma jovem e revolucionária invenção que afeta e transforma profundamente as relações humanas: a internet.

  15. Analysis of Low Level Winds Measured by a Ship-Mounted, High Resolution Doppler Lidar during the Dynamics of the Madden Julian Oscillation (DYANMO) Experiment

    Science.gov (United States)

    2012-09-30

    order to understand its role in transporting moisture into the upper troposphere and effect on the initiation and propagation phases of the Madden...estimates of cloud base from ceilometer. The gray lines are composted insolation measurements to indicate day vs night conditions.

  16. Regional Income Inequalities In Poland And Italy / Rozkład Nierówności Według Regionów w Polsce i We Włoszech

    Directory of Open Access Journals (Sweden)

    Jędrzejczak Alina

    2015-12-01

    Full Text Available Redukcja różnic między regionami Europy była głównym celem polityki “zrównoważonego rozwoju”, której założenia znalazły się już w tzw. Traktatach Rzymskich (1957. Postępujący proces integracji europejskiej tworzył wciąż nowe instrumenty i inicjatywy (tzw. mechanizmy solidarności, wyrażające dążenie do niwelowania ekonomicznej i społecznej nierównowagi między regionami. Okazało się jednak, że różnice między regionami biednymi i bogatymi w wielu krajach wcale się nie zmniejszają, a spowolnienie gospodarcze spowodowało odwrócenie pozytywnych tendencji nawet w krajach relatywnie najbardziej rozwiniętych.

  17. Zagraniczne kontakty oraz ich rola w podnoszeniu jakości usług i budowaniu wizerunku biblioteki akademickiej. Doświadczenia Biblioteki Głównej Uniwersytetu Pedagogicznego im. KEN w Krakowie w latach 2010-2016

    Directory of Open Access Journals (Sweden)

    Błach Marzena

    2017-06-01

    Full Text Available The aim of the article is to draw attention to the role of contacts with foreign institutions in the process of improving services and building the image of an academic library. Experiences of the Main Library of the Pedagogical University in Cracow show a positive influence of participation in the Erasmus programme on the professional activity (increased number of foreign interlibrary transactions and scientific studies (reports and articles, conference papers, seminars of librarians. The article discusses the cooperation of the PU Main Library with foreign institutions in the years 2010-2016, conducted within the framework of the Erasmus programme and Interlibrary Loan. Statistical data illustrate the intensity of Erasmus and interlibrary contacts. Also, based on the experience of a Main Library employee participating in the International Librarians Network, library networking forms are described.

  18. Wymagania informacyjne użytkowników bibliotek akademickich XXI wieku: LibQUAL+TM jako narzędzie pomiaru jakości usług bibliotecznych

    OpenAIRE

    Jankowska, Maria Anna

    2006-01-01

    Google Scholar, Amazon.com, Flickr, MySpace, social networking, open access, and easy retrieval of electronic resources and services create higher user expectations toward academic library collections and services. �In this competitive environment of content providers and users’ growing expectations, academic libraries face a difficult task in providing the most satisfying ways of delivering content and services to their patrons. To what extend should libraries recognize the users’ informatio...

  19. Idea państwa według minarchistów i anarchokapitalistów [Idea of the State from the Perspective of Minarchists and Anarcho-capitalists

    Directory of Open Access Journals (Sweden)

    Hubert Staskiewicz

    2013-03-01

    Full Text Available This scientific article treats of libertarianism. Its fundamental premises are: conception of self-ownership, non-aggression axiom, proprietorship, free market, ‘no victim,no crime’ rule, aversion to the state institutions. The existence of libertarianism itselfis the most prominent subject of dispute between its two currents: minarchism andanarcho-capitalism. The adherents of the doctrine of minimal statism were FriedrichA. von Hayek and Milton Friedman, while Murray N. Rothbard and Hans-HermannHoppe were the followers of the free-market anarchy. The traditional, one-dimensional division into the left and right wing is not sufficient for the libertarianism tofind its place on the political scene. It is multidimensionality that characterises thelibertarian thought.

  20. Emergence of virulence to SrTmp in the Ug99 race group of wheat stem rust, Puccinia graminis f. sp. tritici, in Africa

    DEFF Research Database (Denmark)

    Patpour, M.; Hovmøller, M. S.; Justesen, A. F.

    2016-01-01

    of wheat fields in Africa (Kenya, 9; Uganda, 28; Rwanda, 41; and Egypt, 6) were sent to the Global Rust Reference Center (GRRC, Denmark) for race analysis. Puccinia graminis f. sp. tritici (Pgt) samples were recovered on cv. Morocco, and resulting urediniospores of 53 single-pustule isolates were......Tmp) to confirm their virulence/avirulence combinations to Sr24, Sr31, Sr36, and SrTmp. Race TTKTK was also detected at two locations in Uganda (Rubaya and Muko in Kabale region) and at five locations in Rwanda (Kinigi, Rwerere, Rufungo, Gatebe, and Kamenyo). Three isolates derived from stem rust samples...

  1. Implementation of a system of social accounting in the cooperative of agricultural production “Camilo Cienfuegos” and in the basic unit of cooperative production “Julian Alemán". Main results

    Directory of Open Access Journals (Sweden)

    Yamira Mirabal González

    2014-12-01

    • To determine the results of the implementation of the System of Social Accounting in the Cooperative of Agricultural Production “Camilo Cienfuegos” and in the Basic Unit of Cooperative Production “Julián Alemán”.    The main results of the investigation are centered in: Characterization of the administration of the Cooperative of Agricultural Production “Camilo Cienfuegos” and of the Basic Unit of Cooperative Production “Julián Alemán”, evaluation of the level of execution of a group of premises that you/they allow the implementation of the system and the results of the implementation of the System of Social Accounting in both cooperatives.

  2. Steve Clarke, Julian Savulescu, C. A. J. Coady, Alberto Giubilini, and Sagar Sanyal (eds.), The Ethics of Human Enhancement: Understanding the Debate, Oxford University Press, 2016, 269pp., $74.00 (hbk), ISBN 9780198754855.

    NARCIS (Netherlands)

    Nyholm, S.R.

    2017-01-01

    The Ethics of Human Enhancement: Understanding the Debate has two chief aims. These aims are to help readers understand the existing debate and to move the debate forward. The book consists of an introductory chapter by Alberto Giubilini and Sagar Sanyal (which lays out some prominent

  3. Implementation of a system of social accounting in the cooperative of agricultural production “Camilo Cienfuegos” and in the basic unit of cooperative production “Julian Alemán". Main results

    OpenAIRE

    Yamira Mirabal González

    2014-01-01

    So far they have been designed and implemented different instruments of evaluation of the administration social cooperative that I eat generality have had countable instruments that are limited to the contabilization of their economic-financial acting, without keeping in mind the registration necessities and presentation of the social administration that develop these companies.   The scientific problem of the present work, consists in that: "The current countable system of the cooperativ...

  4. Kõikide mugavustega õnn massidele / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2004-01-01

    Kunstiteaduse Instituudi rahvusvaheline konverents "Võistlevad õnned. Elukeskkond külma sõja perioodil". Esines Adrian Forty, Hilde Heynen Hollandist, Julian Holder Shotimaalt, Kirsi Saarikangas Soomest

  5. Gene : CBRC-MMUS-09-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-136 70% MIFTFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFTFLAI...FHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVILSFFNLSTACFSFSMIFSFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISH...FSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  6. Gene : CBRC-MMUS-09-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-103 84% MIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSLILS...LFKLSTACFSFSMIFNFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLLWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRNIPGPTVCISHFP ...

  7. Gene : CBRC-XTRO-01-2123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /gi=116487409 /ug=Str.18760 /len=4829 9e-15 26% MICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRGPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMNSTAQMLWGRAWGGRENFPSFLRIKVFPLETGGRACESHVVPTEHLPQPQ ...

  8. Gene : CBRC-MMUS-09-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-121 83% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVISS...FFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPTFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFFMIFSFLAIFHVPQWTFLN...VPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVIFSFFNLSTACFSFSMIFSFLAIFQVLQCAFLIFHVFQ ...

  9. Gene : CBRC-MMUS-09-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-108 87% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFSFLAIFHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRF ...

  10. Gene : CBRC-MMUS-23-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...

  11. Gene : CBRC-MMUS-09-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-115 71% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFL...NFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

  12. Gene : CBRC-XTRO-01-1571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=74306002 /ug=Str.68514 /len=887 2e-11 37% MHLVLRHPVLRHPVLRHPVLRHPVLLHPVLRHPVLLHPVLLHLVLLHPVLLHLVLRHPV...LRHPVLRHPVLRHLVLLHLVLLHLVLRHPVLRHPVLRHLVLLHLVLLHLVLLHPVLLHPVLLHPVLRHLVLLHLVLLHLVLRHPVLRHPV...LRHLVLLHLVLLHLVLLHLVLLHPVLRHPVLLHLVLLHLVLWHPVLPCRSARGSVVRKLIHCCIYHKIALVM ...

  13. Gene : CBRC-PMAR-01-0559 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...

  14. Gene : CBRC-CINT-01-0198 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...

  15. Factors Associated with Redundant Sigmoid Colon at Mulago ...

    African Journals Online (AJOL)

    jen

    economic factors between 68 patients .... 50,000 Uganda shillings (Ug. Shs) compared to only 19.9% of the controls (1 US $ = Ug shs 1500). ... the majority of the affected patients in this study had a family income of below 50,000 Ug. shs per month.

  16. Comparative Education in the Nineteenth Century

    Science.gov (United States)

    Brickman, William W.

    2010-01-01

    In this previously unpublished essay, William W. Brickman complicates the traditional conception of the historical foundations of comparative education--that is, the role of Marc-Antoine Julian as a "father figure." The article examines influences on Julian (by Cesar-Auguste Basset's influential publications, for example) and discusses…

  17. Enumeration of Mars years and seasons since the beginning of telescopic exploration

    Science.gov (United States)

    Piqueux, Sylvain; Byrne, Shane; Titus, Timothy N.; Hansen, Candice J.; Kieffer, Hugh H.

    2015-01-01

    A clarification for the enumeration of Mars Years prior to 1955 is presented, along with a table providing the Julian dates associated with Ls = 0° for Mars Years -183 (beginning of the telescopic study of Mars) to 100. A practical algorithm for computing Ls as a function of the Julian Date is provided. No new science results are presented

  18. [Speech by Oscar Julian Bardeci, director of the Centro Latinoamericano de Demografia (CELADE), at the Latinamerican Regional Meeting prior to the International Conference on Population in recognition of the Second Meeting on Population by the Committee of Upper-Level Government Experts (CEGAN), Havana, Cuba, November 16-19, 1983].

    Science.gov (United States)

    Bardeci, O J

    1983-12-01

    This work examines the relationship between population growth and economic development in Latin America and assesses progress in the 10 years since the Bucharest World Population Conference. The Latin American population increased from about 159 million in 1950 to 275 million in 1970 and around 325 million in 1980. The rate of growth reached a maximum of 2.8%/year in the early 1970s and has now declined to about 2.3%/year. The regional growth rate is a product of population dynamics that differ greatly in individual countries. Crude birth rates declined in every country of Latin America between 1975-80, but still exceeded 40/1000 in 1980-85 in Bolivia, Ecuador, El Salvador, Haiti, Honduras, and Nicaragua. Current fertility is the result of the different trajectories of the demographic transition in different countries. While fertility in Argentina, Cuba, and Uruguay underwent a slow but sustained decline that began prior to 1960, other countries including Colombia, Costa Rica, Chile, and Venezuela began an accelerated fertility decline in the 1960s that diffused rapidly through all age and social groups. Other countries have still not entered a definite phase of fertility decline. Mortality rates have declined appreciably in Latin America in the past few decades although they remain high in some countries. After the end of World War II and until the mid-1970s, most countries of the region experienced rapid economic growth coupled with profound changes in the productive structure. The industrial labor force grew in almost all countries along with urbanization, the decline of agricultural employment, and the increase of the tertiary sector. These and other important economic advances through the mid-1970s occurred despite rapid population growth, and the beginning of the fertility decline coincided with slowing economic growth that saw negative rates in 1981-82. Various studies have shown that not all population sectors were incorporated in the process of economic and social development. The proportion of the population in active age groups has increased dramatically, but no corresponding increase in employment opportunities has occurred. The informal sector has absorbed most of the excess growth, a trend reflected in the exclusion of a large segment of the population from the fruits of economic progress. Population growth and increased life expectancy have created demands for more retirement benefits, health and educational services, transportation, recreation, and housing. Nevertheless, it cannot be concluded that rapid population growth necessarily has negative consequences for economic development or social welfare. There are indications that the problem of poverty in Latin America could be solved if the political will to do so existed; obstacles to overcoming poverty are not primarily material or population-related. Urbanization, settlement of marginal areas, and relative decline of agricultural areas are 3 trends in spatial distribution of varying intensity and repercussions in different countries.

  19. Green justice in the city

    DEFF Research Database (Denmark)

    Rutt, Rebecca Leigh; Gulsrud, Natalie Marie

    2016-01-01

    tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment of andde...... of anddecision-making around UGS. On this basis we discuss potentials for European urban green space researchto take up a more explicit environmental justice framing to shed much-needed light on injustices inEuropean cities and inspire change in policy and practice.......tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment...

  20. Application of instrumental neutron activation analysis to assess dietary intake of selenium in Korean adults from meat and eggs

    International Nuclear Information System (INIS)

    Moon, Jong-Hwa; Kim, Sun-Ha; Chung, Yong-Sam; Lee, Ok-Hee

    2013-01-01

    Selenium is a key constituent of enzyme in glutathione peroxidase, which is effective in decreasing various types of oxidative stress, Thus, the adequacy of selenium intake is very important in decreasing the risks of various degenerating diseases such as cardiovascular disease, or certain cancers. Lately, the intake of animal foods is increasing among Koreans owing to a dietary transition toward a western style. This study was conducted to measure the selenium content in meat and eggs, and then assessed the selenium intake from these foods. Forty frequently eaten items among meat and eggs were analyzed using an Instrumental Neutron Activation Analysis. The selenium content in 100g of raw meat and eggs ranged from 8.1ug to 50.9ug. In particular, 100g of beef contained 12.4ug to 50.9ug of selenium; pork, 11.2ug to 22.6ug chicken, 10.2ug to 13.7ug and eggs, 28.6ug to 43.0ug. Thus, beef viscera and chicken eggs contain the highest amounts of selenium among these groups. 100g of Pork belly, the most frequently eaten meat type among Koreans, contains 14.6ug of selenium. An evaluation of dietary selenium intake shows that the total selenium supply from meats and eggs was 28.4ug/day and 27.5 ug/day in adult men and women, respectively. These are over one-half of the Korean RNI (Recommended Daily Intake) of 55ug/day. (author)

  1. Evaluación de la susceptibilidad antimicrobiana de cepas de Salmonella spp. aisladas del beneficio porcino en Colombia / Evaluation of antimicrobial susceptibility of Salmonella spp. strains isolated from pork carcasses on Colombia

    Directory of Open Access Journals (Sweden)

    Paula M. Bermúdez D

    2014-01-01

    Full Text Available Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando 30 patrones diferentes de multiresistencia; el más común fue Ampicilina, Amoxicilina, Cloranfenicol, Florfenicol y Tetraciclina en el 16,77% (n=26 de las cepas. Tetraciclina y Florfenicol fueron los antimicrobianos menos efectivos en el 94,84% (n=147 y 47,74% (n=74 de cepas resistentes, respectivamente. Discusión: se deben consolidar los sistemas de monitoreo, y de vigilancia y control de las resistencias antimicrobianas para prevenir, con un enfoque de cadena productiva, la diseminación de cepas multiresistentes en alimentos de origen animal, como parte integral del sistema de gestión de inocuidad de los alimentos en Colombia. - Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando

  2. A cognitively plausible model for grammar induction

    Directory of Open Access Journals (Sweden)

    Roni Katzir

    2015-01-01

    Full Text Available This paper aims to bring theoretical linguistics and cognition-general theories of learning into closer contact. I argue that linguists' notions of rich UGs are well-founded, but that cognition-general learning approaches are viable as well and that the two can and should co-exist and support each other. Specifically, I use the observation that any theory of UG provides a learning criterion -- the total memory space used to store a grammar and its encoding of the input -- that supports learning according to the principle of Minimum Description-Length. This mapping from UGs to learners maintains a minimal ontological commitment: the learner for a particular UG uses only what is already required to account for linguistic competence in adults. I suggest that such learners should be our null hypothesis regarding the child's learning mechanism, and that furthermore, the mapping from theories of UG to learners provides a framework for comparing theories of UG.

  3. In Situ Bioremediation of Chlorinated Solvent Source Areas with Enhanced Mass Transfer

    Science.gov (United States)

    2008-09-01

    three-dimensional view with iso -surface of LIF counts • GMS support files needed to operate GMS (for example, bor, .map, .mat, .img, .mat, and .sol...DCE (ug/L) trans-DCE (ug/L) VC (ug/L) Ethane (ug/L) Ethene (ug/L) Chloride (ug/L) 5C2C43 11/9/2005 440 J,B,D 27000 D 0 540 D 4.0 J 8.6 J...0.43 J 0.64 J 2C2D21 7/18/2005 29000 D 2C2D22 7/19/2005 530 J, D 30000 B, D, E 0 0 0 0 2C2D22 7/19/2005 27000 D 2C2D23 7/20/2005 180 J

  4. Thermoelectric properties of unoxidized graphene/Bi{sub 2}Te{sub 2.7}Se{sub 0.3} composites synthesized by exfoliation/re-assembly method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Il; Lee, Eun Sil; Kim, Jong-Young [Icheon Branch, Korea Institute of Ceramic Engineering and Technology, Gyeonggi-do (Korea, Republic of); Choi, Soon-Mok [School of Energy, Materials and Chemical Engineering, Korea University of Technology and Education, Cheonan (Korea, Republic of); Lee, Kyu Hyoung [Materials R and D Center, Samsung Advanced Institute of Technology, Yongin (Korea, Republic of); Seo, Won-Seon [Energy and Environmental Division, Korea Institute of Ceramic Engineering and Technology, Seoul (Korea, Republic of)

    2014-04-15

    Nanocomposites of n-type thermoelectric Bi{sub 2}Te{sub 2.7}Se{sub 0.3} (BTS) and unoxidized graphene (UG) were prepared from the exfoliated BTS and UG nanoplatelets. Polycrystalline BTS ingots were exfoliated into nanoscroll-type crystals by chemical exfoliation, and were re-assembled with UG nanoplatelets. The composites were chemically reduced by hydrazine hydrate and sintered by a spark-plasma-sintering method. The thermoelectric properties of the sintered composites were evaluated and exhibited decreased carrier concentration and increased thermal conductivity due to the embedded graphene. The peak ZT values for the UG/BTS-US and UG/BTS-EX composites were ∝0.8 at the UG concentration of 0.05 wt%. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  5. Next-generation Surface Enhanced Raman Scattering (SERS) Substrates for Hazard Detection

    Science.gov (United States)

    2012-09-01

    substrates at differing concentrations ranging from 0.05 ug/cm2 to 50 ug/cm2. These concentrations were independently validated by UV -Vis...standard Klarite substrates at a concentration of 5.0 ug/cm2. The concentration jetted was validated using a secondary UV -Vis technique.(20, 81) After... Spectros ., 994 (1997). [58] Alexander, T.A., Le, D.M., "Characterization of a commercialized SERS-active substrate and its application to the

  6. Metabolomic effects in HepG2 cells exposed to CeO2, SiO2 and CuO nanomaterials.

    Science.gov (United States)

    To better assess potential hepatotoxicity of nanomaterials, human liver HepG2 cells were exposed for three days to 5 different CeO2 (either 30 or 100 ug/ml), 3 SiO2 based (30 ug/ml) or 1 CuO (3 ug/ml) nanomaterials with dry primary particle sizes ranging from 15 to 213 nm. Metab...

  7. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager ... about the members of the eye-care team . Consumer warning about the improper use of colored contact ...

  8. Glucosamine and Chondroitin for Osteoarthritis

    Science.gov (United States)

    ... implications for human efficacy and toxicity. Archives of Biochemistry and Biophysics. 2011;510(1):11–18. Cahlin ... M.P.H., University of Maryland; Julian Leakey, Ph.D., U.S. Food and Drug Administration; Allen Sawitzke, ...

  9. Southern annular mode: tropical-extratropical interactions and impacts

    CSIR Research Space (South Africa)

    Fauchereau, N

    2009-09-01

    Full Text Available In this study the authors investigate in particular its links with the Madden Julian Oscillation and ENSO, the dominant modes of tropical atmospheric variability at the intraseasonal and interannual timescales, respectively. It is showed here that...

  10. 3,7 miljonit võimalust üksinduseks / Kai Tamm

    Index Scriptorium Estoniae

    Kutman, Kai, 1972-

    2011-01-01

    21. aprillil Berliinis Kulturbrauerei Kesselhausis esietendunud Age Veeroosi ooperist "Grid", libreto autor ja lavastaja Korneel Hamers, dirigent Taavi Kull, videokunstnik Julian bergheim, lavakujunduse autor Julia Rommel. Lk. 17 lühiintervjuu heliloojaga

  11. effect of tenure security on livelihood activities of women farmers in ...

    African Journals Online (AJOL)

    KANETH

    1989-05-03

    May 3, 1989 ... Keywords: tenure security, livelihood activities and rural women. INTRODUCTION .... sale to buy farming inputs or other things they cannot produce. Also about 20% of the .... Internet Insiders, USA: McGraw Hill. Quan Julian ...

  12. Pop / Koit Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Koit

    2004-01-01

    Heliplaatidest: Razorlight "Up All Night", Julian Fane "Special Forces", Mark Laneqan Band "Bubblequm", Loits "Vere Kutse Kohustab", Ray Charles "Genius Loves Company", Carly Simon "Reflections: Carly Simon's Greatest Hits"

  13. BYSTANDER EFFECTS GENOMIC INSTABILITY, ADAPTIVE RESPONSE AND CANCER RISK ASSESSMENT FOR RADIAION AND CHEMICAL EXPOSURES

    Science.gov (United States)

    BYSTANDER EFFECTS, GENOMIC INSTABILITY, ADAPTIVE RESPONSE AND CANCER RISK ASSESSMENT FOR RADIATION AND CHEMICAL EXPOSURESR. Julian PrestonEnvironmental Carcinogenesis Division, U.S. Environmental Protection Agency, Research Triangle Park, N.C. 27711, USAThere ...

  14. Nos dlja shpiona odolzhili u majora militsii / Aleksandra Ovikova

    Index Scriptorium Estoniae

    Ovikova, Aleksandra

    2004-01-01

    Kuidas sündis vene nõukogude populaarne spiooniseriaal "TASS on volitatud teatama..." ("TASS upolnomotshen zajavit...") : stsenarist Julian Semjonov : režissöör Vladimir Fokin : Nõukogude Liit 1984

  15. Neid filme mine lähipäevil Pöffile vaatama / Rain Kooli

    Index Scriptorium Estoniae

    Kooli, Rain

    2007-01-01

    11. Pimedate Ööde filmifestivali filme - Gus Van Sant'i "Paranoid Park" (USA, Prantsusmaa), Sergei Bodrovi "Mongol" (Venemaa, Kasahstan), Julian Schnabeli "Tuukrikell ja liblikas" (Prantsusmaa, USA)

  16. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Hazard: The Hidden Dangers of Buying Decorative Contact Lenses Without a Prescription Leer en Español: Peligros asociados ... truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In One Eye By Non- ...

  17. Colored Contact Lens Dangers

    Science.gov (United States)

    ... Hazard: The Hidden Dangers of Buying Decorative Contact Lenses Without a Prescription Leer en Español: Peligros asociados ... truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In One Eye By Non- ...

  18. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager ... the lenses. Never share contact lenses with another person. Get follow up exams with your eye care ...

  19. Prizjorov kinofestivalei ne dopustili k borbje za "Oskar"

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika kinoakadeemia võõrkeelse filmi "Oscari" auhinnale ei pääsenud kandideerima Ang Lee Veneetsias Kuldlõvi saanud film "Ettevaatust, iha" ning Julian Schnabeli Cannes'is režiiauhinna saanud "Skafander ja liblikas"

  20. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... MD, professor of ophthalmology at Case Western Reserve University in Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In ...

  1. Synthesis, characterization and catalytic application of Ni catalysts ...

    Indian Academy of Sciences (India)

    2017-11-11

    Nov 11, 2017 ... 3Department of Industrial Engineering, Technological Institute of Leon, Industrial Julian de Obregon .... ethanol were mixed under an inert atmosphere of nitrogen, ..... lower selectivity towards hydrogen due to major production.

  2. 76 FR 2383 - Ocean Transportation Intermediary License Reissuance

    Science.gov (United States)

    2011-01-13

    .... 021694N Wheelsky Logistics, Inc., November 19, 2010. 14515 East Don Julian Road, City of Industry, CA... City, CA 91780. 018525N Valu Freight Consolidators, November 19, 2010. Inc., 1325 NW 21th Street, Miami...

  3. EPRA avas 20. tegevushooaja

    Index Scriptorium Estoniae

    2015-01-01

    15. septembril oli EPRA-l külas kogenud briti suhtekorraldaja ja ajalehe The Sun endine toimetaja Stuart Higgins ning Eestis veel katmata ala, õigusala meediaekspert Julian Pike. Selle kohtumisega avas EPRA oma 20. tegevushooaja

  4. Gene : CBRC-AGAM-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 27560014 /ug=Aga.24572 /len=986 7e-09 22% MVANTFAIVAKRSAIVAKRSAIIANTFTIVANYSAVVAKSSAIDPKSSAIVGKTFAIVAKTFAIVA...KTFAIVANYSAVVANYSAIVAKSSAIVAKSSAIVANTFAIFANTFAIVANTFAIIAKTFAIVAKTFAIVAKTFAIVAKSSAIVAKSSAIVAKSSAIVANTFAIVAKSS...AIVAKSSAIITNTFTIVANYSAVVAKSSAIVPKNSAIVGKTFAIVAKTFAIVAKTFAIVANTFAIVANYSAVVANYSAIVA...KSSAIVAKSSAIVAKTFAIFANTFAIVANTFAIVANYSAIVAKSSAIVAKSFEIIVKTFAIFAKTFAIVANYSAIVAKTFAIVAINSEIVAKSSATVANTFAIVANTFAIVANTFAIVAKTFAIVANYSAIVA ...

  5. Gene : CBRC-MDOM-02-0490 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTST...HLHIHPSIHPLIHSSTHPHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTST...YPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTST...HPSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...

  6. Gene : CBRC-PMAR-01-0324 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=EG024802 /gi=115341549 /ug=Pma.618 /len=652 2e-14 24% MFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFM...FCRCRCHWFFMFCRCRYHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFMFCRCRCHWFFVFCRSRCHWFFM...FCRCRCHWFFMFCRCRFNWFFMFCRCRCHWFFMFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFVFCRSRCHWFFMFCRCRCHWFFMFYRCRCLNDAAVHKNKNTAIVHVCKVTP ...

  7. Gene : CBRC-OLAT-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /clone_end=3' /gb=DC259951 /gi=141600100 /ug=Ola.17741 /len=827 1e-20 31% MVVCTAVCMAVCAAVCTAVCKEVCIAICTAICAVDCMAVFIAVCTDVLTAVCTAVC...VAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCTAVCTAICAVDCMAVCIAVCTDILTAVYTAVCTAVCMVVCTDVLTAVCKAVCMAVCKAICTAVCTAVCTAVCLYE ...

  8. Gene : CBRC-MMUS-23-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available LLKCVFVIYRDFHFSRHFPGPTVCISHFSRLLVNLSFFKSSSGCFSFSMIISFLSIFHVLQWRFLNFPPFSVFLAIFHILKCVLLIFWDFQFSCNIPGPTVCISHFSR...FSVISSFFKSSSGCFSFSMIFSFLAIFHVLQWILLYFPPFSVFLAIFHILKHVFLIFRDFQFSLNIPGPIVCISHFSCFSI...ISSSYFTSLTSLILFFRDFQFSRHIPGHTVCISHFSRFYCDIVIFQVVKWMFLIFHDFQFSCNIPCRTVDISKFFTFFSFPHHISRHKVCISHFP ... ... insert sequence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-112 58% MIFSFLSIFHVLQWTFLNYLPFSVFLAIFH

  9. Gene : CBRC-XTRO-01-2729 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 559 /gi=71785299 /ug=Str.71415 /len=820 6e-19 35% MQPPVYTTRLFHAAPCISHWALPCSPLYIPLRSSMQPPVYPTALFHAAPCISH...CALPCSPLYIPLRSSMQPPVYTTALFHAAPCISHCALPCSPLYIPLGFSMQPPVYPTGLFHAAPCISHWALPCRPLYIPLGFSMQPPVYPTGLFHAAPCISH...CALPCSPLYIPLRSSMQPPVYPTALFHAAPCISHCALPCSPLYIPLGSSMQPPVYPTALFHAAPCISHWAFPCSPLYIPLGSSMKHRTTFMQKTSTDAPAVPHTRSLTSCKLSLMLLPGLPKPFYIGIPRPYSQ ...

  10. Gene : CBRC-MMUS-09-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available equence /gb=AK156981 /gi=74152306 /ug=Mm.330279 /len=4633 1e-120 79% MIFSFLAIFQVLQWTFPNFRPLSVFLAIFHVPKCVFLIFHDFQFPRHIPGPTVCISH...FSRFSVISSFFKTSSGCFSFFMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSVILSFFN...LSTACFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFTFLAIFQVLQGHFSFFTFSVILSFSICQLHVSHFP ...

  11. Ultrasound-Guided Miniscalpel-Needle Release versus Dry Needling for Chronic Neck Pain: A Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Yongjun Zheng

    2014-01-01

    Full Text Available Objective. To compare ultrasound-guided miniscalpel-needle (UG-MSN release versus ultrasound-guided dry needling (UG-DN for chronic neck pain. Methods. A total of 169 patients with chronic neck pain were randomized to receive either UG-MSN release or UG-DN. Before treatment and at 3 and 6 months posttreatment, pain was measured using a 10-point visual analogue scale (VAS. Neck function was examined using the neck disability index. Health-related quality of life was examined using the physical component score (PCS and mental component score (MCS of the SF-36 health status scale. Results. Patients in the UG-MSN release had greater improvement on the VAS (by 2 points at 3 months and 0.9 points at 6 months versus in the UG-DN arm; (both P<0.0001. Patients receiving UG-MSN release also showed significantly lower scores on the adjusted neck disability index, as well as significantly lower PCS. No severe complications were observed. Conclusion. UG-MSN release was superior to UG-DN in reducing pain intensity and neck disability in patients with chronic neck pain and was not associated with severe complications. The procedural aspects in the two arms were identical; however, we did not verify the blinding success. As such, the results need to be interpreted with caution.

  12. Radiation sensitivity of two Ginger varieties (Zingiber officinale Rosc.) to gamma irradiation

    International Nuclear Information System (INIS)

    Nwachukwu, E.C.; Ene, L.S.O.; Mbanaso, E.N.A.

    1994-01-01

    The mutability and radiosensitivity of two local ginger varieties in Nigeria ''Tafin Giwa'' (UG 1) and ''Yatsun Biri'' (UG 2) were studied using gamma rays from a 60Co gamma source. There was a high frequency of chlorophyll mutations indicating a high mutability in ginger. GR 50 was obtained at 5.0 and 6.0 Gy in UG1, and UG2, respectively, while LD50 was obtained at 8.75 Gy in both varieties. The dose limitation range for ginger was estimated to be 5.0-9.0 Gy [es

  13. Gene : CBRC-OANA-01-1685 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR

  14. Gene : CBRC-FRUB-02-0753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available AB246172 /gi=115305877 /ug=Tru.3675 /len=5037 2e-47 41% MSNITTTTSATTSQTSSSTSTSPSTTSA...TTSSPTTSTTTSQTSSSTSTSPSTTSATTSSPTTSATTSQTSSSTATSPSTTSATTSSPTTSATTSQTSSSTSTSPSTTSATTSSPTTSATSSQTSSSTATSPSTTSETTSSPTTSA...TTSQTSSSTTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKTSSSTDTNPSTTSATTSSPTTSA...TTSQTSSSTTTNPSTTSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSKKSSSTDTNPSTTSATTSSPTTSA...TSSQTSSSTSTSPSTTSTTTSSPTTSATTSQTSSSTSTSPSTSSATTSSPTTSATTSQTSSSTTSPSTTSATTSSPTTSATTSQTSSSTTSPSTTSTTTSSPTTSA

  15. Gene : CBRC-DMEL-08-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 8016 /ug=Dm.1879 /len=6178 4e-22 26% MYCSCTGPVLVLYWSRSGPVLVPYWSRTGPVPGPVLVLGPVLDS...VLGSVLGSVLGSVLVLVLVPYWSRSGPVLVPYWSRTGPVLVPYSVPYSIPYWVQYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVL...VQYSVPYWSRTGRVLCSVLGSVLGPVLVPYWSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGP...VLSPVLSPVLVPYWSRTLFRTRFRTRSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTRSRTRSRTGP...VLVPYLSCTGPVLGHVLLLYWSRTGPILVPFWSRTGPVLVPYSVPYSYSVPYSIPYWVPYLVPYSVPYSFSYWFRTGPVLVPYWSRTGP

  16. Small battery operated unattended radar sensor for security systems

    Science.gov (United States)

    Plummer, Thomas J.; Brady, Stephen; Raines, Robert

    2013-06-01

    McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.

  17. Gene : CBRC-MDOM-04-0140 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available /cds=p(1,2634) /gb=NM_001099531 /gi=156119554 /ug=Mdm.4760 /len=2634 0.33 30% MPNSLTSALLNLLIYELKDMNFPLTTALAASHRFCKDVSSLSFSSMKLLIISTI...CSLSNQFWRIVFFNFQLIFDLPLHVPLLIIIFIALLSEKVAFIISALLNLFGMFLC

  18. Associations between physical activity and characteristics of urban green space

    DEFF Research Database (Denmark)

    Schipperijn, Jasper; Bentsen, Peter; Troelsen, Jens

    2013-01-01

    of the nearest UGS, and the presence of certain features. However, the evidence to date is somewhat inconclusive, and dominated by studies from North America and Australia. There is a large variation in city structures, and recommendations for North American or Australian cities are not automatically valid...... was found. The amount and number of UGS within one kilometre revealed no association either. For PA in the nearest UGS positive associations with size, walking/cycling routes, wooded areas, water features, lights, pleasant views, bike rack, and parking lot were found. This indicates that PA in an UGS might...

  19. Gene : CBRC-PMAR-01-0595 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available =3' /gb=EE272592 /gi=111172325 /ug=Pma.6919 /len=680 2e-04 30% MRLEYLAAIHFNVMMSHFVMMSHFVMMSHFVMMSHVVMMS...YFVMMSHFVMMSHFVMSHVVMMSHFVMSHFVMMSHVVMMSHFVMMSHFVMMSHVVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMSHVVMMS...HFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVXXXXEPLRDDEPLRDDEPLRDDEPLRDDEPLRDDESLR

  20. Gene : CBRC-CINT-01-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 500 /gi=47795328 /ug=Cin.16042 /len=777 0.22 22% MCXXXXXXXXXXXXXXXXXIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

  1. Gene : CBRC-MDOM-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 11) /gb=EF508680 /gi=145232584 /ug=Mdm.4709 /len=10011 0.055 29% MKLINYIYSSVWHFLINFINSS...VWHFLINFIYSSVWHFLINFINSSVWHFLINFIYSSVWHFLINFINSSVWHFLINFINSSVWHFLINFIYSSSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFGQFHILFSLALFL ...

  2. Gene : CBRC-DRER-22-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 102920926 /ug=Dr.79541 /len=690 4e-72 87% MECAARSGDEKELENSKAGVVAARVLNSGVVARVLISCVVARVLSSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVDARVLNSGVVARVLISCVVARVLNSGVVAR...VLISCVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVAR...VLISCVDARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVARVLNSGVVSTLFRLMQT ...

  3. Gene : CBRC-CINT-01-0197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1561) /gb=AY895021 /gi=62903344 /ug=Cin.18201 /len=1561 1.4 25% MELDHIVLVLRNIFLMV...VDWPFLWSVRRCHRMELDHTVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMVVEQPFLQLVRRYQRMELDHI...VLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMEQPFLQLVRRYQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQCMEQEQMKQVKE ...

  4. Gene : CBRC-XTRO-01-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 6e-62 55% MYFSVFANEIRNFIANSCPM...LPVCAILCLPYAACMPYSACPMLPVCAILCLPYAACVCHTRPALCCLCVSYSACPMLPVCHILPALCCLCVLYFACPMLLVCVILDLPYAACVCHTLPALCCMCVPYSACPM...LPVCAILCLPYAACVPYSACPMLPVCAILCLPYAACVCHTLPALCCMCVPYSACPMLPVCAILCLPYAAGVCHTRPALCCLCVPYSACPMLPVFDIPCPYLPTVPLSVGQSQYLWHCPLSRIHC ...

  5. Gene : CBRC-XTRO-01-3375 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available d=5' /gb=ES686353 /gi=148865870 /ug=Str.75856 /len=769 8e-72 58% MLPVCHTLPALCCMCVPYSACPM...VPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCAILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVFHTLPALCCLCVPYFPCPFLPVFHNLPVLCCLCVPYSACPM...LPVCPILCLPYAACVFHTLPALCCLCVPYSACPMLPVCSILCLPYAACVCHTLPALCCLCVPYSACPMLPVCSTLCLPYAACVCHTFPAFFCLCSIICLSYAACVFHTLPVLCCLCVPYSACPMLPVCATLCLPYAAYGR ...

  6. Gene : CBRC-MMUS-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 205) /gb=AB034730 /gi=7209718 /ug=Mm.329131 /len=3320 9e-14 24% MLLMCSMTMLLMRSAITLLICSATMLFMHSATM...LLMCSVNMLFMCSATMLFMGSATTLLMGSATMLLMGSANLLFMGSGTKLFKGSATMLFMGSATMLLMGSATMLLIGSATMLFKGSTNMLLMCSATMVFMGSGIMLFKGSATM...LFMHSSTMLHMGSGTKLFIGSATMLLMGSATMLFKGSATMLSMHSVTMLHMGSATMSFMGSATMLFNGSAAMSFMGSATMLRIPWRLGVEESLERLKEFSLTDLFSSGFMQG ...

  7. Gene : CBRC-RNOR-14-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ' /gb=CB805046 /gi=29921778 /ug=Rn.215427 /len=409 2e-13 100% MYHFLGFATLMLLMCSATM...MFMLSVNMLLMRSVNLLLTFSVHVLLICSVNTLPMCSVNMFMHSTIMLLMCSAIMLLMSSKVMLLMSSAIMLLMWSAILLRVRLATMLLMCSVITLFMGSATMLSMCPETMLITCSATTLSMCSATM...QSMGSATMQFMGSATMQFMHSANMLFMGSATMQFMHSSNMLFMGSATMQFMHSSNMLFMGSATMLFMGSATMQFMHSATMQVMGSATML...HMGSATTLFMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATTLFMGPAIMLHMGSATMLFMGPAIMLHMGSATMLHMGSAIMLCMCPATM...LLMCSAIILYMGSATMLSMCSATMQFMGSATMQFMGSATMQFMGSATMLSMYSAIMQFMGSATMLSMCSATMQFMGSATMQFMHSATMQFMGSATMLSMCSATMQFMGSATMQFMGSATM ...

  8. The anger-infused Ultimatum Game: A reliable and valid paradigm to induce and assess anger.

    Science.gov (United States)

    Gilam, Gadi; Abend, Rany; Shani, Hagai; Ben-Zion, Ziv; Hendler, Talma

    2018-03-22

    The Ultimatum Game (UG) is a canonical social decision-making task whereby a proposer divides a sum of money between himself and a responder who accepts or rejects the offer. Studies consistently demonstrate that unfair offers induce anger, and that rejecting such offers relates to aggression. Nevertheless, the UG is limited in interpersonal provocations common to real-life experiences of anger. Moreover, the psychometric properties of the UG as an anger-induction paradigm have yet to be evaluated. Here, to induce a more intense and genuine anger experience, we implemented a modified UG whereby short written provocations congruent with unfairness levels accompanied each offer. We aimed to test whether this anger-infused UG led to more anger and aggressive responses relative to the standard UG and to establish the reliability and validity of both versions. Participants performed either the anger-infused UG or a standard version, repeated twice, a week apart. They also performed the Taylor Aggression Paradigm, a reactive aggression paradigm, and completed emotion ratings and a trait anger inventory. Results indicate similar decreases in acceptance rates with increase in offer unfairness, and increases in reported anger, across both UG versions. Both versions demonstrated strong test-retest reliability. However, the anger-infused UG led to significantly stronger relations with reactive aggression and trait anger compared to the standard UG, providing evidence for better validity. The development of the anger-infused UG as a reliable and valid paradigm is pivotal for the induction and assessment of interpersonal anger and its aggressive expression in basic and clinical research settings. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  9. Biochemistry and Chemotherapy of Malaria and Leishmaniasis

    Science.gov (United States)

    1993-12-06

    ethanol plant extracts including; nutmeg (Myristicaceae sp.), ginger ( Zingiber officinale ), goldenseal root (Hydrastis canadensis), garlic (Allium...scorodoprasum (elephant garlic), Ailium sativum (garlic), Zingiber officinale ,ginger), Myristicaceae sp. (nutmeg), Hydrastis canadensis (goldenseal...They were Glycyrrhiza glabra (IC25: 6 ug protein/ml)(Fig.7), Zingiber officinale (IC25: 14 ug protein/ ml), and ethanol extracts of Myristacea sp

  10. Unigene BLAST: CBRC-ATHA-03-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-03-0010 gnl|UG|At#S11719378 Arabidopsis thaliana ATARP9 (ACTIN-RELATED PR...OTEIN 9); protein binding (ATARP9) mRNA, complete cds /cds=p(235,2025) /gb=NM_123716 /gi=30694311 /ug=At.26311 /len=2187 0.47 36% ...

  11. Decision Making on Allocating Urban Green Spaces Based upon Spatially-Varying Relationships between Urban Green Spaces and Urban Compaction Degree

    Directory of Open Access Journals (Sweden)

    Hsueh-Sheng Chang

    2015-09-01

    Full Text Available The compact city is becoming a prevailing paradigm in the world to control urban sprawl and achieve a pattern of sustainable urban development. However, discussions of the area's overcrowded neighborhoods, its health problems, and the destruction of its green areas have inspired self-examination with respect to the compact city paradigm. High population density attracts even more residents and frequently renders the existing urban green space (UGS insufficient for use as part of a living environment. Due to the unique benefits that these qualities confer, UGS allocation is now considered a significant contributing factor to urban livability. In addition, the UGS allocation may be different due to the presence of many spatial non-stationarity processes. Therefore, this study employs geographically-weighted regression (GWR to explore the unique and spatially-explicit relationships between the degree of urban compaction and UGS within the Taipei metropolitan area. Maps summarizing the GWR results demonstrate that there is significantly insufficient UGS allocation in the central area, which consists mainly of Taipei City. Townships with higher parameters contain UGS levels that better meet the needs of their residents. Overall, the exploration of conceptualizing spatial heterogeneity of relationships between the degree of urban compaction and UGS can provide insightful analyses for decision-making on allocating UGS.

  12. Unigene BLAST: CBRC-GGAL-02-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-02-0038 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 4e-30 25% ...

  13. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-12-0011 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 5e-38 44% ...

  14. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-26-0008 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-82 44% ...

  15. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  16. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  17. Unigene BLAST: CBRC-GGAL-04-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-30 26% ... ...CBRC-GGAL-04-0034 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  18. Unigene BLAST: CBRC-GGAL-06-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 2e-85 49% ... ...CBRC-GGAL-06-0012 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  19. Unigene BLAST: CBRC-GGAL-05-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 4e-09 24% ... ...CBRC-GGAL-05-0037 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  20. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 1e-80 43% ...

  1. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-24 29% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  2. Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

  3. Unigene BLAST: CBRC-GGAL-06-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-36 29% ... ...CBRC-GGAL-06-0000 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  4. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-26 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  5. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 4e-34 27% ...

  6. Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 1e-25 28% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  7. Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...

  8. Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 0.0 100% ...

  9. Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 9e-84 48% ... ...CBRC-GGAL-26-0008 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  10. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

  11. Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-32 28% ...

  12. Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  13. Unigene BLAST: CBRC-GGAL-03-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-27 32% ... ...CBRC-GGAL-03-0015 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  14. Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  15. Unigene BLAST: CBRC-GGAL-06-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-21 24% ... ...CBRC-GGAL-06-0001 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  16. Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

  17. Unigene BLAST: CBRC-HSAP-23-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0071 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 95% ...

  18. Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-87 50% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  19. Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

  20. Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-32 30% ... ...CBRC-GGAL-12-0011 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  1. Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-29 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  2. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 2e-34 27% ...

  3. Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 5e-23 25% ...

  4. Unigene BLAST: CBRC-GGAL-03-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 3e-24 24% ... ...CBRC-GGAL-03-0047 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  5. Hedonic pricing analysis of the influence of urban green spaces onto residential prices : the case of Leipzig, Germany

    NARCIS (Netherlands)

    Liebelt, Veronika; Bartke, Stephan; Schwarz, Nina

    2018-01-01

    In the light of global urbanization and biodiversity loss, ecosystem services provided by urban green spaces (UGS) are becoming increasingly important, not least as a recovery and recreation opportunity for citizens. The valuation of UGS is significant for urban planners, who make decisions on the

  6. Evidence for the Fundamental Difference Hypothesis or Not?: Island Constraints Revisited

    Science.gov (United States)

    Belikova, Alyona; White, Lydia

    2009-01-01

    This article examines how changes in linguistic theory affect the debate between the fundamental difference hypothesis and the access-to-Universal Grammar (UG) approach to SLA. With a focus on subjacency (Chomsky, 1973), a principle of UG that places constraints on "wh"-movement and that has frequently been taken as a test case for verifying…

  7. Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

  8. Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

  9. Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

  10. Unigene BLAST: CBRC-GGAL-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 3e-50 34% ... ...CBRC-GGAL-03-0016 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

  11. Unigene BLAST: CBRC-MDOM-06-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed neurotrophic factor (BDNF), mRNA /cds=p(1,786) /gb=XM_001368353 /gi=126332213 /ug=Mdm.339 /len=786 0.026 33% ... ...CBRC-MDOM-06-0030 gnl|UG|Mdm#S37377868 PREDICTED: Monodelphis domestica brain-deriv

  12. Blood Lead Levels And Potental Environmental Exposures Among ...

    African Journals Online (AJOL)

    p = 0.439). Low risk parental occupation (p = 0.001) and. Kales sourced from the market/kiosks (p = 0.001) were significantly associated with BLL ≥ 10ug/dl. Soil lead levels (Soil Pb) ranged from 3,000 to 90,000ug/kg, which was very high ...

  13. Geomechanical Assessments of Simultaneous Operation in the Case of Transition from Open Pit to Underground Mine in Vietnam

    Science.gov (United States)

    Niedbalski, Zbigniew; Nguyen, Phu Minh Vuong; Widzyk-Capehart, Eleonora

    2018-03-01

    Nowadays, for a number of reasons, many open pit mines are considering a transition from Open Pit (OP) to Underground (UG) to remain competitive. In OP-UG transition, UG operation is operated simultaneously with the OP operation for a certain period of time. Guidelines for the simultaneous operation of OP and UG are very difficult to establish, as there are very few case studies available. Yet, because of the OP-UG interactions; the operation has a higher safety, technical and management requirements than the OP or UG methods when considered separately. In Vietnam, Cao Son is one of many OP mines, which decided to change the operational system from OP to UG. Simultaneous operation started in 2015 and will be conducted until 2030 when the OP mine Cao Son ends its mining activities. In this paper, selected geomechanical considerations of the simultaneous operation are presented. A number of numerical modelling calculations using finitedifference software with code FLAC were carried out for calibration process, slope stability analysis and the OP-UG interaction analysis for the Cao Son - Khe Cham II-IV mine. Based on the results obtained from numerical modelling, the geomechanical assessments of simultaneous operation Cao Son - Khe Cham II-IV are discussed in this paper.

  14. Characterization of oils from Duranta repens leaf and seed

    Directory of Open Access Journals (Sweden)

    Agomuo Emmanuel

    2017-11-01

    Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p  oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.

  15. Unigene BLAST: CBRC-TGUT-37-0238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available egment Chr 11 Brigham & Women's Genetics 0434 expressed variant 2-like mRNA, complete sequence /gb=DQ215253 /gi=76158658 /ug=Tgu.7189 /len=654 1.4 27% ... ...CBRC-TGUT-37-0238 gnl|UG|Tgu#S33942003 Taeniopygia guttata clone 0058P0013A02 DNA s

  16. Biodiversity in the city: key challenges for urban green space management

    Science.gov (United States)

    Myla F.J. Aronson; Christopher A. Lepczyk; Karl L. Evans; Mark A. Goddard; Susannah B. Lerman; J. Scott MacIvor; Charles H. Nilon; Timothy. Vargo

    2017-01-01

    Cities play important roles in the conservation of global biodiversity, particularly through the planning and management of urban green spaces (UGS). However, UGS management is subject to a complex assortment of interacting social, cultural, and economic factors, including governance, economics, social networks, multiple stakeholders, individual preferences, and social...

  17. report general | 1-Overview | 5-Publications | Indian Academy of ...

    Indian Academy of Sciences (India)

    In this process, the advantages offered by distance education methods should also be exploited. ... The U.G. course should be solid and broad based, providing a good ... Thus all U.G. students should take some common courses in physics, ...

  18. Unigene BLAST: CBRC-TGUT-29-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-29-0000 gnl|UG|Tgu#S36163076 Taeniopygia guttata clone 0057P0006B02 megalencephalic leukoencephalo...pathy with subcortical cysts 1-like mRNA, complete sequence /gb=EF191703 /gi=120431699 /ug=Tgu.3485 /len=1532 1.8 21% ...

  19. Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...

  20. Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...

  1. Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...

  2. Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...

  3. Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...

  4. Unigene BLAST: CBRC-ATHA-05-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-05-0034 gnl|UG|At#S11736431 Arabidopsis thaliana ATMPK19 (Arabidopsis tha...liana MAP kinase 19); MAP kinase (ATMPK19) mRNA, complete cds /cds=p(1,1761) /gb=NM_112333 /gi=30683276 /ug=At.8069 /len=1897 6.9 42% ...

  5. Unigene BLAST: CBRC-FRUB-02-0691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0691 gnl|UG|Tru#S21434263 AL836416 EFRd Takifugu rubripes cDNA clone EFRd031apc...G19, mRNA sequence /clone=EFRd031apcG19 /gb=AL836416 /gi=21878378 /ug=Tru.2410 /len=418 0.24 31% ...

  6. Unigene BLAST: CBRC-FRUB-02-0424 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0424 gnl|UG|Tru#S21433401 AL835449 EFRb Takifugu rubripes cDNA clone EFRb017apc...D5, mRNA sequence /clone=EFRb017apcD5 /gb=AL835449 /gi=21877411 /ug=Tru.1107 /len=522 8.4 39% ...

  7. Unigene BLAST: CBRC-FRUB-02-0750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0750 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.9 26% ...

  8. Unigene BLAST: CBRC-FRUB-02-0743 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0743 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.4 26% ...

  9. Unigene BLAST: CBRC-FRUB-02-0642 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0642 gnl|UG|Tru#S21434581 AL836626 EFRe Takifugu rubripes cDNA clone EFRe005apc...A11, mRNA sequence /clone=EFRe005apcA11 /gb=AL836626 /gi=21878588 /ug=Tru.118 /len=378 3.6 33% ...

  10. Unigene BLAST: CBRC-FRUB-02-0924 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0924 gnl|UG|Tru#S21434557 AL836584 EFRe Takifugu rubripes cDNA clone EFRe005apc...K15, mRNA sequence /clone=EFRe005apcK15 /gb=AL836584 /gi=21878546 /ug=Tru.1833 /len=509 7.4 31% ...

  11. Unigene BLAST: CBRC-FRUB-02-0627 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0627 gnl|UG|Tru#S21434842 AL836687 EFRe Takifugu rubripes cDNA clone EFRe005apc...N22, mRNA sequence /clone=EFRe005apcN22 /gb=AL836687 /gi=21878649 /ug=Tru.3747 /len=363 1.4 48% ...

  12. Unigene BLAST: CBRC-FRUB-02-0118 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0118 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 2.4 33% ...

  13. Unigene BLAST: CBRC-FRUB-02-0587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0587 gnl|UG|Tru#S21435116 AL837106 EFRf Takifugu rubripes cDNA clone EFRf030apc...H13, mRNA sequence /clone=EFRf030apcH13 /gb=AL837106 /gi=21879068 /ug=Tru.387 /len=294 4.9 35% ...

  14. Unigene BLAST: CBRC-FRUB-02-0677 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0677 gnl|UG|Tru#S21435495 AL837483 EFRj Takifugu rubripes cDNA clone EFRj028apc...P21, mRNA sequence /clone=EFRj028apcP21 /gb=AL837483 /gi=21879445 /ug=Tru.1777 /len=323 7.9 50% ...

  15. Unigene BLAST: CBRC-FRUB-02-0784 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0784 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 2.0 26% ...

  16. Unigene BLAST: CBRC-FRUB-02-0299 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0299 gnl|UG|Tru#S21434159 AL836234 EFRd Takifugu rubripes cDNA clone EFRd007apc...O23, mRNA sequence /clone=EFRd007apcO23 /gb=AL836234 /gi=21878196 /ug=Tru.1814 /len=463 0.63 32% ...

  17. Unigene BLAST: CBRC-FRUB-02-0473 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0473 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 0.47 28% ...

  18. Unigene BLAST: CBRC-FRUB-02-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0104 gnl|UG|Tru#S21435233 AL837260 EFRg Takifugu rubripes cDNA clone EFRg101apc...H6, mRNA sequence /clone=EFRg101apcH6 /gb=AL837260 /gi=21879222 /ug=Tru.2053 /len=465 3.3 30% ...

  19. Unigene BLAST: CBRC-FRUB-02-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0391 gnl|UG|Tru#S21434264 AL836417 EFRd Takifugu rubripes cDNA clone EFRd031apc...K15, mRNA sequence /clone=EFRd031apcK15 /gb=AL836417 /gi=21878379 /ug=Tru.1810 /len=428 0.75 34% ...

  20. Unigene BLAST: CBRC-FRUB-02-0702 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0702 gnl|UG|Tru#S21434160 AL836235 EFRd Takifugu rubripes cDNA clone EFRd007apc...K11, mRNA sequence /clone=EFRd007apcK11 /gb=AL836235 /gi=21878197 /ug=Tru.2312 /len=411 6.4 28% ...

  1. Pramana – Journal of Physics | News

    Indian Academy of Sciences (India)

    A novel pedagogical technique is presented that can be used in the undergraduate (UG) class to formulate a relativistically extended kinetic theory of gases and thermal speed distribution, while assuming the basic thermal symmetry arguments of the famous Maxwell–Boltzmann distribution as presented at the UG level.

  2. A new multiplicity formula for the Weyl modules of type A

    International Nuclear Information System (INIS)

    Ye Jiachen; Zhou Zhongguo

    2003-08-01

    A monomial basis and a filtration of subalgebras for the universal enveloping algebra U(g) of a complex simple Lie algebra g l of type A I is given in this note. In particular, a new multiplicity formula for the Weyl module V(λ) of U(g l ) is obtained in this note. (author)

  3. Optimization of extraction parameters for recovery of a-amylase from the fermented bran of Bacillus circulans GRS313

    Directory of Open Access Journals (Sweden)

    Palit Soumen

    2001-01-01

    Full Text Available The extraction of alpha-amylase in the solid state fermentation of wheat bran by Bacillus circulans GRS313 was optimized. Among various solvents tested, maximum extraction was achieved when 2.5% (v/v glycerol was added. The optimum conditions for extraction were 2.5 hrs soaking time at 30° C under recirculation and agitated condition, which yielded 590 U/g bran of enzyme activity. Whereas under stationary soaking condition the activity of the enzyme was 439.58U/g bran. With repeated wash under the above optimum conditions showed that 600 U/g and 184.2 U/g of enzyme extracted in the 1st and 2nd washes respectively and only 36.84 U/g was recovered in the 3rd wash

  4. The Development of Theory of Mind and Positive and Negative Reciprocity in Preschool Children.

    Science.gov (United States)

    Schug, Joanna; Takagishi, Haruto; Benech, Catalina; Okada, Hiroyuki

    2016-01-01

    This study examined the relation between the acquisition of false-beliefs theory of mind (ToM) and reciprocity in preschoolers. Preschool-aged children completed a task assessing the understanding of false beliefs, and played an Ultimatum Game (UG) with another child in a face-to-face setting. Negative reciprocity was assessed by examining the rejection of unfair offers made by another child in the UG, while positive reciprocity was assessed by examining allocations made by participants in a Dictator Game (DG) following the UG. The results indicated that children who had passed a task assessing first-order false beliefs were more likely to make generous offers in a DG following a fair offer made by their partner in a proceeding UG, but that false beliefs ToM was unrelated to the rejection of unfair offers in the UG.

  5. Concentraciones de yodo en orina y en sal de consumo en mujeres entre 12 a 49 años del Perú

    Directory of Open Access Journals (Sweden)

    Carolina Tarqui-Mamani

    Full Text Available Objetivos. Determinar las concentraciones de yodo en orina y sal de consumo en mujeres entre 12 a 49 años en Perú. Materiales y métodos. Se realizó un estudio observacional y transversal. Durante el 2012 y 2013, se incluyó mujeres entre 12 a 49 años residentes en los hogares peruanos seleccionadas mediante un muestreo probabilístico, estratificado y multietápico. La determinación de yodo en orina se realizó por espectrofotometría basada en la reacción de Sandell-Kolthoff. La evaluación cualitativa de yodo en sal se realizó por yoditest y la cuantitativa por volumetría. El procesamiento se realizó mediante muestras complejas con ponderaciones. Se obtuvo medianas, rango intercuartílico y percentiles. Resultados. La mediana de yoduria en las participantes fue 250,4 ug/L; los departamentos con medianas de yoduria elevadas fueron: Moquegua (389,3 ug/L; Tacna (320,5 ug/L; Madre de Dios (319,8 ug/L, y Ucayali (306,0 ug/L; mientras que Puno (192,9 ug/L; Piura (188,1 ug/L y Tumbes (180,5 ug/L tuvieron medianas dentro de lo recomendado por la OMS. La mediana de yoduria en gestantes fue 274,6 ug/L (RIQ: 283 ug/L. El 82,5% de las muestras de sal tuvieron yodo ≥30 ppm y 1,9% tuvo valores de 0 ppm. Conclusiones. La mediana de yoduria en las mujeres peruanas está por encima de lo recomendado por la OMS y la mayoría de las muestras de sal tuvieron concentraciones adecuadas de yodo según la OMS

  6. Ugonin U stimulates NLRP3 inflammasome activation and enhances inflammasome-mediated pathogen clearance

    Directory of Open Access Journals (Sweden)

    Chun-Yu Chen

    2017-04-01

    Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.

  7. SUSCEPTIBILIDAD ANTIMICROBIANA DE AISLAMIENTOS DE Salmonella enterica PROVENIENTES DE PISOS, EQUIPOS, UTENSILIOS Y PRODUCTO TERMINADO EN PLANTAS DE BENEFICIO PORCINO EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    P. M. Bermúdez

    2016-01-01

    Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.

  8. Simultaneous determination of sulphaquinoxaline and amprolium in veterinary mixture by HPLC and first derivative ultraviolet spectrophotometry

    International Nuclear Information System (INIS)

    El-Sattar, Osama Abd

    2002-01-01

    Two simple and reliable methods are described for the determination of sulphaquinoxaline (SQX) and amprolium (AMP) combined in veterinary powder. The first method depends on high performance liquid chromatography on a reversed phase column (Bondapak-C18) using mobile phase consisting of acetonitrile-methanol-water-phosphoric acid (30: 5: 55: 0.7, by volumes) at a flow rate of 1 ml min with UV detection at 254 nm. The detection limits were 0.2 ug ml and 0.35 ug ml and linearity ranges were 2-20 ug ml and 4-40ug ml for SQX and AMP, respectively. The second one deals with the first derivative (D) spectrophotometry with zero-crossing measurement at 253 nm and 226 nm for SQX and AMP respectively. The detection limits were 0.3 ug ml and linearity ranges were 1-18 ug ml and 4-32 ug-ml for SQX and AMP respectively. The proposed procedures were successfully applied to the determination of these drugs in laboratory prepared mixtures with mean percentage recovery ranged from 98.50 to 99.75 and in commercial preparation ranged from 103.85 to 104.85. (author)

  9. Mineralogic sources of metals in leachates from the weathering of sedex, massive sulfide, and vein deposit mining wastes

    Science.gov (United States)

    Diehl, S.F.; Hageman, P.L.; Seal, R.R.; Piatak, N.M.; Lowers, H.

    2011-01-01

    Weathered mine waste consists of oxidized primary minerals and chemically unstable secondary phases that can be sources of readily soluble metals and acid rock drainage. Elevated concentrations of metals such as Cd, Cu, Fe, Mn, Ni, Pb, and Zn are observed in deionized water-based leachate solutions derived from complex sedex and Cu-Pb-Zn mine wastes. Leachate (USGS FLT) from the Elizabeth mine, a massive sulfide deposit, has a pH of 3.4 and high concentrations of Al (16700 ug/L), Cu (440 ug/L), and Zn (8620 ug/L). Leachate from the sedex Faro mine has a pH of 3.5 and high concentrations of Al (2040 ug/L), Cu (1930 ug/L), Pb (2080 ug/L), and Zn (52900 ug/L). In contrast, higher-pH leachates produced from tailings of polymetallic vein deposits have order of magnitude lower metal concentrations. These data indicate that highly soluble secondary mineral phases exist at the surface of waste material where the samples were collected. Sulfide minerals from all sites exhibit differential degrees of weathering, from dissolution etched grain rims, to rinds of secondary minerals, to skeletal remnants. These microscale mineral-dissolution textures enhance weathering and metal teachability of waste material. Besides the formation of secondary minerals, sulfide grains from dried tailings samples may be coated by amorphous Fe-Al-Si minerals that also adsorb metals such as Cu, Ni, and Zn.

  10. Power to punish norm violations affects the neural processes of fairness-related decision making

    Directory of Open Access Journals (Sweden)

    Xuemei eCheng

    2015-12-01

    Full Text Available Punishing norm violations is considered an important motive during rejection of unfair offers in the Ultimatum Game (UG. The present study investigates the impact of the power to punish norm violations on people’s responses to unfairness and associated neural correlates. In the UG condition participants had the power to punish norm violations, while an alternate condition, the Impunity Game (IG, was presented where participants had no power to punish norm violations since rejection only reduced the responder’s income to zero. Results showed that unfair offers were rejected more often in UG compared to IG. At the neural level, anterior insula and dorsal anterior cingulate cortex were more active when participants received and rejected unfair offers in both UG and IG. Moreover, greater dorsolateral prefrontal cortex activity was observed when participants rejected than accepted unfair offers in UG but not in IG. Ventromedial prefrontal cortex activation was higher in UG than IG when unfair offers were accepted as well as when rejecting unfair offers in IG as opposed to UG. Taken together, our results demonstrate that the power to punish norm violations affects not only people’s behavioral responses to unfairness but also the neural correlates of the fairness-related social decision-making process.

  11. Urinary continence following repair of intermediate and high urogenital sinus in CAH. Experience with 55 cases.

    Directory of Open Access Journals (Sweden)

    Maria Marcela Bailez

    2014-07-01

    Full Text Available Aim :Evaluate postoperative urinary continence in patients withcongenital adrenal hyperplasia(CAHwith intermediate (ITand high urogenital sinus (UGS who underwent a UGS mobilization maneuver .Methods: We called IT to those that although needing an aggressive dissection to get to the vagina, still have enough urethra proximal to the vaginal confluence. Very low variants are excluded from this analysis. Dissection always started in the posterior wall of the UGS with an aggressive separation from the anterior rectal wall. If the wide portion of the vagina was reached dissection stopped and the UGS opened ventrally widening to the introitus. Nineteen patients were treated using this maneuver (Group1. When more dissection was required the anterior wall of the UGS was dissected and carefully freed from the low retropubic space. Then the UGS was opened either ventrally or dorsally. Thirty three patients required this approach (Group 2 .Combined procedures were used in 3 patients with high UGS (Group 3. Results : Mean age at the time of the repair and length of the UGS were 12.2 years (4 months to 18 years and 3.75 cm (3 -8 cmfor G 1; 8 years (5 months to 17 years and 6.34 cm ( 4-12 cm in G2 and 8,3 years (2 -14 y and 11.5cm (11-12cm in G3. All patients had been regularly followed. Mean age at last follow up of 14.3y, 17y and 9.9y for groups 1, 2 and 3 respectively. All patients continue to void normally and are continent. All patients have 2 separate visible orifices in the vulva. Only 3 are sexually active.Conclusion: UGS mobilization for vaginoplasty in girls with CAH does not compromise voiding function or urinary continence,

  12. Promotion of hepatic preneoplastic lesions in male B6C3F1 mice by unleaded gasoline.

    Science.gov (United States)

    Standeven, A M; Wolf, D C; Goldsworthy, T L

    1995-01-01

    In previous studies, unleaded gasoline (UG) vapor was found to be a liver tumor promoter and hepatocarcinogen in female mice, but UG was not a hepatocarcinogen in male mice. However, UG vapor had similar transient mitogenic effects in nonlesioned liver of both male and female mice under the conditions of the cancer bioassay. We used an initiation-promotion protocol to determine whether UG vapor acts as a liver tumor promoter in male mice and to examine proliferative effects that may be critical to tumor development. Twelve-day-old male B6C3F1 mice were injected with N-nitrosodiethylamine (DEN; 5 mg/kg, intraperitoneally) or vehicle. Starting at 5-7 weeks of age, mice were exposed by inhalation 6 hr/day, 5 days/week for 16 weeks to 0 or 2046 ppm of PS-6 blend UG. UG treatment caused a significant 2.3-fold increase in the number of macroscopic hepatic masses in DEN-initiated mice, whereas no macroscopic masses were observed in non-initiated mice. Altered hepatic foci (AHF), which were predominantly basophilic in phenotype, were found almost exclusively in DEN-initiated mice. UG treatment significantly increased both the mean volume (threefold) and the volume fraction (twofold) of the AHF without increasing the number of AHF per unit area. UG also induced hepatic pentoxyresorufin-O-dealkylase (PROD) activity, a marker of CYP2B, by more than 12-fold over control with or without DEN cotreatment. To study hepatocyte proliferative effects of UG, we treated mice with 5-bromo-2'-deoxyuridine (BrdU) via osmotic pump for 3 days before necropsy and measured hepatocyte BrdU labeling index (LI) in AHF and nonlesioned liver.(ABSTRACT TRUNCATED AT 250 WORDS) Images Figure 1. PMID:7588481

  13. Addition of Aegilops U and M Chromosomes Affects Protein and Dietary Fiber Content of Wholemeal Wheat Flour

    Directory of Open Access Journals (Sweden)

    Marianna Rakszegi

    2017-09-01

    Full Text Available Cereal grain fiber is an important health-promoting component in the human diet. One option to improve dietary fiber content and composition in wheat is to introduce genes from its wild relatives Aegilops biuncialis and Aegilops geniculata. This study showed that the addition of chromosomes 2Ug, 4Ug, 5Ug, 7Ug, 2Mg, 5Mg, and 7Mg of Ae. geniculata and 3Ub, 2Mb, 3Mb, and 7Mb of Ae. biuncialis into bread wheat increased the seed protein content. Chromosomes 1Ug and 1Mg increased the proportion of polymeric glutenin proteins, while the addition of chromosomes 1Ub and 6Ub led to its decrease. Both Aegilops species had higher proportions of β-glucan compared to arabinoxylan (AX than wheat lines, and elevated β-glucan content was also observed in wheat chromosome addition lines 5U, 7U, and 7M. The AX content in wheat was increased by the addition of chromosomes 5Ug, 7Ug, and 1Ub while water-soluble AX was increased by the addition of chromosomes 5U, 5M, and 7M, and to a lesser extent by chromosomes 3, 4, 6Ug, and 2Mb. Chromosomes 5Ug and 7Mb also affected the structure of wheat AX, as shown by the pattern of oligosaccharides released by digestion with endoxylanase. These results will help to map genomic regions responsible for edible fiber content in Aegilops and will contribute to the efficient transfer of wild alleles in introgression breeding programs to obtain wheat varieties with improved health benefits.Key Message: Addition of Aegilops U- and M-genome chromosomes 5 and 7 improves seed protein and fiber content and composition in wheat.

  14. Isomeric rations study for the α + 70 Ge

    International Nuclear Information System (INIS)

    Hora Villano, M.H. da.

    1984-12-01

    Isomeric ratios for 73 Se F,I produced in the reaction α + 70 Ge with incidence laboratory energy ranging from 8 to 28 MeV, have been measured using off-line γ-ray spectroscopy. Relative formation cross-section for isomeric and ground states were obtained with NAT Ge targets. Compound nucleus statistical analyses were performed using computer codes Alice and Julian. Unlike to Alice code, the Julian code predictions agreed quite well with the experimental results. This agreement may be explained by the inclusion of the γ competition in the deexcitation channels of the compound nucleus and by the correct level density calculation of the emission probabilities in the Julian code. Finally angular momentum populations for isomers formations in the reaction 70 Ge(α, n) 73 have been determined. (author)

  15. Effect of anti-inflamentation extracts from Korean traditional medicinal herb

    Directory of Open Access Journals (Sweden)

    Zhang Xiaowan

    2014-09-01

    Full Text Available Five Mix Plant Extracts according to different extraction solvents were assessed for its cell viability and anti-inflammatory activity by in vitro methods. The single plant extract was extracted with 70% ethanol(EtOH and the mix plants(C.kousa, R.multiflora, T.nucifera, M.basjoo and S.glabra were extracted with EtOH 30%, 70%; Butylene Glycol(BG 30%, 70%; Propylene Glycol(PG 30%, 70%; Distilled Water(D.W. Cell viability was measured using the Micro culture tetrazolium (MTT assay method and Human fibroblast cells, CCD 1102 KERTr were used. The plant extracts with the maximum concentration that none toxic to the cells were evaluated for anti-inflammatory activity. Anti-inflammatory activity was evaluated using lipoxygenase inhibition assay method. A dose response curve was plotted to determine the IC50 values. Results showed that, at the 5 kinds of single plant extracts by 70% EtOH extraction solvent, it showed the IC50 was 280ug/ml of S1, 370ug/ml of S2, 380ug/ml of S3, 170ug/ml of S4 and 190ug/ml of S5. At the mix plant extracts by 7 kinds of extraction solvents (70%, 30% EtOH; 70%, 30% BG; 70%, 30% PG; D.W, it showed the IC50 was 140ug/ml of M E70, 140ug/ml of M E30, 120ug/ml of M BG70, 110ug/ml of M BG30, 120ug/ml of M PG70, 136ug/ml of M PG30 and 120ug/ml of M D.W. From the results, it is concluded that when these five plants mixed before extraction, it will extract more active ingredients with anti-inflammatory effects. Further study we will analyzing plants effective single compound using high performance liquid chromatography (HPLC profiling and progressing the experiments in vivo.

  16. Lipase production by Penicillium restrictum using solid waste of industrial babassu oil production as substrate.

    Science.gov (United States)

    Palma, M B; Pinto, A L; Gombert, A K; Seitz, K H; Kivatinitz, S C; Castilho, L R; Freire, D M

    2000-01-01

    Lipase, protease, and amylase production by Penicillium restrictum in solid-state fermentation was investigated. The basal medium was an industrial waste of babassu oil (Orbignya oleifera) production. It was enriched with peptone, olive oil, and Tween-80. The supplementation positively influenced both enzyme production and fungal growth. Media enriched with Tween-80 provided the highest protease activity (8.6 U/g), whereas those enriched with peptone and olive oil led to the highest lipase (27.8 U/g) and amylase (31.8 U/g) activities, respectively.

  17. Does reduced movement restrictions and use of assistive devices affect rehabilitation outcome after total hip replacement? A non-randomized, controlled study in 365 patients with six week follow up

    DEFF Research Database (Denmark)

    Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Søballe, Kjeld

    (primary outcome, HOOS), anxiety (HADS), working status and patient satisfaction were administered before THR, 3 and 6 weeks after. Findings / Results HOOS function score at the 3 measurement times were (mean ± SD); UG: 46±17 - 76±9 - 83±14 compared to RG: 43±16 – 81±14 - 83±13, (difference between groups...... over time, p=0.004). For return to work 6 weeks post THR, UG compared to RG: 53% versus 32% (p=0.045). No significant differences between groups in anxiety, hip dislocations and patient satisfaction. Conclusions No clinically relevant difference between UG and RG on patient evaluated function was found...

  18. Digital Archiving: Where the Past Lives Again

    Science.gov (United States)

    Paxson, K. B.

    2012-06-01

    The process of digital archiving for variable star data by manual entry with an Excel spreadsheet is described. Excel-based tools including a Step Magnitude Calculator and a Julian Date Calculator for variable star observations where magnitudes and Julian dates have not been reduced are presented. Variable star data in the literature and the AAVSO International Database prior to 1911 are presented and reviewed, with recent archiving work being highlighted. Digitization using optical character recognition software conversion is also demonstrated, with editing and formatting suggestions for the OCR-converted text.

  19. Immobilization of Aspergillus niger. beta. -D-glucosidase on aminated chitin and alumina/alginate

    Energy Technology Data Exchange (ETDEWEB)

    Bon, E.; Freire, D.; Mendes, M.F.; Soares. V.F.

    1986-01-01

    The immobilization of ..beta..-glucosidase was studied by (a) covalent coupling to aminated chitin (IME-C) and (b) adsorption onto alumina followed by gel entrapment of the suspension with calcium alginate (IME-A). The levels of catalytic activity determined against salicin at 50 C were 23.0 U/g and 0.2 U/g for the IME-C and IMA-A respectively. The first system was shown to be quite stable with a loss of only 2% of the initial activity over 14 days. The IME-A system had a half life of 14 days. The activity of IME-C was studied using cellobiose and enzymatic hydrolysates of sugar cane bagasse at several cellobiose concentrations. The activities obtained with cellobiose were 104.0 U/g and 72.0 U/g respectively. 13 references.

  20. Gene : CBRC-PMAR-01-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o Petromyzon marinus cDNA 3', mRNA sequence /clone_end=3' /gb=EE272683 /gi=111169662 /ug=Pma.1613 /len=663 1e-08 26% MEVGIS...IMEVAISIMEVDISIMEVDISIMEVGISIMEVGISIMEVGISIMEVDISIMEVGISIMEVAISIMEVAISIMEVGISITEVRISIMEVGIS...IMEVGISITEVGISITEVGISIMEVGISIMEVGISITEVGISITEVGISITEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGISIMEVGIS...ITEVGISIMEVGISITEVRISIMEVGFTITASSTSSLSSLTQARLLHLFPSTLQRTTSSCLMLSSSLSAMNNPLLDENLSTPPPLIILQIRHPSIHPHGGRPLSDAFRPWAAALFLVSAIGHRPSLAVTTRPDKAQISSGAV ...

  1. no es nada it is nothing simbonile we saw himjher

    African Journals Online (AJOL)

    Universal Grammar (UG) to applied linguistics and language teaching. In particular I am ... input in which subjects are sometimes physically present and .... in complex sentences than simple sentences, and I have found .... Present tense perf.

  2. Gene : CBRC-DRER-07-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available C572172), mRNA /cds=p(17,10813) /gb=XM_695856 /gi=125855624 /ug=Dr.88794 /len=10813 0.0 37% TTTTASVTTTTEHTSTTEPSTTTTVPVTTTTEHTST...TEQSTTTTVPVTTTTEHTSTTELSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTTEHTSTTELSTTTTAPVTTTTEHTST...TELSTTTTAPVTTTTTEHTSTTEPSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPPTTTTGPVTTTTTEHTST...TEQSTTTTTPVTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEQSTTTTAPVTTTEHTSTTEPPTTTTKPITTTTEHTSTTEPSTTTTVPVTTTTEHTSTTEPSTTTTASVTTTTEHTST...TELSTTTTAPETTTTEHTSTTEPSTTTTAPVTTTTEHTSTTEPSTTTTAPVTTTQHTSTTEQSTTTTAPVTTTTEHTST

  3. Methanol Extract of Codonopsis pilosula Inhibits Inducible Nitric ...

    African Journals Online (AJOL)

    HP

    Department of Pharmacology and Toxicology, School of Dentistry, Kyung Hee University, .... triton X-100, 0.5 % NP-40, 1 ug/ml leupetin, and .... oxidative stress like smoking, ultraviolet rays, ... thereby disturbing the normal protein structure.

  4. Personnel and Vehicle Data Collection at Aberdeen Proving Ground (APG) and its Distribution for Research

    Science.gov (United States)

    2015-10-01

    28 Magnetometer Applied Physics Model 1540-digital 3-axis fluxgate 5 Amplifiers Alligator Technologies USBPGF-S1 programmable instrumentation...Acoustic, Seismic, magnetic, footstep, vehicle, magnetometer , geophone, unattended ground sensor (UGS) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION

  5. Effects of visibility and types of the ground surface on the muscle activities of the vastus medialis oblique and vastus lateralis

    Science.gov (United States)

    Park, Jeong-ki; Lee, Dong-yeop; Kim, Jin-Seop; Hong, Ji-Heon; You, Jae-Ho; Park, In-mo

    2015-01-01

    [Purpose] The purpose of this study was to compare the effects of visibility and types of ground surface (stable and unstable) during the performance of squats on the muscle activities of the vastus medialis oblique (VMO) and vastus lateralis (VL). [Subjects and Methods] The subjects were 25 healthy adults in their 20s. They performed squats under four conditions: stable ground surface (SGS) with vision-allowed; unstable ground surface (UGS) with vision-allowed; SGS with vision-blocked; and UGS with vision-blocked. The different conditions were performed on different days. Surface electromyogram (EMG) values were recorded. [Results] The most significant difference in the activity of the VMO and VL was observed when the subjects performed squats on the UGS, with their vision blocked. [Conclusion] For the selective activation of the VMO, performing squats on an UGS was effective, and it was more effective when subjects’ vision was blocked. PMID:26356407

  6. Gene : CBRC-PMAR-01-0569 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available romyzon marinus cDNA, mRNA sequence /gb=CO548425 /gi=51796737 /ug=Pma.8609 /len=962 3e-06 21% MCCIGIADTLALLLHWHCCCIGIAATLA...LLLHWHCCYIGIVATLALLLRWHCCCIGIVDTLALLLHWHCCFIGIVAALALLLHWHCCCIGIVAALALLLHWHCCYIGIVATLA...LLLHWHCCYIRIAATLALLLHWHCCCIGIAAALALLLHWHCCCIGIVDTLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLA...LLLHWHCCYIGIAATLALLLHWHCCCIGIAATLTLLLHCHSCTVRAPAVADTLGLRPSPNLYKEFTFRG ...

  7. Persistence of 14C maneb in lettuce plants an soil

    International Nuclear Information System (INIS)

    Bennaceur, M.; Sennaoui, Z.; Meguenni, H.

    1992-10-01

    Maneb residue is studied on lettuce plant and soil after spraying on greenhouse with 14C maneb. The residues declined with time. After 37 days from the application, 14C maneb residues in water extracts declined to 1,5. 10-2ug/g from 5,8. 10-1ug/g of the zero day sample in lettuce plants and 4,6. 10-3ug/g from 1,73. 10-1ug/g in soil. The 14C internals residues in lettuce and soil increase respectively till 16 days and 24 days, then decrease to 88% and 4,05% after 37 days. ETU was present in lettuce plant after 8 days then decreases with time. Two metabolites were identified by TLC (EU,ETU)

  8. Gene : CBRC-RNOR-10-0236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available lete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-73 64% MVATITQDNRVNNNSSSSNNNSSSDHNKSNNSSNSSNSNNSSNSNNSS...NSNNSSNSSNSNNSSNSSNSSNSSNNSNSNNSSNSSNSSNSSNSNNNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSS...NINNSSNSNNSNSNNSSNSNNSSNSNNSSNSNNSNSNNSNSNNSSNSNNSSNINNSSNSNNSNSNNSSNINNSSNSNNSNSNNSSNSNNSSNSNNSNSNNSSNINNSS...NSNNSNSNNSSNSNNSSNSNNSSNSSNSSNSSNNSNSNNSSKATTAVTATTAATATTAVTATTATATTAAKQQQQGWQCSSLVPGNRRQRQADPLS ...

  9. Gene : CBRC-RNOR-07-0266 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 5 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 4e-65 64% MNGKKIIKLRAEINRNNNNNSSSSNSNNSSSSSNNNNSSSNSNNNSS...SNSNNNSSSSNSNNNSNNNSNSSNNSSSNNNSSSSNSNNSSNSNNSNNNSNSSNNNSNNSSSNSNNSNNNSS...SNSNNSNNNSNSNNSNSSNNNSNNNNSSSNSNNNNNNNSSNNNSSNNNNNSNNIKTTAATTTTATTTTAANAIIETKSWFLEKISKIDKPLFNIKVERKLNQINQPRKERRGV ...

  10. Gene : CBRC-PMAR-01-0249 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available nt subunit NF-180 mRNA, complete cds /cds=p(122,3454) /gb=U19361 /gi=632548 /ug=Pma.4811 /len=3763 8e-43 41% MRSSNSSSSRSSSNNSSSNSSNSS...RSSSNNSSSSNNSSRSSSNSSSSNRSSSNRSSSSSNSNSSSSSSSNRSRSSSNRSSSNRSSSNSSNSSNSSSSSNSS...SNSNSSNSRSNSSNSSNSRNSNSSSNSSSNSSNSNRRNSSNSSNSRSNNSSNSSNSSSNSSNSNSSSNSSSNSSNSNSSSNSSRSNNSSSSNSSNRSSNSSNNSSNSSSNSS...NSSNSSSNNSSNSSSSNSSNNNSSNSSNNNSSNSSNSSNNSNSSSNNNSNSSRSNSGFWLSHRTKSVAVTKPRGAFGLRFRGRLERCSLPT ...

  11. Gene : CBRC-RNOR-01-0770 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available pothetical protein LOC685755 (LOC685755), mRNA /gb=XR_006286 /gi=109471595 /ug=Rn.197700 /len=1496 6e-64 70% MFKPQYNYNNNSS...SSNNYNSNNNNSNSSSNNNSNSSSSNNNSNSSNNNSNSNNSNNSNNNSNSSSNNNSNSSNSNSSSNNNSNSSNNYNSNNNSSSSNSS...SNNSNNNNNNSNNNNSNNNSSNSSNSSSNNNSNSSNNNSSNNNSNSNSSNSNSNSSNSNSSSNNSNNNNSNSSNNNNNSSSNNSNNNNSSSNNNNSNSSNNNNNSS...SNNSNNNNNSNNNSNSSNSNSSSNNNNSNSSSNNSNNNNNSNSNSSNSNNNNSNNSNSNSSNNNSNNNNNSNSSNNNSNSNNSNSSNSSSNNSNSSSNNSNNNNNSNNSNSNSS...NSNNNNNSNNSNSNSSNSNSSNNNSNNNNSNSSNSNNNNSNSSNSNSNNSNSNSSNSNSNNSNNSSNSSSSNNNSNSNSS

  12. Gene : CBRC-RNOR-08-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available complete cds /cds=p(41,1927) /gb=AY325173 /gi=33086523 /ug=Rn.6897 /len=1933 1e-76 65% MDDRSQKMNSYNNSSSNNNNNSSKNSNNSNSSSNNNSSNNNSNNSS...NNNSNSNNSKNSSSNNSSNSSNNSNSNNSNNSNSNNSSNNNSSNNNSNSNNSNNSSSNNSSNSNNNSSSNNSNNSNSNNSS...NSSSNNSSNSNNSSSSNNSSNSNNNSSSNNSNSNNSSNNSSNSNNSSSSNNSNSNSNNSNNSSNNSNNSSSNNSNNSNSNNSNSSSRNSNNSSNNSSNSNNSS...SSNNSNSSSSNSNNSSNSNNSKRLSLFRLTKLEIEENYLTYACGGSGVHDGSYIPSEDVCLGIPGDLKGVIVTLSDDGHLQCSYLGTD

  13. Gene : CBRC-CINT-01-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available v425e13 /clone_end=3' /gb=BW467001 /gi=48602865 /ug=Cin.16926 /len=835 3e-11 23% TNTNNRTTHNNKITTHNNSS...TNTNNSSTNTTNSSTVTYNSTTLNNKNTTHNNSSTNTNNSSTVTHNGTTLNNKNTKHNNSFTNTNNSFTNTNISSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSSTNTNNSSTITNNSFTNTNNSSTNTNNSS...TNTNNSVTNTNNSFTNTNDSTTHNNKITTHNNSSTNTNNSFTNTNISSTNTNNSSTNTNNSSTNTNNSSTINNNSSTITNNSS...TNTNNSSTITNNSSTVTYNSSTNTNNSTTPNDNAINNNNYIKPMFMKSYAHACITIPTTRLVYFVYNFTITVVFKLLFITLFIF ...

  14. Gene : CBRC-MMUS-19-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein (Dspp), mRNA /cds=p(77,2914) /gb=NM_010080 /gi=111120321 /ug=Mm.319832 /len=4431 3e-34 34% MDSRLCLNNRSNSSSSNNSRNNSS...SSSSSRNSRNNNNSNINNINTNSSRNNSSSRNNSNNSSWNSSNNSSSNNSSSNNSNTSKNNNSSNINYSNNSSSRSNSNNSS...SRNNSNNNNNKSSNHSSNNNSNNSSSSNSSNKSSSSNNNNNNSNNHSSNSNSNSSSSRINSNNNISNNNINNNSSSNNNSSNHSSNNNSNSSSSNNNSSSNNSHNSSSNNNNNQKQNQKQPKKSR ...

  15. BIOACTIVITIES AND MECHANISM OF SPIRO ENOL ETHER ANALOGUES AGAINST PIERIS RAPAE

    Institute of Scientific and Technical Information of China (English)

    Zhi-xiangZhang; Dong-meiCheng; Han-hongXu; Yu-linWu; andJun-faFan

    2004-01-01

    Nineteen kinds of spiro enol ether analogues were screened with larvae of Pieris rapae for antifeedant activity. The results showed that the antifeedant activity of compounds No.20 and No.12 was higher than others. In non-choice test, AFC50 values within 24 h of compounds No.20 and No.12 against 3rd instar larvae of P. rapae were 226.93ug/mL and 370.00ug/mL, and that in choice test against 4th larvae were 280.54 ug/mL and 398.88 ug/mL, respectively. Compd. No.20 could prolong the eggs hatch time and reduce the haemolymph content and the protein content in haemolymph of 4th instar larvae obviously. Compd. No.20 could protect tested leaves and control larvae of P. rapae effectively.

  16. 2512-IJBCS-Article-Okot Okumu

    African Journals Online (AJOL)

    hp

    heterophyllus and Moringa oleifera for treatment of community drinking water, Uganda ... *Auteur correspondant, E-mail: jokotokumu@caes.mak.ac.ug, jokotokumu@yahoo.com, ..... low, medium and high turbidity water by Jack fruit seed ...

  17. properties of extrudates from sorghum varieties abstract résumé

    African Journals Online (AJOL)

    ACSS

    Corresponding author: ybbyaru@yahoo.com, ybbyaruhanga@caes.mak.ac.ug. ABSTRACT. Extrusion cooking is a modern high-temperature short-time (HTST) processing technology, which is ... moisture contents and viscosities are treated,.

  18. banana juice as an alternative energy source for banana in vitro

    African Journals Online (AJOL)

    ACSS

    2015-02-23

    Feb 23, 2015 ... Corresponding author: sbmukasa@caes.mak.ac.ug, sbmukasa@yahoo.com ... However, the cost of tissue culture grade energy sources is high, thus making tissue ..... Treatment (banana juice from different Cvs at 50 ml l-1).

  19. Underground gas storage Lobodice geological model development based on 3D seismic interpretation

    International Nuclear Information System (INIS)

    Kopal, L.

    2015-01-01

    Aquifer type underground gas storage (UGS) Lobodice was developed in the Central Moravian part of Carpathian foredeep in Czech Republic 50 years ago. In order to improve knowledge about UGS geological structure 3D seismic survey was performed in 2009. Reservoir is rather shallow (400 - 500 m below surface) it is located in complicated locality so limitations for field acquisition phase were abundant. This article describes process work flow from 3D seismic field data acquisition to geological model creation. The outcomes of this work flow define geometry of UGS reservoir, its tectonics, structure spill point, cap rock and sealing features of the structure. Improving of geological knowledge about the reservoir enables less risky new well localization for UGS withdrawal rate increasing. (authors)

  20. Disease: H01588 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available estlessness or agitation. Headaches often recur at the same time each day during the cluster period, which c...ug) ... AUTHORS ... VanderPluym J ... TITLE ... Cluster Headache: Special Considerations for Treatment of Female P

  1. An Advanced VHF/UHF Short Range, Groundwave Propagation Model for Paths With Near-Earth Antennas

    National Research Council Canada - National Science Library

    Cross, Marshall W; Fung, Tat Y

    2006-01-01

    ... the earth such as: Unattended Ground Sensors (UGS) and Intelligent Munitions Systems (IMS), are attenuated above free space values by the lossy earth itself and any obstructions between a transmitter and receiver pair...

  2. Gene : CBRC-CINT-01-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available :cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 0.027 32% MISCLLLNSPVCLMTICILLNLQVRLMMS...SVLLNSPVCLMMSCRLLNSPVRLMMSCLLNSPVRLMISCLLLNSPVRLMMSCILLNSPVRLMMSSVLLNSAVCLMMSCRLLNSPVRLMMS...CRLLNSPVRLMMSSVLLNSPVCLMMSCRLLNSPVRFIMSCLLPNSPVCLMTICILLNSQVRLMISSLLNSPVCLMMSSALLNSPVRLMMSSRLLNSPVRLMMSCRLLNSPVRLMMSCVLLNSPVRLMMSCLLLNSPVCLMMSCSF ...

  3. Gene : CBRC-CINT-01-0076 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ntestinalis cDNA, clone:cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 5e-04 29% MMSCLLLNLPVRLMMS...CLLLNSPVCLMMSCRLLNSPVRLMISCLLLNSPVCLMMSCLLLNSPVRLMMSCLLLNSPVRLMMSCLLLNSPVCLMMS...CLLLNSPVRLMMSCLLLNSPVRLMISCLLLNSPVRLMISCLLLNPPVRLMMSCVLLNLPVRLMMICILSNSPVCLVISCLLLNSPVRLMISCLLLNSPVCLMMS...CVLPNSPVRLMMSCLLLNSPVRLMMSCLLLNLPVRLMMSCLLLNSPVCLMMSCLILNSPVRLMICCLLLNSPVCLMTICILLNSTVRLMICCLLLNPPVRLMISCLLNPPVRLMMSCVLLNSPVRLMTSRFRLELMYVRCLTIFKKFLL ...

  4. Publications | Page 62 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 611 - 620 of 6389 ... IDRC works with developing-country researchers and institutions to ... sp. strain UCD-UG_FMILLET was isolated from the roots of the Afro-. ... and men that perpetuate gender and inequality and power imbalances.

  5. Gene : CBRC-XTRO-01-3152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available Neu108f03 /clone_end=3' /gb=BX693382 /gi=38342502 /ti=474115996 /ug=Str.40529 /len=838 3e-17 39% MPLAFAPS...PLAFAPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPSPLAFPPSPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLAFAPS...PLAFVPSLLAFPPSPHAFAPLPLAFAPSPLAFAPSPLAFAPSPLAFPPSPLPLLLCSLPFLLGPLPLLLCPFPLLLHPLSLLLCPLPLLLGPLPLLFCPFPWLLRPLPLLLCPLPLLLRPLSLLLCPFPLLLRPLPLLLRPLPLLLDPGHYTKRWALDVNTAITRP ...

  6. Gene : CBRC-DRER-26-0137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cDNA clone 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 4e-71 84% MECAARSGDEKELQNSKAGVVAR...VLISCVVARVLISCVVAQVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLISCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVARVLVSCVVAR...VLNSGVVARVLNSGVVARVLNSGVVARVLNSGVVARVLISGVVARVLISCVVARVLNSCVVARVLIXXXXXXXXXXXXXXXXXXX

  7. Gene : CBRC-DRER-08-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 3e-61 79% MECAARRGDEKELENPKAGVVAARVLNSGVVAR...VLISCVVVRVLISCVVAARVLNSGVVARVLISCVVVRVLISCVVAARVLNSSVVARVLISCVVARVLISCVVAARVLNSSVVAR...VLISCVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVAARVLNSSVVARVLISCVVAARVLNSGVVARVLISCVVARVLISCVVARVVISCVVAR...VLKSGVVARVLISCVVARVLNSGVVARVLISGVVARVLISCVVARVLISCVVARVLISCVVARTE ...

  8. Gene : CBRC-DRER-26-0260 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3384097, mRNA sequence /clone=3384097 /gb=EB959993 /gi=102920926 /ug=Dr.79541 /len=690 2e-68 82% MECAARSGDEKELENSKAGVVATRVLNSGVVAR...VLISCVVARVLNSGVVARVLISCVVARALISCVVARVLNSSVVARVLINSVVARVLISCVVARVLNSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARFLISCVVARVLNSGVVSTLFRLMQT ...

  9. The concentration of cadmium in hepatoma among Filipinos

    International Nuclear Information System (INIS)

    Alejandrino, A.L.; Goze, C.B.; Paradero, R.R.

    1977-08-01

    The concentration of cadmium in liver hepatoma and in normal liver in Filipinos was determined by atomic absorption spectrophotometry. Using NBS Bovine Liver (SRM1577) as reference material, a value of 0.28+-0.025 ug/g dry weight was obtained for cadmium which is close to the certified NBS value of 0.27+-0.04 ug/g. The mean percentage recovery for cadmium determination by AAS was 98.38%. A mean value of 2.14+-1.58 ug Cd/g liver hepatoma was observed for the 12 cases investigated, showing decreased cadmium levels in the cancerous liver compared to the mean value of 12.62 ug Cd/g observed for normal liver obtained from 10 cases of accidental deaths. The values are expressed on a dry weight basis

  10. Aryl hydrocarbon receptors in urogenital sinus mesenchyme mediate the inhibition of prostatic epithelial bud formation by 2,3,7,8-tetrachlorodibenzo-p-dioxin

    International Nuclear Information System (INIS)

    Ko, Kinarm; Moore, Robert W.; Peterson, Richard E.

    2004-01-01

    In utero exposure of male C57BL/6 mice to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) prevents prostatic epithelial buds from forming in the ventral region of the urogenital sinus (UGS) and reduces the number of buds that form in the dorsolateral region. This inhibition of budding is aryl hydrocarbon receptor (AHR) dependent and appears to be the primary cause of lobe-specific prostate abnormalities in TCDD-exposed mice. TCDD can inhibit prostatic epithelial bud formation by acting directly on the UGS in vitro, but whether it does so via AHR in UGS mesenchyme, epithelium, or both was unknown. To address this issue, UGS mesenchyme and epithelium from gestation day (GD) 15 wild-type C57BL/6J male mice were isolated, recombined, and cultured in vitro for 5 days with 10 -8 M 5α-dihydrotestosterone (DHT) and either 10 -9 M TCDD or vehicle. Prostatic epithelial buds were viewed by light microscopy after removal of mesenchyme. Effects depended greatly on which portions of the mesenchyme were used: TCDD had little if any effect when whole UGS epithelium (UGE) was recombined with ventral plus dorsolateral mesenchyme, tended to reduce bud numbers in recombinants made with UGE and dorsolateral mesenchyme, and severely reduced bud numbers in recombinants made with UGE and ventral mesenchyme (VM). [VM + UGE] recombinants prepared from wild-type and AHR knockout (Ahr -/- ) mice were then cultured with DHT to determine the site of action of TCDD. AHR null mutation alone had no effect on budding. TCDD severely inhibited prostatic epithelial bud formation in recombinants that contained mesenchymal AHR, whereas bud formation was not inhibited by TCDD in recombinants lacking mesenchymal AHR, regardless of epithelial AHR status. These results demonstrate that UGS mesenchyme and not UGS epithelium is the site of action of TCDD. Therefore, the initial events responsible for abnormal UGS (and ultimately prostate) development occur within the UGS mesenchyme, and changes in gene expression

  11. Heavy Metal Contents of Municipal and Rural Dumpsite Soils and Rate of Accumulation by Carica papaya and Talinum triangulare in Uyo, Nigeria

    Directory of Open Access Journals (Sweden)

    G. A. Ebong

    2008-01-01

    Full Text Available Dumpsites in Uyo and most cities in Nigeria are used nutrients rich soils for cultivating fruits and vegetables without regards to the risk of toxic metal pollution by the wastes. This development necessitated the research on the assessment of the impact of municipal and rural dumpsites on the metal levels of the underlying soils, the relationship between the dumpsite- soil metal content and the rate of bio-accumulation by plants, the effect of plant specie and plant part on the rate of metal uptake. Atomic absorption spectrophotometer was employed for the analysis of the samples and results obtained from municipal dumpsite soil indicated the following mean concentrations: Fe, 1711.20 μg/g; Pb, 43.28 ug/g; Zn, 88.34 ug/g; Ni, 12.18 ug/g; Cd, 14.10 ug/g and Cu, 56.33 ug/g. These concentrations were relatively higher than the following concentrations: Fe, 1016.98 ug/g; Pb, 18.57 ug/g; Zn, 57.90 ug/g; Ni, 7.98 ug/g; Cd, 9.25 ug/g and Cu, 33.70 ug/g recorded for the rural dumpsite soil. Consequently, plants grown on municipal dumpsites soil accumulated higher concentrations of the metals than those on rural dumpsites. Results obtained from this study also revealed that plants grown on dumpsite soils bio-accumulated higher metal concentrations than their counterparts obtained from normal agricultural soils. The ability of plants to bioaccumulate these metals were also observed as being different from one plant to the other and from one plant parts to the other. And apart from Fe and Zn which recorded higher concentrations in the leaves of the plants studied, other metals recorded higher concentrations in the roots. The general results obtained revealed that the levels of Cd in dumpsite-soil were above the standard while the levels of Cd and Pb in plants were also above the recommended levels in plants. The implications of these high concentrations of these metals in soil and plants have been discussed. Some useful recommendations on the proper

  12. Planar algebra of the subgroup-subfactor

    Indian Academy of Sciences (India)

    We think of R α G as the II1-factor (R ∪{ug: g ∈ G}) ⊂ L(L2(R)), where ug(ˆx) ..... define a global trace on P, where for 0± the trace for P0± ∼= C is the obvious identity .... function for strings is either a local maximum or a local minimum. ..... In order to understand how the inclusion tangles act on the subgroup-subfactor planar.

  13. Asian Dust Observed During the KORUS Air Quality Mission Creates Significant Super-Micron NO3-, NH4+, and SO42- Aerosols.

    Science.gov (United States)

    Heim, E. W.; Dibb, J. E.; Scheuer, E. M.

    2017-12-01

    The KORUS mission was a collaborative effort between the Korean Institute of Environmental Research and NASA. KORUS provided a comprehensive assessment of air quality in Korea during early 2016. The intensive sampling campaign was timed to assess local photochemistry during increasing solar insolation and biogenic emissions; after the April peak in outflow of pollution and dust from central China. Chinese outflow is well characterized by Silica-Calcium rich dust. Despite the effort to avoid the period with strongest dust outflow, Ca2+ was well represented in all bulk (particle diameters up to 4.5 micron) aerosol filter samples filter measurements and submicron measurements of NH4+, SO42, and NO3- made by AMS indicates substantial super-micron fractions of these anthropogenic ions at times during KORUS-AQ. During the dustiest samples (Ca2+ > 1.5ug/m3) we see marked increases in super-micron concentration of NH4+, SO42-, and NO3-, m = 1.113 ug/m3 , 2.621 ug/m3 , 4.413 ug/m3, with the super-micron contribution to total concentration averaging 47%, 45%, and 81% respectively. In contrast, low dust days (Ca2+ < 0.2ug/m3) the super-micron concentrations averaged 0.262 ug/m3, 0.510 ug/m3, -0.029 ug/m3, respectively and accounted for just 20%, 14%, and 8% of total mass. During the dust events, samples that have trajectories passing over industrial centers in eastern China approached equivalence balance between Ca2++ NH4+ and SO42-+NO3-. In contrast dusty samples that did not pass over these industrial centers during transport to the West Sea and Korea maintained excess cations, dominantly Ca2+. This suggests that dust can act as an important carrier of Chinese pollution to Korea when this saturated dust reaches the peninsula.

  14. On star-critical and upper size Ramsey numbers

    NARCIS (Netherlands)

    Zhang, Yanbo; Broersma, Haitze J.; Chen, Yaojun

    2016-01-01

    In this paper, we study the upper size Ramsey number u(G1,G2)u(G1,G2), defined by Erdős and Faudree, as well as the star-critical Ramsey number r∗(G1,G2)r∗(G1,G2), defined by Hook and Isaak. We define Ramsey-full graphs and size Ramsey good graphs, and perform a detailed study on these graphs. We

  15. Effect of gamma-irradiation on the natural occurence of Fusarium mycotoxins in wheat, flour and bread

    International Nuclear Information System (INIS)

    Aziz, N.H.; Attia, E.-S.A.; Farag, S.A.

    1997-01-01

    A survey was carried out to obtain data on the occurence of Fusarium mycotoxin in wheat and flour samples collected from local markets in Egypt and to study the influence of gamma-irradiation on controlling the occurrence of thesemycotoxins in wheat, flour and bread. Deoxynivalenol (DON) was detected in five samples of wheat at levels ranging from 103 to 287 ug/kg and one sample each of flour and bread concentrations 188 and 170 ug/kg. Zearaleone (ZEN) was detected in ten samples of wheat at levels from 28 to 42 ug/kg and four samples each of flour and bread at concentrations of 95 and 34 ug/kg, respectively. T-2 toxin was detected only in one sample each of wheat, flour and bread at concentrations of 2.9, 2.2, and 2.3 ug/kg, respectively. Gamma-irradiation at dose level of 6 kGy completely eliminated fungal flora in flour and wheat. DON, ZEN and T-2 toxin concentrations are reduced to 85, 20 and 2.0 ug/kg for wheat and to 125, 45, and 1.0 ug/kg for flour after 4 kGy exposure and a sharp drop in Fusarium toxin levels occured at 6 kGy and was eliminated at 8 kGy. Bread prepared from 6 kGy was contaminate4d with Fusarium toxin at levels below 5 ug/kg. It was noticed that gamme-irradiation reduce greatly the natural occurrence of Fusarium mycotoxins in bread

  16. Unigene BLAST: CBRC-DRER-15-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0112 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-49 71% ...

  17. Unigene BLAST: CBRC-DRER-15-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0109 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-51 71% ...

  18. Unigene BLAST: CBRC-DRER-15-0107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0107 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-59 84% ...

  19. Unigene BLAST: CBRC-DRER-15-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0115 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-41 67% ...

  20. Unigene BLAST: CBRC-DRER-15-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0111 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-48 73% ...

  1. Unigene BLAST: CBRC-DRER-15-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0105 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 9e-35 69% ...

  2. Unigene BLAST: CBRC-DRER-15-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0102 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-30 54% ...

  3. Unigene BLAST: CBRC-DRER-15-0103 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0103 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 6e-32 56% ...

  4. Unigene BLAST: CBRC-DRER-15-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0101 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-47 77% ...

  5. Unigene BLAST: CBRC-DRER-15-0113 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0113 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 73% ...

  6. Unigene BLAST: CBRC-DRER-15-0114 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0114 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-38 62% ...

  7. Unigene BLAST: CBRC-DRER-15-0108 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0108 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-53 74% ...

  8. Unigene BLAST: CBRC-DRER-15-0100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0100 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-52 75% ...

  9. Unigene BLAST: CBRC-DRER-15-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0106 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 75% ...

  10. Unigene BLAST: CBRC-DRER-15-0110 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0110 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-71 99% ...

  11. Unigene BLAST: CBRC-DRER-15-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0104 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 5e-58 79% ...

  12. Uropygial gland volatiles may code for olfactory information about sex, individual, and species in Bengalese finches Lonchura striata

    Directory of Open Access Journals (Sweden)

    Jian-Xu ZHANG et al.

    2009-10-01

    Full Text Available Over-shadowed by eye-catching vocal and visual signals, chemical communication has long been overlooked in birds. This study aimed at exploring whether volatile composition of the uropygial gland secretion (UGS of birds was associated with the information about sex, individual and species. By using dichloromethane extraction and gas chromatography-mass spectrometry (GC-MS, we analyzed the UGS volatiles of domesticated Bengalese finches (Lonchura striata, Estrildiea which is also known as white-rumped munias. We characterized 16 volatile molecules from the UGS, including eight n-alkanols, five diesters, an ester, an aldehyde and a fatty acid, and quantified them in terms of GC peak area percentages (relative abundances. Among these compounds, hexadecanol and octadecanol were major components in both sexes. The former was richer in males than females and the latter richer in females than males, suggesting that they might be male and female pheromone candidates, respectively. The high inter-individual variations, in relative abundance, of the UGS volatiles implied that they might carry information about individuality. The similarity between GC profiles of the UGS and wing feather from same individuals indicates that the birds might preen the secretion to their feathers to transmit chemical cues. Additionally, by comparing with three sympatric passerine species,i.e., zebra finches Taeniopygia guttata, yellow-bowed buntings Emberiza chrysophrys and rooks Corvus frugilegus, we found that the composition of C13-C18 alkanols in the UGS might contain information about species. Our study also show that quantitative differences (degree of same UGS volatiles might be the key for the Bengalese finch to code for information about sex and individuality whereas both the kind and degree of UGS constituents could be utilized to code for information about species [Current Zoology 55 (5:–2009].

  13. Wastewater/Storm Water Characterization and Toxicity Identification Evaluation, Sheppard Air Force Base, Texas

    Science.gov (United States)

    1991-12-01

    support the NPDES permit renewal appl ication. the studies should collect sufficient data to characterize waste streams, including wastewater and WINTP...26Apr 1 30Apr I 1May I 2May Arsenic I uiI ᝺ ᝺i ᝺  ᝺! ᝺ Barium I ug l I i  . 4001 SWot 1000 " 2600 Beryllium J ug 1 ᝺ <o 0 <o

  14. Environmental and occupational exposures to mercury among indigenous people in Dunkwa-On-Offin, a small scale gold mining area in the South-West of Ghana.

    Science.gov (United States)

    Kwaansa-Ansah, E E; Basu, N; Nriagu, J O

    2010-11-01

    Total mercury concentrations in human hair and urine samples were determined to ascertain the extent of environmental and occupational mercury exposure in Dunkwa-On-Offin, a small scale gold mining area of the central-west region of Ghana. In all ninety-four (94) hair and urine samples comprising of forty (40) small scale miners and fifty-four (54) farmers were collected and analyzed for their total mercury levels using the cold vapour atomic absorption spectrometry. The hair total mercury concentrations ranged from 0.63 to 7.19 ug/g with a mean of 2.35 ± 1.58 ug/g for the farmers and 0.57-6.07 ug/g with a mean of 2.14 ± 1.53 ug/g for the small scale gold miners. There was no significant correlation between the total mercury concentration and the average weekly fish diet. The total mercury concentrations in urine of the miners were higher than those of the farmers and ranged from 0.32 to 3.62 ug/L with a mean of 1.23 ± 0.86 ug/L. The urine concentrations of farmers ranged from 0.075 to 2.31 ug/L with a mean of 0.69 ± 0.39 ug/L. Although the results indicate elevated internal dose of mercury the current levels of exposures do not appear to pose a significant health threat to the people.

  15. Establishment of Uropygial Gland Growth Curves for White, Three-Way Crossed Mule Ducklings

    Directory of Open Access Journals (Sweden)

    YH Chen

    2015-06-01

    Full Text Available Growth curves for the uropygial gland (UG of white, 3-way crossed mule ducklings were established using the Gompertz function. In total, 144 ducklings were fed in 12 floor pens with 12 birds in each pen. Each pen contained an equal number of animals of each sex. Feed and water were supplied ad libitumthroughout the entire experimental period. The weekly change in UG weight was recorded in males and females from hatch to 8 weeks of age. The weight and length of the UG, the width of the lobus glandulae uropygialis, the length and width of the pluma of the circulus uropygialis, and the index of the papilla uropygialis were measured once a week in individual ducklings in one pen. The average UG weight gain observed in white, 3-way crossed drakes was significantly higher than that of ducks of 21-56 days of age (P< 0.05. The UG length was 1.64-2.23 times the width of the left or right lobe, and the development of the UG was delayed from 3-4 weeks of age. The morphology of the UG changed from elliptical to elongated-elliptical with age. The right and left lobus glandulae uropygialis were symmetrical. The Gompertz growth functions of the UG in drakes and ducks were W=5.49e-e-0.675(t-1.955 and W=4.76e-e-0.685(t-1.936, respectively, where t represents age in weeks. These equations indicated that the maximum growth rate for drakes occurred at 14.1 days of age and for ducks at 13.6 days of age.

  16. Unattended Ground Sensors for Expeditionary Force 21 Intelligence Collections

    Science.gov (United States)

    2015-06-01

    little impact on modern intelligence collections. This thesis analyzes and compares the units and individual Marine skillsets that employ UGS, and the...the sensor employment planning cycle, and the socialization of this plan through the proper chain-of-command [4]. Figure 8 depicts the Sensor...the use of newly developed cellphone based technologies and emerging UGS capabilities to assist in Listening Post/ Observation Post (LP/OP

  17. Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

  18. Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...

  19. Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...

  20. Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...

  1. Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...

  2. Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...

  3. Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...

  4. Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...

  5. Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...

  6. Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...

  7. Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...

  8. Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...

  9. Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...

  10. Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...

  11. Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...

  12. Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...

  13. Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...

  14. Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...

  15. Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...

  16. Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

  17. Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...

  18. Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...

  19. Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...

  20. Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...

  1. Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...

  2. Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...

  3. Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...

  4. Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...

  5. Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...

  6. Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...

  7. Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...

  8. Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...

  9. Enhanced technologies for unattended ground sensor systems

    Science.gov (United States)

    Hartup, David C.

    2010-04-01

    Progress in several technical areas is being leveraged to advantage in Unattended Ground Sensor (UGS) systems. This paper discusses advanced technologies that are appropriate for use in UGS systems. While some technologies provide evolutionary improvements, other technologies result in revolutionary performance advancements for UGS systems. Some specific technologies discussed include wireless cameras and viewers, commercial PDA-based system programmers and monitors, new materials and techniques for packaging improvements, low power cueing sensor radios, advanced long-haul terrestrial and SATCOM radios, and networked communications. Other technologies covered include advanced target detection algorithms, high pixel count cameras for license plate and facial recognition, small cameras that provide large stand-off distances, video transmissions of target activity instead of still images, sensor fusion algorithms, and control center hardware. The impact of each technology on the overall UGS system architecture is discussed, along with the advantages provided to UGS system users. Areas of analysis include required camera parameters as a function of stand-off distance for license plate and facial recognition applications, power consumption for wireless cameras and viewers, sensor fusion communication requirements, and requirements to practically implement video transmission through UGS systems. Examples of devices that have already been fielded using technology from several of these areas are given.

  10. Azobenzene dye-coupled quadruply hydrogen-bonding modules as colorimetric indicators for supramolecular interactions

    Directory of Open Access Journals (Sweden)

    Yagang Zhang

    2012-04-01

    Full Text Available The facile coupling of azobenzene dyes to the quadruply hydrogen-bonding modules 2,7-diamido-1,8-naphthyridine (DAN and 7-deazaguanine urea (DeUG is described. The coupling of azobenzene dye 2 to mono-amido DAN units 4, 7, and 9 was effected by classic 4-(dimethylaminopyridine (DMAP-catalyzed peptide synthesis with N-(3-dimethylaminopropyl-N’-ethyl carbodiimide hydrochloride (EDC as activating agent, affording the respective amide products 5, 8, and 10 in 60–71% yield. The amide linkage was formed through either the aliphatic or aromatic ester group of 2, allowing both the flexibility and absorption maximum to be tuned. Azobenzene dye 1 was coupled to the DeUG unit 11 by Steglich esterification to afford the product amide 12 in 35% yield. Alternatively, azobenzene dye 16 underwent a room-temperature copper-catalyzed azide–alkyne Huisgen cycloaddition with DeUG alkyne 17 to give triazole 18 in 71% yield. Azobenzene coupled DAN modules 5, 8, and 10 are bright orange–red in color, and azobenzene coupled DeUG modules 12 and 18 are orange–yellow in color. Azobenzene coupled DAN and DeUG modules were successfully used as colorimetric indicators for specific DAN–DeUG and DAN–UPy (2-ureido-4(1H-pyrimidone quadruply hydrogen-bonding interactions.

  11. List of Participants

    Science.gov (United States)

    2011-08-01

    Abigail Alvarez OlarteCINVESTAV Alba Leticia Carrillo MonteverdeDCI-UG Alberto CarramiñanaINAOE Aldo MorselliFERMI Alejandro CastillaDCI-UG Alejandro IbarraTechnical University of Munich Alma D Rojas PachecoFCFM-BUAP Alma Xochitl Gonzalez MoralesInstituto de Ciencias Nucleares, UNAM Andrew Walcott BeckwithAmerican Institute of Beam Energy Physics Ariadna Montiel ArenasDepartamento de Física, CINVESTAV Arnulfo ZepedaCinvestav Arturo Alvarez CruzInstituto de Fisica, UNAM Axel de la MacorraUNAM, IAC Azar MustafayevUniversity of Minnesota Benjamin JaramilloDCI-UG Vincent BertinCPPM-Marseille Carlos Alberto Vaquera-AraujoDCI-UG Carlos MuñozMadrid Autonoma U. & Madrid, IFT Carmine PagliaroneINFN, FNAL Carolina Lujan PeschardDCI-UG Christiane Frigerio MartinsUniversidade Federal do ABC-São Paulo Csaba BalazsMonash University David DelepineDCI-UG David G CerdenoUniversidad Autonoma de Madrid & Instituto de Fisica Teorica Debasish MajumdarSaha Institute of Nuclear Physics, Kolkata, India Dibyendu PanigrahiKandi Raj College, Kandi, Murshidabad, INDIA-742137 Dupret Alberto Santana BejaranoUniversidad de Sonora Departamento de Investigacion en Fisica Ernest MaRiverside U.C. Esteban Alejandro Reyes Pírez MontañezInstituto de Física, UNAM Federico Ortiz TrejoINSTITUTO DE ASTRONOMÍA - UNAM Francisco José de Anda NavarroUniversidad de Guadalajara González Alvarez Francisco JavierCINVESTAV-Depto. Física Gustavo Medina TancoICN-UNAM Hernando Efrain Caicedo OrtizInstituto Politecnico Nacional - IPN J D VergadosCERN & Ioannina U. James R BoyceJefferson Lab Jason SteffenFERMILAB Javier Montaño DomínguezDCI-UG Jeevan SolankiMandsaur Institue of Technology MP India Joe SatoSaitama University Jorge Luis Navarro EstradaUNAM-ICN and Universidad del Atlantico (B/quilla-Col.) Jose A R CembranosUniversity of Minnesota José DíazIFIC Jose Didino Garcia AguilarDepto. de Fisica. Cinvestav Keith OliveUniversity of Minnesota Konstantia BalasiUniversity of Ioannina, Greece Lilian Prado

  12. Viking Quest - an Epic Tale of Loot and Legend

    Directory of Open Access Journals (Sweden)

    Richard Osgood

    2002-10-01

    Full Text Available Sounding rather more akin to a promotional release for the Tony Curtis/Kirk Douglas film The Vikings, Viking Quest is another BBC undertaking. From Julian Richards' latest offering, The Blood of the Vikings, this game centres on putting together a crew to undertake a raid on the monastery at Lindisfarne.

  13. Instilling a Culture of Accountability at the Department of Homeland Security (DHS): Leveraging the Government Performance and Results Modernization Act (GPRA-MA) of 2010

    Science.gov (United States)

    2013-09-01

    Estrella et al., Learning from Change: Issues and Experiences in Participatory Monitoring and Evaluation (Ottawa, ON, CAN: IDRC Books, 2000); John Denton...afford:60 59 Estrella et al., Learning from Change: Issues and Experiences in...Administrator’s Companion: A Practical Guide. CQ Press, 2010. Estrella , Marisol, with Jutta Blauert, Dindo Campilan, John Gaventa, Julian Gonsalves

  14. Knaves, Knights or Networks: Which Assumption of Lecturer and Manager Motivation Should Underlie Further Education Policy?

    Science.gov (United States)

    Boocock, Andrew

    2015-01-01

    Julian Le Grand, a well-known economist, identifies two types of public sector employee: knights (with altruistic motives) and knaves (with self-interested motives). He argues that the quasi-market, predicated on the assumption of knavish behaviour (or agent self-interest), is the most effective way of directing school managers and teachers…

  15. Ecology Art Education On-Line: A World Community of Old Trees, A Story of the Research

    Science.gov (United States)

    Julian, June

    1997-01-01

    "A World Community of Old Trees," http://www.nyu.edu/projects/julian/, is the Internet research component of the doctoral dissertation, "Ecology Art Education On-Line: A World Community of Old Trees." It is the first study in the discipline of Art Education to use the World Wide Web to transmit and receive data for doctoral…

  16. Veneetsia biennaal - Tintoretto põhiekspositsioonis, Schnabel satelliitnäitusel? / Jaan Elken

    Index Scriptorium Estoniae

    Elken, Jaan, 1954-

    2011-01-01

    Venezia Correri muuseumis 27. nov.-ni avatud Julian Schnabeli retrospektiivist "Pidev muutumine ja nägemise arhitektuur" ("Permanently becoming and the Architecture of Seeing"). Lühidalt Tintoretto maalidega algavast Bice Curigeri kuraatoriprojektist "ILLUMInatsioonid", paviljonidest (Itaalia, Saksamaa, Suurbritannia, Eesti jt.)

  17. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Astronomical Observatory & Theoretical Astrophysics Center, Juliane Maries Vej 30, 2100 Copenhagen ɸ, Denmark; The Royal Swedish Academy of Sciences, Stockholm Observatory, SE-13336 Saltsjöbaden, Sweden; Dept. of Physics and Astronomy, Michigan State University, East Lansing, MI 48824, ...

  18. Learning from Change: Issues and Experiences in Participatory ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Learning from Change: Issues and Experiences in Participatory Monitoring and Evaluation. Book cover Learning from Change: Issues and Experiences in Participatory Monitoring and Evaluation. Directeur(s) : Marisol Estrella, Jutta Blauert, Dindo Campilan, John Gaventa, Julian Gonsalves, Irene Guijt, Deb Johnson, and ...

  19. New Physical Constraints for Multi-Frame Blind Deconvolution

    Science.gov (United States)

    2014-12-10

    Laboratory) Dr. Julian Christou (Large Binocular Telescope Observatory) REAL ACADEMIA DE CIENCIAS Y ARTES DE BARCELONA RAMBLA DE LOS ESTUDIOS 115... CIENCIAS Y ARTES DE BARCELONA RAMBLA DE LOS ESTUDIOS 115 BARCELONA, 08002 SPAIN 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING

  20. 75 FR 66344 - Amendment of Jet Route J-93; CA

    Science.gov (United States)

    2010-10-28

    ...-1022; Airspace Docket No. 10-AWP-4] RIN 2120-AA66 Amendment of Jet Route J-93; CA AGENCY: Federal... proposes to amend Jet Route J-93 in California between the Julian VHF Omnidirectional Radio Range Tactical... is necessary to realign Jet Route J-93 with the revised location of the Penasco VOR. The Proposal The...

  1. Rituaalid Ando Keskküla moodi

    Index Scriptorium Estoniae

    2000-01-01

    Tallinna Kunstihoones näitus "Rituaalide mehaanika", millega Ando Keskküla tähistab oma 50. sünnipäeva. Näituse külalised Marko Laimre, Zoe Beloff, Bea de Visser, Fiddian Warman ja Julian Saunderson.

  2. Mittepateetiline juubel Kunstihoones / Heie Treier

    Index Scriptorium Estoniae

    Treier, Heie, 1963-

    2000-01-01

    Kunstnik-kuraatori Ando Keskküla "Rituaalide mehaanika" Tallinna Kunstihoones. Marko Laimre installatsioonist "Sugar Free", Bea de Visseri tööst "Silmapilgutus", Fiddian Warmani ja Julian Saundersoni installatsioonist "Paheline loomus", Ando Keskküla videost "Hingus", installatsioonist "12 tooli".

  3. Antinociceptive Properties and Acute Toxicity of Ethanol Extract of ...

    African Journals Online (AJOL)

    Sarah RG de Lima-Saraiva1, Henrique CC Saraiva2, Juliane C Silva2, Leonardo ... 56.304-205, Petrolina, Pernambuco, 3Universidade Estadual de Feira de ..... Santos VNC, Freitas RA, Deschamps FC, Biavatti, MW. ... Queiroz AC, Lira DP, Dias TL, Souza ET, Matta CB, ... Alexandre-Moreira MS, Piuvezam MR, Araújo CC,.

  4. Embodied Spirituality

    Science.gov (United States)

    Trousdale, Ann

    2013-01-01

    This article explores the concept of embodied spirituality from early Celtic traditions through the British medieval mystic Julian of Norwich to the present day. A "high theology" of the body in early Christianity and early Christian understandings of the relation among body, soul and spirit gave way to the influences of Greek thought with its…

  5. Qualitative in-depth interviews: Studying religious meaning-making in MMOs

    NARCIS (Netherlands)

    S.D. Aupers (Stef); J.C.F. Schaap (Julian); L. de Wildt (Lars)

    2018-01-01

    markdownabstractIn this chapter, Stef Aupers, Julian Schaap, and Lars de Wildt argue that a “game-centered” orientation in the study of religion and video games (studying in-game religious narratives, discourses, and game rules) should be complemented with a “player-centered” perspective. They call

  6. Komedija "Dzhuno" stala triumfatorom nezavissimogo "Oskara"

    Index Scriptorium Estoniae

    2008-01-01

    Santa Monicas USAs anti 23. veebruaril üle sõltumatu kino aastaauhinnad Spirit Awards. Parimaks filmiks tunnistati Jason Reitmani "Juno", parim stsenaarium oli samale filmile Diablo Cody sulest, parim naisnäitleja Ellen Page samast filmist, parim režissöör filmi "Skafander ja liblikas" looja Julian Schnabel

  7. Staariderikas rokisuvi jõuab kinno

    Index Scriptorium Estoniae

    2008-01-01

    7.-11. juulini Tallinnas kinos Sõprus toimuvast muusikafilmide nädalast "Rock on Screen". Programmis on Julian Schnabeli dokumentaalfilm "Lou Reed's Berlin" Lou Reedi kontserdist, draama "Control" Joy Divisoni liidrist Ian Curtisest, dokfilm "The Future Is Unwritten" punkbändist The Clash, mängufilm "Hurriganes"soome rockansamblist ja muusikafilm "Shlaager" Eesti 80ndate popmuusikute osavõtul

  8. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Anshu Aggarwal. Articles written in Journal of Biosciences. Volume 27 Issue 4 July 2002 pp 339-346 Articles. Place prioritization for biodiversity content · Sahotra Sarkar Anshu Aggarwal Justin Garson Chris R Margules Juliane Zeidler · More Details Abstract Fulltext PDF.

  9. Testing the Canon: Student Responses to Texts by Medieval Women in English Literature Surveys.

    Science.gov (United States)

    Hawkins, Ann R.

    While there has been a great deal of debate about enlarging the canon, less attention has been paid to how students respond to "new" literary figures such as Margery Kempe and Julian of Norwich, or to how instructors should incorporate them into an already cramped literature survey course. Instructors must consider some questions that…

  10. Diplomatic asylum and the Assange case

    NARCIS (Netherlands)

    den Heijer, M.

    2013-01-01

    This article traces the place and development of diplomatic asylum in international law in close connection with the more specific questions raised by the case of Julian Assange, who was granted asylum in the Ecuador embassy in London on 16 August 2012. After discussing the historical rise and

  11. Toil and Trouble: On the Materiality of Time

    Directory of Open Access Journals (Sweden)

    Ross Chambers

    2014-03-01

    Full Text Available This article explores the nature of temporality, entropy and negentropy, drawing contemporary fiction by Graham Swift and Fiona McGregor as well as the autobiography of Wikileaks founder Julian Assange, to ask questions about history, time and life.

  12. A not-so-new eugenics. Harris and Savulescu on human enhancement.

    Science.gov (United States)

    Sparrow, Robert

    2011-01-01

    John Harris and Julian Savulescu, leading figures in the "new' eugenics, argue that parents are morally obligated to use genetic and other technologies to enhance their children. But the argument they give leads to conclusions even more radical than they acknowledge. Ultimately, the world it would lead to is not all that different from that championed by eugenicists one hundred years ago.

  13. Veneetsia Kuldlõvi iraanlasele

    Index Scriptorium Estoniae

    2000-01-01

    Kuldlõvi sai Jafar Panahi mängufilm "Ring" ("Dayereh"), žürii suure preemia USA režissööri Julian Schnabeli "Enne kui öö saabub" ("Before Night Falls"), parima meesnäitleja preemia Javier Bardem

  14. Veneetsia filmifestival lõppes Iraani võiduga / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2000-01-01

    Kuldlõvi sai Jafar Panahi mängufilm "Ring" ("Dayereh"), žürii suure preemia USA režissööri Julian Schnabeli "Enne kui öö saabub" ("Before Night Falls"), parima stsenaariumi preemia itaallase Marco Tullio Giordana "Sada sammu" ("I cento passi")

  15. Veneetsias lööb laineid kuuba kirjaniku eluloofilm / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2000-01-01

    57. Veneetsia filmifestivalil tõusis üheks favoriidiks Julian Schnabeli mängufilm "Enne õhtu saabumist" ("Before Night Falls") : Ameerika Ühendriigid 2000. Riho Undi nukufilmi "Samueli Internet" näidati edukalt ühes alaprogrammis, mis läheb edasi Milanosse ja Rooma

  16. First results of Indian - Current meter moorings along The equator: Vertical current structure variability at equator, 93 degrees E during February-December, 2000

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Suryanarayana, A.; Sarma, M.S.S.; Tilvi, V.; Fernando, V.; Nampoothiri, G.; Sardar, A.; Gracias, D.; Khalap, S.

    forcing while the 30-50 day ISO with Madden-Julian Oscillations. The energy spectrum at 280 m shows relatively higher energy than that at 135 m at 10-20 day ISO; while cross-spectra of kinetic energy at these depths reveal high coherence and upward phase...

  17. Impact of Convection on Surface Fluxes Observed During LASP/DYNAMO 2011

    Science.gov (United States)

    2014-12-01

    20  Figure 8.  FFM maneuver used in the LASP/DYNAMO experiment (from Wang et al. 2013...Atmosphere Response Experiment DYNAMO Dynamics of Madden-Julian Oscillation EM electro-magnetic EO electro-optical FFM flight-level flux mapping FVS...level flux mapping ( FFM ) modules. Convection modules consisted of dropsonde cloud survey or radar convective element maneuver. Dropsonde modules

  18. Highlight: IDRC sponsors Caribbean symposium on impact of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-04-15

    Apr 15, 2016 ... Among the attendees were the Honourable Julian Robinson, Jamaica's Minister of State for the Ministry of Science, Technology, Energy and Mining and Celia Champagnie, Trade Commissioner ... IDRC project: Harnessing Open Data to Achieve Development Results in Latin America and the Caribbean ...

  19. Eventos de Agosto (August Events).

    Science.gov (United States)

    Toro, Leonor; Pla, Myrna

    Written in Spanish, this booklet contains brief information on seven August events celebrated by Puerto Ricans: Herbert Hoover's birthdate (August 10); Acta del Seguro Social (Social Security Act, August 14); Julian E. Blanco (August 14), Enmienda 19 Sufragia de la Mujer (Amendment 19, Women's Suffrage, August 26); Benjamin Harrison (August 20);…

  20. Love troubles : human attachment and biomedical enhancements

    NARCIS (Netherlands)

    Nyholm, S.

    ABSTRACT In fascinating recent work, Julian Savulescu and his various co-authors argue that human love is one of the things we can improve upon using biomedical enhancements. Is that so? This article first notes that Savulescu and his co-authors mainly treat love as a means to various other goods.

  1. Naftahinna olulist langust lähiajal loota ei maksa / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    Analüütikute hinnangul kujuneb tänavu nafta keskmiseks hinnaks 83,87 krooni barrelilt. Energiaanalüütik Julian Lee on seisukohal, et keskpikas perspektiivis peaks naftapuhastustehaste mahu kasv sundima naftahinna langema, Deutsche Banki tooraineanalüüsi juhi Michael Lewise arvates ei saa praegu suuremat hinnalangust tulla. Lisa: OPEC viivitab toodangukärpega. Diagramm

  2. Halb nali. Oma viga? / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2007-01-01

    Näitus "Halb nali" Tallinna Kunstihoones kuni 6. I 2008. Kuraator Johannes Saar, kunstnikud: Tamy Ben-Tor, Nathalie Djurberg, Peter Finnemore, Paul Granjon, Ivars Gravlejs, Igor Grubic, Zlatko Kopljar, Tsui Kuang-Yu, Marko Mäetamm, Jüri Ojaver, Julian Rosefeldt, Tommi Toija

  3. "Informacja chce by? wolna". Strategie kontroli i taktyki uwalniania informacji w epoce cyfrowej

    OpenAIRE

    Banaszak, Ada

    2016-01-01

    W niniejszej pracy przygl?dam si? wybranym strategiom kontroli informacji w epoce cyfrowej oraz taktykom jej uwalniania ? dzia?aniom haker?w i haktywist?w, takich jak Richard Stallman, za?o?yciel ruchu wolnego oprogramowania, Julian Assange, cypherpunk i redaktor naczelny WikiLeaks, czy Anonymous. Aleksander Kmak

  4. Pattulangemine ja lunastus / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2005-01-01

    PÖFFi filme - "Taevane lahing" ("Batalla en el cielo" : režissöör Carlos Reygadas : Mehhiko - Prantsusmaa - Saksamaa - Belgia 2005, "Valede kammitsas" ("Separate Lies") : Nigel Balchini rom. "A Way Through the Wood" järgi režissöör Julian Fellowes : Suurbritannia 2005

  5. Phytochemical screening, cytotoxicity and acute toxicity of Annona ...

    African Journals Online (AJOL)

    Phytochemical screening, cytotoxicity and acute toxicity of Annona vepretorum Mart (Annonaceae) leaf extracts. Mariana G e Silva, Ana P de Oliveira, Camila de S Araújo, Érica M de Lavor, Juliane C Silva, Rosemairy L Mendes, Cláudia do Ó Pessoa, Marcília P Costa, Jackson R G da S Almeida ...

  6. Management process invaded Ames as the Center shifted from NACA to NASA oversight. Ames constructed

    Science.gov (United States)

    1968-01-01

    Management process invaded Ames as the Center shifted from NACA to NASA oversight. Ames constructed a review room in its headquarters building where, in the graphical style that prevailed in the 1960's, Ames leadership could review progress against schedule, budget and performance measures. Shown, in October 1965 is Merrill Mead chief of Ames' program and resources office. (for H Julian Allen Retirement album)

  7. Cinematic Emotion in Horror Films and Thrillers. The Aesthetic Paradox of Pleasurable Fear (paperback edition)

    NARCIS (Netherlands)

    Hanich, Julian

    2012-01-01

    Why can fear be pleasurable? Why do we sometimes enjoy an emotion we otherwise desperately wish to avoid? And why are the movies the predominant place for this paradoxical experience? These are the central questions of Julian Hanich’s path-breaking book, in which he takes a detailed look at the

  8. Constraints on the Grueneisen Theory

    Science.gov (United States)

    2007-02-01

    TOMSK 634024 RUSSIA 5 DEPARTMENTO DE QUIMICA FISICA I FACULTAD DE CIENCIAS QUIMICAS UNIVERSIDAD COMPLUTENSE DE MADRID V G BAONZA...OVIEDO FACULTAD DE QUIMICA DEPARTMENTO DE QUIMICA FISICA Y ANALITICA E FRANCISCO AVENIDA JULIAN CLAVERIA S/N 33006 - OVIEDO

  9. A Note on the Application of the Extended Bernoulli Equation

    Science.gov (United States)

    1999-02-01

    SANTANDER SPAIN DEPARTMENTO DE QUIMICA FISICA FACULTAD DE CIENCIAS QUIMICAS UNIVERSIDAD COMPLUTENSE DE MADRID V G BAONZA M TARAVTLLO M CACERAS...UNIVERSIDAD DE OVIEDO FACULTAD DE QUIMICA DEPARTMENTO DE QUIMICA FISICA Y ANALITICA E FRANCISCO AVENIDA JULIAN CLAVERIA S/N 33006 - OVIEDO SPAIN

  10. The Effects of Speech and Language Therapy Intervention on Children with Pragmatic Language Impairments in Mainstream School

    Science.gov (United States)

    Adams, Catherine; Lloyd, Julian

    2007-01-01

    In this article, Catherine Adams, clinical senior lecturer in speech and language therapy at the University of Manchester, and Julian Lloyd, senior lecturer in psychology at Newman College, Birmingham, describe the implementation and effects of an intensive programme of speech and language therapy for children who have pragmatic language…

  11. The Talent Search Model of Gifted Identification

    Science.gov (United States)

    Assouline, Susan G.; Lupkowski-Shoplik, Ann

    2012-01-01

    The Talent Search model, founded at Johns Hopkins University by Dr. Julian C. Stanley, is fundamentally an above-level testing program. This simplistic description belies the enduring impact that the Talent Search model has had on the lives of hundreds of thousands of gifted students as well as their parents and teachers. In this article, we…

  12. The Growth of the Chinese People’s Liberation Army Navy: Impacts and Implications of Regional Naval Expansion

    Science.gov (United States)

    2007-12-01

    84 Julian S. Corbett, Some Principles of Maritime Strategy (New York, NY: Longmans, Green and Co., 1911; reprint...authority 182 Ian Nish, Japanese Foreign Policy 1869-1942 (Boston, MA: Routledge & Kegan Paul, 1977...Westport, CT: Praeger Publishers, 1998), 170. 237 Michael Lindberg and Daniel Todd, Brown-, Green -, and Blue- Water Fleets: The Influence of Geography

  13. Climatology and Landfall of Tropical Cyclones in the South- West ...

    African Journals Online (AJOL)

    with a substantial increase (about 0.3˚C) in sea surface temperature. However, it is ... Julian (1994). El Niño is known to cause increased cyclone activity in the South and in the North-East. Pacific, but decreased activity in the North Atlantic.

  14. 77 FR 9657 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2012-02-17

    ..., Owner, Application Type: Add OFF Service. Cargo Tours International, Inc. dba CTI Global Logistics (NVO.... Deckwell Sky (USA) Inc. dba Monarch Container Line (NVO & OFF), 14343 E. Don Julian Road, City of Industry.... Logistics, Inc. (NVO & OFF), 3905 West Albany Street, McHenry, IL 60050, Officers: Arthur N. Nutig, Chief...

  15. Scientia Militaria: South African Journal of Military Studies - Vol 11 ...

    African Journals Online (AJOL)

    Warning and Response by Julian Critch. ley. Leo Cooper, 1978. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Calvin Smit, VC Muller, 60-60. http://dx.doi.org/10.5787/11-2-660 ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Vol 11, No 2 (1981), Warning and Response by Julian Critch. ley. Leo Cooper, 1978. Abstract PDF. Calvin Smit, VC Muller. Vol 25, No 2 (1995), Wartime Christmases in five countries in World War II, Abstract PDF. H Rose-Innes. Vol 8, No 1 (1978), Weer en klimaat as omgewingsfaktore in die militêre situasie, Abstract PDF.

  17. CARCINOGENIC EFFECTS OF LOW DOSES OF IONIZING RADIATION

    Science.gov (United States)

    Carcinogenic Effects of Low Doses of Ionizing RadiationR Julian Preston, Environmental Carcinogenesis Division, NHEERL, U.S. Environmental Protection Agency, Research Triangle Park, NC 27711The form of the dose-response curve for radiation-induced cancers, particu...

  18. Kae kunstnikku! / Harry Liivrand, Margit Tõnson

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2007-01-01

    Filmiajaloo kümme parimat filmi kunstnikest: Vincente Minnelli "Elujanu", Peter Webber "Tütarlaps pärlkõrvarõngaga", Andrei Tarkovski "Andrei Rubljov", Julie Taymor "Frida", James Ivory "Picasso: looja ja hävitaja", Ed Harris "Pollock", Julian Schnabel "Basquiat", Konrad Wolf "Goya ehk tunnetuse salakaval tee", Raoul Ruiz "Klimt", Oliver Hirschbiegel "Allakäik"

  19. Voorus-porno / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2009-01-01

    Stephenie Meyeri "Videviku" romaanide sari (Videvik, Noorkuu, Päikesevarjutus, Koidukuma) ja kahe esimese loo ekraniseeringud on fenomenaalselt populaarsed. PÖFFi filmikoolis arutleti teemat kirjandusagent Julian Friedmani juhtimisel. Lisaks kirjastuse Pegasus toimetaja Rene Tendermanni, kirjanik-kirjandusteoreetik Peeter Helme jt. arvamusi

  20. Estimating C-17 Aircrew Seasoning Given a Prediction of Flying Austerity

    Science.gov (United States)

    2014-06-01

    mission classification, operating organization, operating squadron, actual departure time (in Zulu ), actual arrival time (in Zulu ), and flight time in...zero. The horizontal axis is the time axis and is in Julian day units starting with January 1, 2013 and terminates at 2359 Zulu on June 30th 2013

  1. Strategic Improvements to TSA Spot Program

    Science.gov (United States)

    2015-03-01

    supporting me in this program, and specifically, Assistant Administrators Robin Kane, John Sanders, and Chris McLaughlin for their sponsorship. I hope...analysis. Edited by Michael Borenstein, Larry V. Hedges, Julian P. T. Higgins , and Hannah R. Rothstein, 377–387. Chichester, UK: John Wiley & Sons, 2009

  2. ANTIBACTERIAL PROPERTIES OF PHARMACEUTICAL COMPOSITION OF HEPATOPROTECTORS

    Directory of Open Access Journals (Sweden)

    Aslanian MA

    2016-12-01

    Full Text Available Pathology problemof hepatobiliary system (HBS of contagious origin becomes relevant with the increase of disturbance and complications of lipid metabolism and bile pigments among young people. Leading role in prophylaxis and treatment in the context of this pathology belongs to antibacterialc hemotherapeutic agents. However, along with antimicrobial activity, numerous side effects can be observed during treatment with antibacterial agents. According to the recent study on hepatobiliary system (HBS, therapeutic effect can be seen only while using herbal medicine with choleretic action as well as their various compositions.Amountof medicine with the appropriate effect is insufficient, that is why the study was conducted towards finding effective combinations of plant substances of different groups for the purpose of creatingan effective medicine for treatment of hepatobiliary system (HBS of contagious origin. Aim of the work The purpose of study was to examine antibacterial properties of different combinations with flamin and lavender oil in combined medicine during the course of treatment of cholecystitis and cholangitis. Materials and methods. It the result of study 61 microbial strains were distinguished and identified from the pathological material taken from 53 patients with cholecystitis and cholangitis. All distinguished clinical microbial strains taken from the patients were tested for sensitivity to combined medicine in the form of tablets with flamin and lavender oil. Minimal inhibitory concentration for S. aureus АТСС 25923 amounted to 250-350 ug/ml, for E. coli АТСС 25922 - 350±50,0 ug/ml, for P. aeruginosa АТСС 27853 750±100,0 ug/ml, for Р. vulgaris АТСС 4636 - 850±100,0 ug/ml, minimal inhibitory concentration to the tablets № 2 та № 3 amounted to > 1000 мкг/мл. Minimal inhibitory concentration for B. subtilis АТСС 6633 amounted to 250±50,0 ug/ml, for C. albicans ATCC 885/653 300±50,0 ug

  3. Use of a simplified spectrophotometric method for quantitative determination of glucose-6-phosphate dehydrogenase activity in normal children from two day-care centers of the city of São Paulo

    Directory of Open Access Journals (Sweden)

    Roberto Muller

    2003-06-01

    Full Text Available Objective: To evaluate the applicability of a simplified method forquantitative determination of glucose-6-phosphate dehydrogenaseactivity in normal children; to determine the mean, standarddeviation and threshold value under which the enzyme activity isconsidered deficient. Methods: Blood samples were collected from201 children from two day-care centers in the city of São Paulo.The subjects were considered normal based on physicalexamination and laboratory tests. The enzyme activity wasdetermined in red blood cells of normal children using the “TestCombination G-6-PDH®” kit. The following statistical analyses werecarried out: the results were submitted to Student’s t test,Kolmogorov-Smirnov test, lower confidence interval (one-tailedtest and Spearman’s correlation coefficient. Results: The meanhemoglobin value for girls was slightly higher than the mean valuefor boys, but this difference was not statistically significant. Therewas no statistical difference in mean enzyme activities for Caucasianand non-Caucasian children. There was no significant correlation amongenzyme activity levels, red blood cells, hemoglobin levels,hematocrit, reticulocytes, white blood cells and age of patients.The mean enzyme activity for boys was 4.448 U/g Hb, standarddeviation = 1.380 U/g Hb. For girls, the mean enzyme activity was4.531 U/g Hb, standard deviation = 1.386 U/g Hb, and the differencewas not statistically significant. Therefore, the two populationgroups were considered as one single population, presenting amean enzyme activity of 4.490 U/g Hb, standard deviation = 1.380 U/g Hb.Since the distribution curve of enzyme activity values was normal,a lower confidence interval was determined (one-tailed test, witha cutoff point of 2.227 U/g Hb. Conclusion: The method used bySolem proved to be simple, fast, very accurate and useful to detectglucose-6-phosphate dehydrogenase activity and to identifychildren with enzyme deficiency.

  4. Enhancement Nisin Activity By Some Natural Additives

    International Nuclear Information System (INIS)

    Hussien, H.A.; El-Fouly, M.E.; Zayed, M.N.; Harroun, M.B.

    2010-01-01

    Nisin showed great inhibition of gram positive bacteria while it had no effect on gram negative bacteria or yeast.It is clear from the present study that 250ug/ml of nisin was lethal for S .aureus but this dose decreased to 25 ug/ml when combined with 0.05% of citric acid or 0.1% of lactic acid or 0.4% of cinnamon. Although nisin had no effect on P. aeruginosa but when 200ug/ml of nisin combined with 0.2% of citric acid or 0.1% of lactic acid or 2% of cinnamon P. aeruginosa completely inhibited.In the same manner 200ug/ml of nisin was sufficient to inhibit Debaryomyces sp. growth when combined by 3% of citric or 3.5% of lactic or 2% of cinnamon. On the other hand, 25 μg/ml of nisin reduced the following lethal concentrations of S .aureus from0.2% to 0.05%, 0.15% to 0.1% and from 1.2% to 0.4% for citric acid, lactic acid and cinnamon, respectively. While. 200 ug/ml of nisin decreased the following lethal concentrations of P. aeruginosa from 0.3% to 0.2%, 0.3% to 0.1% and from 4% to 2% for citric acid, lactic acid and cinnamon, respectively. Two hundred ug/ml of nisin decreased lethal concentrations of Debaryomyces sp. from4% to 3%, 4.5% to 3.5% for citric acid and lactic acid, respectively. Two hundred ug/ml of nisin did not reduce cinnamon lethal dose.

  5. Ultrasonic destruction of albumin microbubbles enhances gene transfection and expression in cardiac myocytes.

    Science.gov (United States)

    Wang, Guo-zhong; Liu, Jing-hua; Lü, Shu-zheng; Lü, Yun; Guo, Cheng-jun; Zhao, Dong-hui; Fang, Dong-ping; He, Dong-fang; Zhou, Yuan; Ge, Chang-jiang

    2011-05-01

    It has been proven that ultrasonic destruction of microbubbles can enhance gene transfection efficiency into the noncardiac cells, but there are few reports about cardiac myocytes. Moreover, the exact mechanisms are not yet clear; whether the characteristic of microbubbles can affect the gene transfection efficiency or not is still controversial. This study was designed to investigate whether the ultrasound destruction of gene-loaded microbubbles could enhance the plasmids carried reporter gene transfection in primary cultured myocardial cell, and evaluate the effects of microbubbles characteristics on the transgene expression in cardiac myocytes. The β-galactosidase plasmids attached to the two types of microbubbles, air-contained sonicated dextrose albumin (ASDA) and perfluoropropane-exposed sonicated dextrose albumin (PESDA) were prepared. The gene transfection into cardiac myocytes was performed in vitro by naked plasmids, ultrasound exposure, ultrasonic destruction of gene-loaded microbubbles and calcium phosphate precipitation, and then the gene expression and cell viability were analyzed. The ultrasonic destruction of gene-loaded microbubbles enhanced gene expression in cardiac myocytes compared with naked plasmid transfection ((51.95 ± 2.41) U/g or (29.28 ± 3.65) U/g vs. (0.84 ± 0.21) U/g, P ASDA ((51.95 ± 2.41) U/g vs. (29.28 ± 3.65) U/g, P < 0.05). Ultrasonic destruction of microbubbles during calcium phosphate precipitation gene transfection enhanced β-galactosidase activity nearly 8-fold compared with calcium phosphate precipitation gene transfection alone ((111.35 ± 11.21) U/g protein vs. (14.13 ± 2.58) U/g protein, P < 0.01). Even 6 hours after calcium phosphate precipitation gene transfection, ultrasound-mediated microbubbles destruction resulted in more intense gene expression ((35.63 ± 7.65) U/g vs. (14.13 ± 2.58) U/g, P < 0.05). Ultrasonic destruction of microbubbles might be a promising method for the delivery of non-viral DNA into

  6. Efecto de un extracto hidroalcohólico de Uncaria tomentosa (uña de gato sobre la población de células dendríticas y sus moléculas hla-dr y cd86 ante el estímulo con lipopolisacáridos

    Directory of Open Access Journals (Sweden)

    Iván Lozada-Requena

    2009-04-01

    Full Text Available Objetivo. Determinar el efecto de un extracto hidroalcohólico de uña de gato, Uncaria tomentosa (UG sobre células dendríticas (DC de sangre periférica y la expresión de HLA-DR y CD86 en muestras de sangre periférica de individuos sanos tratadas con lipopolisacáridos (LPS. Materiales y métodos. El polvo de la corteza de UG se preparó como una decocción estéril a 30g/L por 30 minutos. Se obtuvo muestras de sangre periférica de individuos sanos. Las células mononucleares de sangre periférica (CMSP fueron separadas por gradiente de centrifugación, pretratadas o no durante dos horas con distintas concentraciones de UG y estimuladas 24 h con LPS, luego fueron marcadas con anticuerpos monoclonales fluorescentes específicos para HLA-DR, Linaje tipo 1 (Lin1, CD11c y CD86 y preparadas para la citometría de flujo. Resultados. Comparando con el grupo de CMSP con LPS pero sin UG se observó, de manera dosis dependiente, una disminución en el porcentaje de DC mieloides (DCm (p<0,05 y una tendencia a incrementar el porcentaje de DC plasmacitoides (DCp. En las DCp se observó una disminución de la intensidad de fluorescencia media (IFM de HLA-DR sólo a 500 y 1000 μg/mL de UG (p<0,001; mientras que hubo un incremento de la IFM de CD86 en todo el rango (p<0,05. En DCm a las mismas concentraciones no se observó efecto de UG sobre la IFM de HLA-DR y CD86. Conclusiones. Este extracto estandarizado de UG tiende a incrementar el porcentaje de DCp y disminuye el porcentaje de DCm. UG no afecta la expresión de HLA-DR y CD86 en DCm. Este estudio demuestra que este extracto de UG favorece la activación/diferenciación de DCp, la cual participa en mecanismos de respuesta inmune adaptativa.

  7. Laparoscopic-assisted vaginal pull-through: A new approach for congenital adrenal hyperplasia patients with high urogenital sinus

    Directory of Open Access Journals (Sweden)

    Jacques Birraux

    2015-01-01

    Full Text Available Background: To open vaginal cavity to the pelvic floor is part of surgical treatment for urogenital sinus (UGS in girls with congenital adrenal hyperplasia (CAH. For high UGS, this operative procedure can be challenging and may jeopardise urinary continence. Combined perineal and laparoscopic approaches could be useful to minimise perineal dissection and to facilitate the vaginal lowering. Patients and Methods: We report the procedure of a laparoscopic-assisted vaginal pull-through for supra-sphincteric UGS in a 5-year-old girl with CAH. Laparoscopic dissection of the vagina from the posterior wall of the bladder and urethra, division of the confluence and vaginal pull-through to the perineum are described. Discussion: The technique is derived from laparoscopic-assisted treatment for high ano-rectal malformations. Compared with current procedures for treatment for high UGS, laparoscopic-assisted approach allows mobilising vagina with minimal dissection of perineum and complete preservation of urethra. Another major advantage is to provide a direct vision for dissection of the space between rectum and urethra prior to vaginal pull-through. Conclusion: Laparoscopic-assisted vaginal pull-through appears to be an interesting approach for high UGS in CAH patients, reducing dissection and risk of urinary incontinence. This new approach needs to be strengthened by other cases.

  8. A low-noise MEMS accelerometer for unattended ground sensor applications

    Science.gov (United States)

    Speller, Kevin E.; Yu, Duli

    2004-09-01

    A low-noise micro-machined servo accelerometer has been developed for use in Unattended Ground Sensors (UGS). Compared to conventional coil-and-magnet based velocity transducers, this Micro-Electro-Mechanical System (MEMS) accelerometer offers several key benefits for battlefield monitoring. Many UGS require a compass to determine deployment orientation with respect to magnetic North. This orientation information is critical for determining the bearing of incoming signals. Conventional sensors with sensing technology based on a permanent magnet can cause interference with a compass when used in close proximity. This problem is solved with a MEMS accelerometer which does not require any magnetic materials. Frequency information below 10 Hz is valuable for identification of signal sources. Conventional seismometers used in UGS are typically limited in frequency response from 20 to 200 Hz. The MEMS accelerometer has a flat frequency response from DC to 5 kHz. The wider spectrum of signals received improves detection, classification and monitoring on the battlefield. The DC-coupled output of the MEMS accelerometer also has the added benefit of providing tilt orientation data for the deployed UGS. Other performance parameters of the MEMS accelerometer that are important to UGS such as size, weight, shock survivability, phase response, distortion, and cross-axis rejection will be discussed. Additionally, field test data from human footsteps recorded with the MEMS accelerometer will be presented.

  9. Cooperative Behavior in the Ultimatum Game and Prisoner’s Dilemma Depends on Players’ Contributions

    Directory of Open Access Journals (Sweden)

    Amy R. Bland

    2017-06-01

    Full Text Available Economic games such as the Ultimatum Game (UG and Prisoner’s Dilemma (PD are widely used paradigms for studying fairness and cooperation. Monetary versions of these games involve two players splitting an arbitrary sum of money. In real life, however, people’s propensity to engage in cooperative behavior depends on their effort and contribution; factors that are well known to affect perceptions of fairness. We therefore sought to explore the impact of relative monetary contributions by players in the UG and PD. Adapted computerized UG and PD games, in which relative contributions from each player were manipulated, were administered to 200 participants aged 18–50 years old (50% female. We found that players’ contribution had large effects on cooperative behavior. Specifically, cooperation was greater amongst participants when their opponent had contributed more to joint earnings. This was manifested as higher acceptance rates and higher offers in the UG; and fewer defects in the PD compared to when the participant contributed more. Interestingly, equal contributions elicited the greatest sensitivity to fairness in the UG, and least frequent defection in the PD. Acceptance rates correlated positively with anxiety and sex differences were found in defection behavior. This study highlights the feasibility of computerized games to assess cooperative behavior and the importance of considering cooperation within the context of effortful contribution.

  10. [Frequency and in vitro susceptibility antiparasitic of Blastocystis hominis from patients admitted to the Hospital Regional Lambayeque, Peru].

    Science.gov (United States)

    Silva-Díaz, Heber; Flores-Esqueche, Lorena; Llatas-Cancino, Dunalia; Guevara Vásquez, Génesis; Silva-García, Teresa

    2016-01-01

    To describe the frequency and antiparasitic in vitro susceptibility of Blastocystis hominis in patients admitted to theHospital Regional Lambayeque, Peru. A cross-sectional study was conducted from January to August 2015 at 313 patients of all ages. B. hominis detection was performed on serial fecal samples by direct microscopic examination and microculture in modified Locke solution. The in vitro susceptibility testing against the drug metronidazole, nitazoxanide, trimethoprim-sulfamethoxazole and erythromycin was performed in 24 strains of B. hominis, which grew up (microculture method) in 10 double concentrations of each antimicrobial (from 256 ug/ml to 0.5 ug/mL) plus a control. 46.3% (145/313) of the sample had B. hominis, also the age between 12 to 17 years and 60 years was associated with higher frequency of parasites (OR: 2.93 and 2.62). The minimum inhibitory concentration (MIC) 90 of metronidazole and nitazoxanide was 3.19 ug/mL and 11.19 ug/ml, respectively, whereas the MIC 90 of trimethoprim-sulfamethoxazole and erythromycin were above 256 ug/mL. B. hominis occurs in high frequency in patients admitted to the Hospital Regional in Lambayeque, proving to be an important problem of public health in the region. Also B. hominis isolated from these patients were shown to be susceptible in vitro to low concentrations of metronidazole and nitazoxanide so they could be chosen for treatment of this parasite.

  11. On the relationship between emotional state and abnormal unfairness sensitivity in alcohol dependence

    Directory of Open Access Journals (Sweden)

    Damien eBrevers

    2015-07-01

    Full Text Available Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent individuals (AD and 32 controls performed an Ultimatum Game (UG, in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR. Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed are needed in order to examine whether - emotional and behavioral - reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.

  12. Uniform Gauss-Weight Quadratures for Discrete Ordinate Transport Calculations

    International Nuclear Information System (INIS)

    Carew, John F.; Hu, Kai; Zamonsky, Gabriel

    2000-01-01

    Recently, a uniform equal-weight quadrature set, UE n , and a uniform Gauss-weight quadrature set, UG n , have been derived. These quadratures have the advantage over the standard level-symmetric LQ n quadrature sets in that the weights are positive for all orders,and the transport solution may be systematically converged by increasing the order of the quadrature set. As the order of the quadrature is increased,the points approach a uniform continuous distribution on the unit sphere,and the quadrature is invariant with respect to spatial rotations. The numerical integrals converge for continuous functions as the order of the quadrature is increased.The numerical characteristics of the UE n quadrature set have been investigated previously. In this paper, numerical calculations are performed to evaluate the application of the UG n quadrature set in typical transport analyses. A series of DORT transport calculations of the >1-MeV neutron flux have been performed for a set of pressure-vessel fluence benchmark problems. These calculations employed the UG n (n = 8, 12, 16, 24, and 32) quadratures and indicate that the UG n solutions have converged to within ∼0.25%. The converged UG n solutions are found to be comparable to the UE n results and are more accurate than the level-symmetric S 16 predictions

  13. Taking it easy when playing ultimatum game with a Down syndrome proposer: Effects on behavior and medial frontal negativity.

    Science.gov (United States)

    Rêgo, Gabriel Gaudencio; Campanhã, Camila; do Egito, Julia Horta Tabosa; Boggio, Paulo Sérgio

    2017-10-01

    The ultimatum game (UG) is an endowment sharing game in which a proposer suggests a division of an asset to a recipient, who must accept or reject it. Economic studies showed that despite recipients usually rejecting unfair offers, perception and reaction to unfairness are highly dependent on who is the proposer. Event-related potentials (ERPs) commonly detected in UG games are the medial frontal negativity (MFN), a component detected in recipients facing unfair offers, and the P300, a component related to attentional and memory processes. Given this, we aimed to investigate the behavioral and ERP responses of healthy people playing the UG game with Down syndrome (DS) and typical development (TD) proposers. Nineteen subjects participated in this study. The UG behavioral data were similar to previous studies. ERP analysis showed no MFN in participants facing unfair offers. A higher P300 amplitude was detected when participants faced fair offers from TD compared to DS fair offers. We also found a positive correlation between P300 amplitude for TD offers and self-esteem scale score. Together these findings indicate that insertion of an atypical player in the UG led to changes in participants' perception and expectancy of the game.

  14. Smartphone and Universal Goniometer for Measurement of Elbow Joint Motions: A Comparative Study

    Science.gov (United States)

    Behnoush, Behnam; Tavakoli, Nasim; Bazmi, Elham; Nateghi Fard, Fariborz; Pourgharib Shahi, Mohammad Hossein; Okazi, Arash; Mokhtari, Tahmineh

    2016-01-01

    Background Universal goniometer (UG) is commonly used as a standard method to evaluate range of motion (ROM) as part of joint motions. It has some restrictions, such as involvement of both hands of the physician, leads to instability of hands and error. Nowadays smartphones usage has been increasing due to its easy application. Objectives The study was designed to compare the smartphone inclinometer-based app and UG in evaluation of ROM of elbow. Materials and Methods The maximum ROM of elbow in position of flexion and pronation and supination of forearm were examined in 60 healthy volunteers with UG and smartphone. Data were analyzed using SPSS (ver. 16) software and appropriate statistical tests were applied, such as paired t-test, ICC and Bland Altman curves. Results The results of this study showed high reliability and validity of smartphone in regarding UG with ICC > 0.95. The highest reliability for both methods was in elbow supination and the lowest was in the elbow flexion (0.84). Conclusions Smartphones due to ease of access and usage for the physician and the patient, may be good alternatives for UG. PMID:27625754

  15. Textural properties of low-fat set-type yoghurt depending on mTG addition

    Directory of Open Access Journals (Sweden)

    Lívia Darnay

    2016-07-01

    Full Text Available Our aim was to determine how 0.5-2 U/g non-inactivated mTG affects the pH development and apparent viscosity during fermentation. Furthermore we wished to examine how the enzyme addition could change protein structure, gel strength and sensory characteristics by healthy low-fat set-type yoghurt product. Therefore commercial mTG enzyme preparation was added in different concentrations (0.5-2.0 U/g, in 0.5 U/g steps to 1.5 % bovine milk simultaneously with DVS starter culture. Our study revealed that enzyme dosage (0.5-2 U/g protein had no impact on pH development and apparent viscosity during fermentation when manufacturing low-fat (1.5 % set-type yoghurt. The addition of mTG contributed to 38 % more whey retention with incorporation of β-casein, and caused 44 % higher gel strength up to a level of 1 U/g protein.

  16. Biochemical Effects of six Ti02 and four Ce02 Nanomaterials ...

    Science.gov (United States)

    Abstract The potential mammalian hepatotoxicity of nanomaterials were explored in dose-response and structure-activity studies with human hepatic HepG2 cells exposed to between 10 and 1000 ug/ml of six different TiO2 and four CeO2 nanomaterials for 3 days. Various biochemical parameters were then evaluated to study cytotoxicity, cell growth, hepatic function and oxidative stress. Few indications of cytotoxicity were observed between 10 and 100 ug/ml. In the 300 to 1000 ug/ml exposure range a moderate to substantial degree of cytotoxicity was observed. The percent of lactic dehydrogenase released from cells was the most sensitive cytotoxicity parameter. There were four major biochemical effects observed. By far decreased activities of glucose 6-phosphate dehydrogenase was the major finding of this enzymatic study with some significant decreases observed at 10 ug/ml. In the range of 100 to 1000 ug/ml, the activities of superoxide dismutase, glutathione reductase and glutathione peroxidase were decreased by many nanomaterials. There are six factors that contribute to substantial oxidative stress in cultured hepatocytes (decreased GSH content, and reduced G6PDH, GRD, GPX, SOD and altered catalase activities). Cytotoxicity per se did not seem to fully explain the patterns of biological responses observed. With respect to structure-activity, nanomaterials of CeO2 were more effective than TiO2 in reducing glutathione reductase and SOD activ

  17. U.S. Natural Gas Storage Risk-Based Ranking Methodology and Results

    Energy Technology Data Exchange (ETDEWEB)

    Folga, Steve [Argonne National Lab. (ANL), Argonne, IL (United States); Portante, Edgar [Argonne National Lab. (ANL), Argonne, IL (United States); Shamsuddin, Shabbir [Argonne National Lab. (ANL), Argonne, IL (United States); Tompkins, Angeli [Argonne National Lab. (ANL), Argonne, IL (United States); Talaber, Leah [Argonne National Lab. (ANL), Argonne, IL (United States); McLamore, Mike [Argonne National Lab. (ANL), Argonne, IL (United States); Kavicky, Jim [Argonne National Lab. (ANL), Argonne, IL (United States); Conzelmann, Guenter [Argonne National Lab. (ANL), Argonne, IL (United States); Levin, Todd [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-10-01

    This report summarizes the methodology and models developed to assess the risk to energy delivery from the potential loss of underground gas storage (UGS) facilities located within the United States. The U.S. has a total of 418 existing storage fields, of which 390 are currently active. The models estimate the impacts of a disruption of each of the active UGS facilities on their owners/operators, including (1) local distribution companies (LDCs), (2) directly connected transporting pipelines and thus on the customers in downstream States, and (3) third-party entities and thus on contracted customers expecting the gas shipment. Impacts are measured across all natural gas customer classes. For the electric sector, impacts are quantified in terms of natural gas-fired electric generation capacity potentially affected from the loss of a UGS facility. For the purpose of calculating the overall supply risk, the overall consequence of the disruption of an UGS facility across all customer classes is expressed in terms of the number of expected equivalent residential customer outages per year, which combines the unit business interruption cost per customer class and the estimated number of affected natural gas customers with estimated probabilities of UGS disruptions. All models and analyses are based on publicly available data. The report presents a set of findings and recommendations in terms of data, further analyses, regulatory requirements and standards, and needs to improve gas/electric industry coordination for electric reliability.

  18. On the relationship between emotional state and abnormal unfairness sensitivity in alcohol dependence.

    Science.gov (United States)

    Brevers, Damien; Noël, Xavier; Hanak, Catherine; Verbanck, Paul; Kornreich, Charles

    2015-01-01

    Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent (AD) individuals and 32 controls performed an ultimatum game (UG), in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR). Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed in order to examine whether-emotional and behavioral-reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.

  19. Ultrasound-Assisted Esterification of Valeric Acid to Alkyl Valerates Promoted by Biosilicified Lipases

    Directory of Open Access Journals (Sweden)

    Soledad Cebrián-García

    2018-06-01

    Full Text Available A novel, environmentally friendly, and sustainable ultrasound-assisted methodology in the valorization of valeric acid to alkyl valerate using a biosilicified lipase from Candida antarctica is reported. This one-pot room temperature methodology of enzyme biosilicification leads to biosilicified lipases with improved activity and reaction efficiency as compared to free enzymes. Yields in the ultrasound-promoted esterification of valeric acid was ca. 90% in 2 h with 15% m/v of biosilicified lipase (Bio-lipase; 616 U/g biocatalyst enzymatic activity and a molar ratio 1:2 (valeric acid:ethanol, slightly superior to that observed by the free enzyme (75% conversion, 583U/g biocatalyst enzymatic activity. The reuse of enzymes in these conditions was tested and the results show a relatively good reusability of these biosilicified enzymes under the investigated conditions, particularly preserving fairly stable specific activities (616 vs. 430 U/g biocatalyst after four reuses.

  20. Determination of the uranium concentration in samples of raw, retorted and spent shale from Irati, Parana-Brazil, by the fission track registration technique

    International Nuclear Information System (INIS)

    Cabral, R.G.

    1981-02-01

    The feasibility of the determination of uranium in oil shale, by the fission track registration technique is studied. The wet and dry methods were employed, using a Bayer policarbonate, Makrofol KG, as detector. It was created a new variant of the dry method. The fission track registration technique was used in samples of raw, retorted and spent shale from Irati, Parana in Brazil, 16 μg U/g, 20 μg U/g and 20μg U/g were found, respectively, with a total error ranging from 19% to 20%. Some experimental results were included for illustration and comparison. The feasibility of the determination of uranium in oil shale from Irati was verified. (Author) [pt