A political-culture case from late antiquity: the emperor julian and his concept of education - doi: 10.4025/actascieduc.v32i1.9488

Directory of Open Access Journals (Sweden)

Margarida Maria de Carvalho

2010-08-01

Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} In this article, I propose to appraise Emperor Julian's conception of Paidéia or education. To this end, I will work from the meanings of the Christian Logos and the Greek Logos making use also of Gregory Nazianzen's Against Julian, verifying whether the clash that occurred between Gregory Nazianzen and Julian was not only religious but politico-religious, taking into account that at that point of the 4th century AD no separation of these spheres had yet existed. The text is divided into Preliminary Considerations, where I argue that the conflict between the two authors is political-cultural; The Emperor Julian and the Historiography about his times, in which I demonstrate that since the Emperor Julian's own time there was a myth built around him, and finally about Nazianzen's purpose of writing Against Julian. All of these interlinked points lead to the comprehension of this specific political moment of Late Antiquity.

Rachunek kosztów działańjako podstawa wyceny usług

Directory of Open Access Journals (Sweden)

Gertruda Krystyna Świderska

2009-03-01

Full Text Available Artykuł prezentuje wykorzystanie rachunku kosztów działań do wyceny usług na trzech rynkach podlegających centralnym regulacjom – rynku usług pocztowych, telekomunikacyjnych oraz świadczeń zdrowotnych. Doświadczenia krajów Unii Europejskiej (w tym Polski pokazują nowe obszary wykorzystania rachunku kosztów działań. Potwierdzają, że zastosowanie tego narzędzia pozwala na kontrolę kosztów ponoszonych przy świadczeniu usług oraz wycenę na podstawie rzeczywistego rachunku ekonomicznego. Takie podejście gwarantuje przejrzystość procesu wyceny na rynkach, na których odgrywa to szczególnie istotną rolę. W części pierwszej przedstawiono zarys koncepcji rachunku kosztów działań wykorzystanej w PPUP Poczta Polska. Scharakteryzowano zastosowane rozwiązanie dostosowane do specyfiki działań poczty, zawierające elementy obiektowego rachunku kosztów działań oraz rachunku kosztów działań sterowanego czasem. W części drugiej zaprezentowano zastosowanie koncepcji rachunku kosztów działań do wyceny świadczonych usług w British Telecom. Wykorzystanie właściwych nośników kosztów pozwala na prawidłowe przypisanie kosztów obiektom je generującym. W części trzeciej opisano doświadczenia krajów Unii Europejskiej w zakresie stosowania rachunku kosztów działań do wyceny świadczeń medycznych. Stanowią one przesłankę dla wdrożenia tej koncepcji do wyceny usług zdrowotnych na rynku polskim.

New England observed and predicted Julian day of maximum growing season stream/river temperature points

Data.gov (United States)

U.S. Environmental Protection Agency — The shapefile contains points with associated observed and predicted Julian day of maximum growing season stream/river temperatures in New England based on a spatial...

Revisiting Noah’S Ark in Julian Barnes’ A History of the World in 10 ½ Chapters

Directory of Open Access Journals (Sweden)

Muthu Liana

2014-03-01

Full Text Available Considering that intertextuality is the text’s property of being connected to other previous texts, Julian Barnes’ novel, “A History of the World in 10 ½ Chapters”, rewrites the Biblical story of Noah’s Ark. Besides the narration accounted in the Bible, new elements are encountered here: e.g. the Ark wasn’t a simple vessel, but a small fleet; Noah butchered the animals from the Ark, animals selected initially to be saved from the Deluge; the woodworms, creatures that symbolize decay, were also present on the Ark, etc. Then, new versions of the Biblical story, all having connections with Noah, the Ark and the Sea are present. Therefore, Julian Barnes fructifies Noah’s story, readjusting it to other spaces and historic times.

Development of convection along the SPCZ within a Madden-Julian oscillation

OpenAIRE

Matthews, Adrian J.; Hoskins, Brian J.; Slingo, Julia M.; Blackburn, Mike

1996-01-01

A subtropical Rossby-wave propagation mechanism is proposed to account for the poleward and eastward progression of intraseasonal convective anomalies along the South Pacific convergence zone (SPCZ) that is observed in a significant proportion of Madden–Julian oscillations (MJOs). Large-scale convection, associated with an MJO, is assumed to be already established over the Indonesian region. The latent heating associated with this convection forces an equatorial Rossby-wave response with an u...

Development of convection along the SPCZ within a Madden-Julian oscillation

OpenAIRE

Matthews, AJ; Hoskins, BJ; Slingo, JM; Blackburn, M

1996-01-01

A subtropical Rossby wave propagation mechanism is proposed to account for the poleward and eastward progression of intraseasonal convective anomalies along the South Pacific Convergence Zone (SPCZ) that is observed in a significant proportion of Madden-Julian Oscillations (MJOs). Large scale convection, associated with an MJO, is assumed to be already established over the Indonesian region. The latent heating associated with this convection forces an equatorial Rossby wave response with an u...

Julian Schwinger the physicist, the teacher, and the man

CERN Document Server

1996-01-01

In the post-quantum-mechanics era, few physicists, if any, have matched Julian Schwinger in contributions to and influence on the development of physics. A deep and provocative thinker, Schwinger left his indelible mark on all areas of theoretical physics; an eloquent lecturer and immensely successful mentor, he was gentle, intensely private, and known for being "modest about everything except his physics". This book is a collection of talks in memory of him by some of his contemporaries and his former students: A Klein, F Dyson, B DeWitt, W Kohn, D Saxon, P C Martin, K Johnson, S Deser, R Fin

Julian Lennon Is Global Ambassador for the Lupus Foundation of America | NIH MedlinePlus the Magazine

Science.gov (United States)

... research. In 2009, he and musician James Scott Cook released the song "Lucy" in honor of Vodden. Proceeds from the song benefited the LFA and the Saint Thomas' Lupus Trust in London. Julian Lennon agreed to ...

The Development of “Eldo Ngano 1”: The World’s World’s First Ug99 Resistant Mutant Wheat Variety

International Nuclear Information System (INIS)

Forster, Brian P.

2014-01-01

The wheat black stem rust disease is a virulent race of fungus, Puccinia graminis, which affects wheat plants and is caused by a strain of fungus known as Ug99. Named for its place and year of origin, Ug99 was first discovered on wheat in Uganda in 1999. The spores of this plant disease are airborne and can be easily spread by wind. If not prevented, the disease can destroy 70 to 100 per cent of the yield of wheat crops. Annually on average 8.3 million tonnes of wheat grain is lost to this disease, costing US $1.23 billion per year. Ethiopia, Kenya and Uganda are hot spots for this disease. In 2009, growing international concern regarding the horrific impact of Ug99 on wheat led to the establishment of IAEA project INT/5/150, Responding to the Transboundary Threat of Wheat Black Stem Rust (Ug99). This project has involved over 18 countries and 5 national and international institutions, and examined possible mutation induction treatments to deal with the challenges posed by Ug99. Meetings and workshops to facilitate the project efforts have been held in Kenya and Turkey. Ug99 continues to spread globally and has now reached the Islamic Republic of Iran. There are also reports of suspected disease occurrences in Europe. It is essential that work continues on developing mutant lines for further crop protection that can be utilized worldwide to safeguard the wheat crop from this devastating disease

Commentary: "An Evaluation of Universal Grammar and the Phonological Mind"-UG Is Still a Viable Hypothesis.

Science.gov (United States)

Berent, Iris

2016-01-01

Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett's concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett's logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett's arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett's arguments hardly undermine the viability of this hypothesis.

Relationships between the Antarctic oscillation, the Madden-Julian oscillation, and ENSO, and consequences for rainfall analysis

CSIR Research Space (South Africa)

Pohl, B

2010-01-01

Full Text Available range, it is not unambiguously related to the global-scale Madden–Julian oscillation (MJO) activity, with in particular no coherent phase relationship with the MJO index. Moreover, in the high southern latitudes, the MJO-associated anomaly fields do...

Noble magnetic barriers in the ASDEX UG tokamak

Science.gov (United States)

Ali, Halima; Punjabi, Alkesh; Vazquez, Justin

2010-02-01

The second-order perturbation method of creating invariant tori inside chaos in Hamiltonian systems (Ali, H.; Punjabi, A. Plasma Phys. Contr. F. 2007, 49, 1565-1582) is applied to the axially symmetric divertor experiment upgrade (ASDEX UG) tokamak to build noble irrational magnetic barriers inside chaos created by resonant magnetic perturbations (m, n)=(3, 2)+(4, 3), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation. The radial dependence of the Fourier modes is ignored. The modes are considered to be locked and have the same amplitude δ. A symplectic mathematical mapping in magnetic coordinates is used to integrate magnetic field line trajectories in the ASDEX UG. Tori with noble irrational rotational transform are the last ones to be destroyed by perturbation in Hamiltonian systems. For this reason, noble irrational magnetic barriers are built inside chaos, and the strongest noble irrational barrier is identified. Three candidate locations for the strongest noble barrier in ASDEX UG are selected. All three candidate locations are chosen to be roughly midway between the resonant rational surfaces ψ32 and ψ43. ψ is the magnetic coordinate of the flux surface. The three candidate surfaces are the noble irrational surfaces close to the surface with q value that is a mediant of q=3/2 and 4/3, q value of the physical midpoint of the two resonant surfaces, and the q value of the surface where the islands of the two perturbing modes just overlap. These q values of the candidate surfaces are denoted by q MED, q MID, and q OVERLAP. The strongest noble barrier close to q MED has the continued fraction representation (CFR) [1;2,2,1∞] and exists for δ≤2.6599×10-4; the strongest noble barrier close to q MID has CFR [1;2,2,2,1∞] and exists for δ≤4.6311×10-4; and the strongest noble barrier close to q OVERLAP has CFR [1;2,2,6,2,1∞] and exists for δ≤1.367770×10-4. From these results, the strongest

Would Jule Charney Have Cracked the Madden-Julian Oscillation?

Science.gov (United States)

Emanuel, K.

2017-12-01

Jule Charney's approach to science often involved looking at old problems in new ways. One example was his theory of baroclinic instability, which followed on the heels of long-standing efforts to explain well-observed cyclones and anticyclones. He mastered the art of boiling a physical phenomenon down to its essence, throwing away many things that others had considered important while expressing that which he retained in the simplest possible way. To help honor Charney's legacy, I will review the history of another well-observed phenomenon - the Madden Julian Oscillation (MJO) - together with the many largely unsuccessful efforts to explain it, culminating finally in a satisfying explanation that Jule would have loved.

An investigation into breast imaging as part of the undergraduate (UG) education of diagnostic radiography students in the UK

International Nuclear Information System (INIS)

Strudwick, R.M.; Taylor, K.

2017-01-01

Introduction: How mammography is incorporated into undergraduate (UG) radiography training may influence student perception of the speciality and its potential as a future career option. An overview is provided of the academic and clinical content of UG radiography courses relating to mammography across the UK. Methods: Using mixed methods and an iterative, inductive approach supplying quantitative and qualitative data, we identify any variations and discuss possible causes which may help influence future training strategies. A self-designed questionnaire containing open and closed questions was sent online using SurveyMonkey™ to course leaders of all Higher Education Institutions (HEIs) offering BSc (Hons) Diagnostic Radiography courses in the UK. Responses were analysed for trends which were further explored by semi structured telephone interviews. These were transcribed and evaluated using a thematic analysis, the themes being categorised and coded. Results: 19 of 24 (79%) HEIs responded to the questionnaire. Follow up telephone interviews were conducted with five course leaders to further explore themes. Academic teaching ranged from 3 to 25 h over the 3 year course. Compared to other specialities 10 (53%) HEIs spent less time on mammography with 12 (63%) citing HCPC standards as the reason. 11 (65%) HEIs sent students on mammography placements, 2 (12%) sent females only. Placement times ranged between 2 days and 2 weeks. Influences included availability of expert teaching and relationship with clinical departments. Conclusion: There is variation in undergraduate exposure to mammography. Students views should be sought to add validity to these findings - Highlights: • A summary of undergraduate (UG) breast imaging in the UK. • Themes around the delivery of UG breast imaging education in university and practice. • Opinions of UG course leaders and other stakeholders about UG breast imaging education. • There is a variation across UK universities in

Protection of Children's Human Rights and Health: A Legacy of Julian Kramsztyk, Janusz Korczak, and Ludwik Rajchman.

Science.gov (United States)

Woltanowski, Piotr; Wincewicz, Andrzej; Sulkowski, Stanisław

2018-01-01

Tutor of generations of Warsaw medical doctors, Julian Kramsztyk (1851-1926) was son of Rabbi Izaak Kramsztyk, Polish patriot and fighter for independent Poland. Julian Kramsztyk graduated in medicine from Warsaw University in 1873 to soon work as a supervisor of the Internal Diseases Department of Bersohns and Baumans Children's Hospital from 1878 to 1910, and despite of refusing professorship from Imperial Warsaw University, he worked as a lecturer of pediatric disorders from 1880 with strong association of his medical practice with scientific and editorial tasks as well as engaging in charity. This article focuses on selective retrieval of biographical data of social and scientific achievements of followers of Julian Kramsztyk: his student, pioneer of children human rights, and pioneer of healthy patterns of nutrition of children, pediatrician Janusz Korczak (Henryk Goldszmit; 1878 or 1879-1942); and a skilled bacteriologist and a brilliant epidemiologist who was a prominent activist of the League of Nations (later United Nations Organization), cofounder of the UNICEF (United Nations Children's Emergency Fund), and the first chairman of the Organization from 1946 to 1950, which was primarily dedicated to "provide emergency food and health care to children in postwar time," Ludwik Rajchman (1881-1965). Janusz Korczak works laid foundation for international recognition of children rights to health, respect, education, privacy, and all the other human rights to be included in the United Nations Convention on the Rights of the Child (UNCRC). In 1989, nutrition and vaccination issues were the main medical interests of these medical doctors and still remain major fields of UNICEF actions.

Commentary: “An Evaluation of Universal Grammar and the Phonological Mind”—UG Is Still a Viable Hypothesis

Science.gov (United States)

Berent, Iris

2016-01-01

Everett (2016b) criticizes The Phonological Mind thesis (Berent, 2013a,b) on logical, methodological and empirical grounds. Most of Everett’s concerns are directed toward the hypothesis that the phonological grammar is constrained by universal grammatical (UG) principles. Contrary to Everett’s logical challenges, here I show that the UG hypothesis is readily falsifiable, that universality is not inconsistent with innateness (Everett’s arguments to the contrary are rooted in a basic confusion of the UG phenotype and the genotype), and that its empirical evaluation does not require a full evolutionary account of language. A detailed analysis of one case study, the syllable hierarchy, presents a specific demonstration that people have knowledge of putatively universal principles that are unattested in their language and these principles are most likely linguistic in nature. Whether Universal Grammar exists remains unknown, but Everett’s arguments hardly undermine the viability of this hypothesis. PMID:27471480

Identification and characterization of Sr13, a tetraploid wheat gene that confers resistance to the Ug99 stem rust race group

Science.gov (United States)

The Puccinia graminis f. sp. tritici (Pgt) Ug99 race group is virulent to most stem rust resistance genes currently deployed in wheat and poses a serious threat to global wheat production. The durum wheat (Triticum turgidum ssp. durum) gene Sr13 confers resistance to Ug99 in addition to virulent rac...

78 FR 37792 - Mario Julian Martinez-Bernache, Inmate Number #95749-279, CI Big Spring, Corrections Institution...

Science.gov (United States)

2013-06-24

... DEPARTMENT OF COMMERCE Bureau of Industry and Security Mario Julian Martinez-Bernache, Inmate... Order with the Under Secretary of Commerce for Industry and Security. The appeal must be filed within 45... the Internal Security Act of 1950 (50 U.S.C. 783(b)), or section 38 of the Arms Export Control Act (22...

Quantification of African cassava mosaic virus (ACMV) and East African cassava mosaic virus (EACMV-UG) in single and mixed infected Cassava (Manihot esculenta Crantz) using quantitative PCR.

Science.gov (United States)

Naseem, Saadia; Winter, Stephan

2016-01-01

The quantity of genomic DNA-A and DNA-B of African cassava mosaic virus (ACMV) and East African cassava mosaic virus Uganda (Uganda variant, EACMV-UG) was analysed using quantitative PCR to assess virus concentrations in plants from susceptible and tolerant cultivars. The concentrations of genome components in absolute and relative quantification experiments in single and mixed viral infections were determined. Virus concentration was much higher in symptomatic leaf tissues compared to non-symptomatic leaves and corresponded with the severity of disease symptoms. In general, higher titres were recorded for EACMV-UG Ca055 compared to ACMV DRC6. The quantitative assessment also showed that the distribution of both viruses in the moderately resistant cassava cv. TMS 30572 was not different from the highly susceptible cv. TME 117. Natural mixed infections with both viruses gave severe disease symptoms. Relative quantification of virus genomes in mixed infections showed higher concentrations of EACMV-UG DNA-A compared to ACMV DNA-A, but a marked reduction of EACMV-UG DNA-B. The higher concentrations of EACMV-UG DNA-B compared to EACMV DNA-A accumulation in single infections were consistent. Since DNA-B is implicated in virus cell-to-cell spread and systemic movement, the abundance of the EACMV-UG DNA-B may be an important factor driving cassava mosaic disease epidemic. Copyright © 2015 Elsevier B.V. All rights reserved.

Julian Assange, Jacob Appelbaum, Andy Müller-Maguhn, Jérémie

OpenAIRE

Boenisch, Gilles

2014-01-01

En 2009, Amnesty International a attribué un prix à Julian Assange, En 2010, il a été nommé homme de l’année par Time Magazine et Le Monde ; Forbes Magazine l’a placé pour la première fois parmi les 68 personnalités les plus influentes au monde. Retranché depuis plus d’un an à l’ambassade d’Équateur qui lui a accordé l’asile politique à Londres, le fondateur de Wikileaks propose un ouvrage, fruit d’un dialogue avec Jacob Appelbaum, Andy Müller-Maguhn et Jérémie Zimmermann, tous très soucieux ...

Intraseasonal response of the northern Indian Ocean coastal waveguide to the Madden-Julian Oscillation

Digital Repository Service at National Institute of Oceanography (India)

Vialard, J.; Shenoi, S.S.C.; Mc; Shankar, D.; Durand, F.; Fernando, V.; Shetye, S.R.

Author version: Geophys. Res. Lett.: 36(14); 2009; doi:10.1029/2009GL038450; 5 pp Intraseasonal response of Northern Indian Ocean coastal waveguide to the Madden-Julian Oscillation J. Vialard 1 2 , S.S.C Shenoi 2 , J.P. McCreary 3 , D. Shankar 2... involving both equatorial wave dynamics and coastal wave propagation around the perimeter of the northern Indian Ocean [McCreary et al., 1993]. The East India Coastal Current (EICC), for example, is strongly influenced by remote wind forcing from...

Targeted introgression of stem rust Ug99 resistance from wheatgrasses into pasta and bread wheat

Science.gov (United States)

In the past 50 years, a number of stem rust resistance (Sr) genes have been transferred from several wheat-related grasses into durum (i.e. pasta) and bread wheat through chromosome translocations and additions. To utilize these genes for controlling the Ug99 races of the stem rust pathogen, we ini...

The Madden-Julian Oscillation and the Indo-Pacific Warm Pool

Science.gov (United States)

Raymond, David J.; Fuchs, Željka

2018-04-01

A minimal model of the interaction of the Madden-Julian oscillation (MJO) with the Indo-Pacific warm pool is presented. This model is based on the linear superposition of the flow associated with a highly simplified treatment of the MJO plus the flow induced by the warm pool itself. Both of these components parameterize rainfall as proportional to the column water vapor, which in turn is governed by a linearized moisture equation in which WISHE (wind induced surface heat exchange) plays a governing role. The MJO component has maximum growth rate for planetary wavenumber 1 and is equatorially trapped with purely zonal winds. The warm pool component exhibits a complex flow pattern, differing significantly from the classical Gill model as a result of the mean easterly flow. The combination of the two produce a flow that reproduces many aspects of the observed global flow associated with the MJO.

Electromagnetic Radiation : Variational Methods, Waveguides and Accelerators Including seminal papers of Julian Schwinger

CERN Document Server

Milton, Kimball A

2006-01-01

This is a graduate level textbook on the theory of electromagnetic radiation and its application to waveguides, transmission lines, accelerator physics and synchrotron radiation. It has grown out of lectures and manuscripts by Julian Schwinger prepared during the war at MIT's Radiation Laboratory, updated with material developed by Schwinger at UCLA in the 1970s and 1980s, and by Milton at the University of Oklahoma since 1994. The book includes a great number of straightforward and challenging exercises and problems. It is addressed to students in physics, electrical engineering, and applied mathematics seeking a thorough introduction to electromagnetism with emphasis on radiation theory and its applications.

Resistance to stem rust Ug99 in six bread wheat cultivars maps to chromosome 6DS.

Science.gov (United States)

Lopez-Vera, Eric E; Nelson, Sarah; Singh, Ravi P; Basnet, Bhoja R; Haley, Scott D; Bhavani, Sridhar; Huerta-Espino, Julio; Xoconostle-Cazares, Beatriz G; Ruiz-Medrano, Roberto; Rouse, Matthew N; Singh, Sukhwinder

2014-01-01

Identified SSR markers ( Xcfd49 and Xbarc183 ) linked with stem rust resistance for efficient use in marker-assisted selection and stacking of resistance genes in wheat breeding programs. More than 80 % of the worldwide wheat (Triticum aestivum L.) area is currently sown with varieties susceptible to the Ug99 race group of stem rust fungus. However, wheat lines Niini, Tinkio, Coni, Pfunye, Blouk, and Ripper have demonstrated Ug99 resistance at the seedling and adult plant stages. We mapped stem rust resistance in populations derived from crosses of a susceptible parent with each of the resistant lines. The segregation of resistance in each population indicated the presence of a single gene. The resistance gene in Niini mapped to short arm of chromosome 6D and was flanked by SSR markers Xcfd49 at distances of 3.9 cM proximal and Xbarc183 8.4 cM distal, respectively. The chromosome location of this resistance was validated in three other populations: PBW343/Coni, PBW343/Tinkio, and Cacuke/Pfunye. Resistance initially postulated to be conferred by the SrTmp gene in Blouk and Ripper was also linked to Xcfd49 and Xbarc183 on 6DS, but it was mapped proximal to Xbarc183 at a similar position to previously mapped genes Sr42 and SrCad. Based on the variation in diagnostic marker alleles, it is possible that Niini and Pfunye may carry different resistance genes/alleles. Further studies are needed to determine the allelic relationships between various genes located on chromosome arm 6DS. Our results provide valuable molecular marker and genetic information for developing Ug99 resistant wheat varieties in diverse germplasm and using these markers to tag the resistance genes in wheat breeding.

A Madden-Julian oscillation event realistically simulated by a global cloud-resolving model.

Science.gov (United States)

Miura, Hiroaki; Satoh, Masaki; Nasuno, Tomoe; Noda, Akira T; Oouchi, Kazuyoshi

2007-12-14

A Madden-Julian Oscillation (MJO) is a massive weather event consisting of deep convection coupled with atmospheric circulation, moving slowly eastward over the Indian and Pacific Oceans. Despite its enormous influence on many weather and climate systems worldwide, it has proven very difficult to simulate an MJO because of assumptions about cumulus clouds in global meteorological models. Using a model that allows direct coupling of the atmospheric circulation and clouds, we successfully simulated the slow eastward migration of an MJO event. Topography, the zonal sea surface temperature gradient, and interplay between eastward- and westward-propagating signals controlled the timing of the eastward transition of the convective center. Our results demonstrate the potential making of month-long MJO predictions when global cloud-resolving models with realistic initial conditions are used.

Identification and validation of single nucleotide polymorphic markers linked to Ug99 stem rust resistance in spring wheat

Science.gov (United States)

Wheat stem rust (Puccinia graminis f. sp. tritici Eriks. and E. Henn.) is one of the most destructive diseases world-wide. Races belonging to Ug99 (or TTKSK) continue to cause crop losses in East Africa and threaten global wheat production. Developing and deploying wheat varieties with multiple race...

Genomic analysis of a novel gene conferring resistance to Ug99 stem rust in Triticum turgidum ssp. dicoccum

Science.gov (United States)

Wheat production is threatened by the disease stem rust, which is caused by the biotrophic fungal pathogen Puccinia graminis Pers.:Pers. f. sp. tritici (Pgt). Among all known Pgt races, TTKSK (Ug99) and TRTTF are significant threats to North American wheat production due to their virulence against f...

Using AMIE data to study cloud processes within the Madden-Julian Oscillation

Energy Technology Data Exchange (ETDEWEB)

Houze, Robert A. [Univ. of Washington, Seattle, WA (United States). Dept. of Atmospheric Sciences

2015-12-17

This study uses AMIE data to show how the small clouds in the Madden-Julian Oscillation first organize into lines and other patterns, how they develop the first rainshowers, how those showers deposit cool air over the ocean surface, how this cool air spreads and triggers deeper convection, how the deep convection develops into mesoscale systems, how the mesoscale systems modify the heating profile through the depth of the troposphere, and how the development of the clouds responds to and interacts with large-scale waves circumnavigating the globe at upper levels, and how equatorial trapped waves at lower levels modulates the development of the cloud population. The techniques used to analyze the radar and sounding data collected in AMIE to achieve the above results are innovative, and to obtain more general results we have used regional modeling with a variety of cloud microphysical schemes in combination with the data analyses.

Impact of Madden–Julian Oscillation upon Winter Extreme Rainfall in Southern China: Observations and Predictability in CFSv2

OpenAIRE

Hong-Li Ren; Pengfei Ren

2017-01-01

The impact of Madden–Julian oscillation (MJO) upon extreme rainfall in southern China was studied using the Real-time Multivariate MJO (RMM) index and daily precipitation data from high-resolution stations in China. The probability-distribution function (PDF) of November–March rainfall in southern China was found to be skewed toward larger (smaller) values in phases 2–3 (6–7) of MJO, during which the probability of extreme rainfall events increased (reduced) by 30–50% (20–40%) relative to all...

Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

International Nuclear Information System (INIS)

Osborne, P.E.

2002-01-01

The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of 233 U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF 6 and subsequent steam treatments of UO 2 F 2 . For each mole of UF 6 converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance

Most Dominated Problems of Mass Media Dialogism in National Dailies during the Trial Process of Wikileaks Grounder Julian Assange

OpenAIRE

Sandra Veinberg

2014-01-01

This paper examines media mediation, media effects and their impact on the literacy of the public sphere. To examine the medial text and media mediation's impact on various journalistic fields in different countries, I analyse during the current moment of ¡°the global hunting¡± around WikiLeaks¡¯ founder Julian Assange. As the source, I use 764 published articles in newspapers and online media from six different countries: Sweden, UK, Ecuador, Russia, Latvia and Malaysia. The objective was to...

From Satis House to Newgate: Manipulation and Repression in the Adaptation of Great Expectations by Julian Jarrold

Directory of Open Access Journals (Sweden)

Claudia Cao

2012-12-01

Full Text Available This article analyzes a serial of Great Expectations in two parts directed by Julian Jarrold for the BBC in 1999. Through the semiotic approach proposed by Nicola Dusi in his essay Il cinema come traduzione. Da un medium all’altro (2003, this paper wants to highlight the translation strategies employed in the target text in comparison with the hypotext. The aim of this article is to show how the dominant isotopies – Pip’s repression and manipulation – are figurativized in the representation of the main places of power in the adaptation: Satis House, Little Britain and Newgate.

Underground gas storage Uelsen: Findings from planning, building and commissioning the surface buildings and structures; Untertagegasspeicher (UGS) Uelsen: Erkenntnisse aus Planung, Bau und Inbetriebnahme der obertaegigen Anlagen

Energy Technology Data Exchange (ETDEWEB)

Focke, H.; Brueggmann, R.; Mende, F.; Steinkraus, D.; Wauer, R. [BEB Erdgas und Erdoel GmbH, Hannover (Germany)

1998-12-31

The article describes the concepts of the plants and equipment and the specific features of the underground storage at Uelsen. The underground storage will be purpose-built as an H-gas storage in a nearly depleted sandstone deposit. At a nominal deliverability of 250.000 cubic m/h (Vn) the storage at Uelsen has more potential for expansion. This potential was taken into account by designing appropriate pressure stages, capacities, performance characteristics and space. (orig.). [Deutsch] Die nachfolgende Veroeffentlichung stellt das anlagentechnische Grundkonzept und die spezifischen Besonderheiten des UGS Uelsen dar. Der im suedwestlichen Niedersachsen als H-Gasspeicher in einer nahezu ausgefoerderten Buntsandsteinlagerstaette eingerichtete UGS Uelsen wird in mehreren Ausbaustufen bedarfsgerecht fertiggestellt. Bei einer Nennentnahmekapazitaet von 450.000 m{sup 3}/h (Vn) und einer Nenninjektionsleistung von 250.000 m{sup 3}/h (Vn) weist der UGS Uelsen noch weiteres Potential fuer Erweiterungen auf. Dieses Ausbaupotential wurde bei der Planung und dem Bau der bestehenden Anlagen durch Festlegung entsprechender Druckstufen, Kapazitaeten, Leistungsgroessen und Platzanordnungen beruecksichtigt. (orig.)

Analysis of the sediments of the Julian Adame Alatorre dam by the INAA; Analisis de sedimentos de la presa Julian Adame Alatorre por la tecnica de AANI

Energy Technology Data Exchange (ETDEWEB)

Oliva, J.E.; Lugo, J.F.; Mireles, F.; Quirino, L.L.; Davila, J.I.; Pinedo, J.L.; Rios, C. [UAZ, Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Miller, W.H. [Nuclear Science and Engineering Institute, E2433 Engineering Building East, University of Missouri-Columbia, MO 65211 (United States)]. e-mail: jeolivag@yahoo.com.mx

2003-07-01

Its were taken eight samples of sediment of the Julian Adame Alatorre dam located in the Villanueva municipality, in the State of Zacatecas, Mexico; with the end of determining the presence of elements of anthropogenic origin, as well as the concentration of the same ones. It was used the Instrumental neutron activation analysis (AANI) with a flow of thermal neutrons of 8 x 10{sup 13} and 5 x 10{sup 13} n cm{sup -2} s{sup -1}. With the purpose of determining the concentration of these elements at level of traces; finding presence of 32 elements among which its were find elements in greater concentrations and others at level of traces. Of these 32 elements, five of anthropogenic origin were identified which its were: Cr, Co, Zn, As and Mn; but that whose concentration is very low, in comparison with the one reported in other places of the world. In this work there are presented the obtained results of the elementary analysis of this samples. (Author)

Creation of a magnetic barrier at a noble q close to physical midpoint between two resonant surfaces in the ASDEX UG tokamak

Science.gov (United States)

Vazquez, Justin; Ali, Halima; Punjabi, Alkesh

2009-11-01

Ciraolo, Vittot and Chandre method of building invariant manifolds inside chaos in Hamiltonian systems [Ali H. and Punjabi A, Plasma Phys. Control. Fusion, 49, 1565--1582 (2007)] is used in the ASDEX UG tokamak. In this method, a second order perturbation is added to the perturbed Hamiltonian [op cit]. It creates an invariant torus inside the chaos, and reduces the plasma transport. The perturbation that is added to the equilibrium Hamiltonian is at least an order of magnitude smaller than the perturbation that causes chaos. This additional term has a finite, limited number of Fourier modes. Resonant magnetic perturbations (m,n) = (3,2)+(4,3) are added to the field line Hamiltonian for the ASDEX UG. An area-preserving map for the field line trajectories in the ASDEX UG is used. The common amplitude δ of these modes that gives complete chaos between the resonant surfaces ψ43 and ψ32 is determined. A magnetic barrier is built at a surface with noble q that is very nearly equals to the q at the physical midpoint between the two resonant surfaces. The maximum amplitude of magnetic perturbation for which this barrier can be sustained is determined. This work is supported by US Department of Energy grants DE-FG02-07ER54937, DE-FG02-01ER54624 and DE-FG02-04ER54793.

Root cause analysis of the fatigue failures of the pulsation dampers of a large underground gas storage (UGS) system

NARCIS (Netherlands)

Eijk, A.; Lange, D. de; Maljaars, J.; Tenbrock-Ingenhorst, A.; Gottmer, A.

2014-01-01

Two large identical 6-cylinder Ariel JGB/6 reciprocating compressors each of 7.5 MW, are used for an underground gas storage system (UGS) plant of RWE Gasspeicher GmbH located in Epe, Germany. The system is in operation since 2005. In 2011 several internals parts (baffle plates and baffle choke

Influences of the ENSO, oscillation Madden-Julian, waves of the east, hurricanes and moon phases on the diurnal cycle of precipitation at the tropical Andes of Colombia

International Nuclear Information System (INIS)

Poveda, German; Mesa, Oscar; Agudelo, Paula; Alvarez, Juan; Arias, Paola; Moreno, Hernan; Salazar, Luis; Toro, Vladimir; Vieira, Sara

2002-01-01

We study the effects of large-scale ocean-atmospheric, astronomic phenomena on the diurnal cycle of precipitation at the tropical Andes of Colombia. Such phenomena include both phases of El Nino/Southern Oscillation (ENSO), namely El Nino and La Nina, the intra seasonal Madden-Julian oscillation, tropical easterly waves (4-8 days), moon phases and hurricanes over the Atlantic and eastern pacific oceans. We found a clear-cut effect of both ENSO phases: El Nino is associated with a diminished rainfall diurnal cycle, and La Nina intensifies it. Thus, ENSO modulates precipitation in Colombia at timescales ranging from hours to decades. We identified a close association with different phases of the Madden-Julian oscillation, as the diurnal cycle is intensified (larger amplitude) during its westerly phase, but it gets decreased during its easterly phase. For both ENSO and the Madden-Julian oscillation we identified a clear-cut influence on the amplitude of the diurnal cycle, yet the phase is conserved for the most part. Tropical easterly waves appear to affect the diurnal cycle, but no clear overall signal is pervasive throughout the region. We al so found a significant statistical association with hurricanes occurring over the northeastern pacific ocean with the diurnal cycle of precipitation at rain gages located over the eastern slope of the eastern range of the Colombian Andes. Rainfall at all the remaining slopes of the Andes is statistically associated with hurricanes occurring at the tropical north Atlantic and the Caribbean Sea. Moon phases are not statistically associated with the diurnal cycle and daily total rainfall

Problems of Gas Pressure Build-up in Casing String of UGS and Gas Wells

Directory of Open Access Journals (Sweden)

Peter Sovius

2006-10-01

Full Text Available This paper consists of three basic parts. The opening part is a brief description of problems associated with the secondary untightness of UGS wells (Underground Gas Storages and gas wells generally.The main part of the paper is composed of some cases that we have met in our company. Solution proposals of various cases are also supplied in this part. Separate problem situations are described in terms of finding out an untight point and also a testing result and consequential removing of untightness.The conclusion includes knowledge summary that were taken by solution of complicatedsituations connected with well non-hermeticity.

Discovery of a Novel Stem Rust Resistance Allele in Durum Wheat that Exhibits Differential Reactions to Ug99 Isolates

Directory of Open Access Journals (Sweden)

Jayaveeramuthu Nirmala

2017-10-01

Full Text Available Wheat stem rust, caused by Puccinia graminis f. sp. tritici Eriks. & E. Henn, can incur yield losses in susceptible cultivars of durum wheat, Triticum turgidum ssp. durum (Desf. Husnot. Although several durum cultivars possess the stem rust resistance gene Sr13, additional genes in durum wheat effective against emerging virulent races have not been described. Durum line 8155-B1 confers resistance against the P. graminis f. sp. tritici race TTKST, the variant race of the Ug99 race group with additional virulence to wheat stem rust resistance gene Sr24. However, 8155-B1 does not confer resistance to the first-described race in the Ug99 race group: TTKSK. We mapped a single gene conferring resistance in 8155-B1 against race TTKST, Sr8155B1, to chromosome arm 6AS by utilizing Rusty/8155-B1 and Rusty*2/8155-B1 populations and the 90K Infinium iSelect Custom bead chip supplemented by KASP assays. One marker, KASP_6AS_IWB10558, cosegregated with Sr8155B1 in both populations and correctly predicted Sr8155B1 presence or absence in 11 durum cultivars tested. We confirmed the presence of Sr8155B1 in cultivar Mountrail by mapping in the population Choteau/Mountrail. The marker developed in this study could be used to predict the presence of resistance to race TTKST in uncharacterized durum breeding lines, and also to combine Sr8155B1 with resistance genes effective to Ug99 such as Sr13. The map location of Sr8155B1 cannot rule out the possibility that this gene is an allele at the Sr8 locus. However, race specificity indicates that Sr8155B1 is different from the known alleles Sr8a and Sr8b.

Analysis of the sediments of the Julian Adame Alatorre dam by the INAA

International Nuclear Information System (INIS)

Oliva, J.E.; Lugo, J.F.; Mireles, F.; Quirino, L.L.; Davila, J.I.; Pinedo, J.L.; Rios, C.; Miller, W.H.

2003-01-01

Its were taken eight samples of sediment of the Julian Adame Alatorre dam located in the Villanueva municipality, in the State of Zacatecas, Mexico; with the end of determining the presence of elements of anthropogenic origin, as well as the concentration of the same ones. It was used the Instrumental neutron activation analysis (AANI) with a flow of thermal neutrons of 8 x 10 13 and 5 x 10 13 n cm -2 s -1 . With the purpose of determining the concentration of these elements at level of traces; finding presence of 32 elements among which its were find elements in greater concentrations and others at level of traces. Of these 32 elements, five of anthropogenic origin were identified which its were: Cr, Co, Zn, As and Mn; but that whose concentration is very low, in comparison with the one reported in other places of the world. In this work there are presented the obtained results of the elementary analysis of this samples. (Author)

Corrosion Test Results for Inconel 600 vs Inconel-Stainless UG Bellows

Energy Technology Data Exchange (ETDEWEB)

Osborne, P.E.

2002-09-11

The Conversion Project (CP) of the Molten Salt Reactor Experiment at Oak Ridge National Laboratory (ORNL) involves converting slightly less than 40 kg of {sup 233}U to a stable form for safe storage. The operation is performed within a few vessels interconnected by valves and 1/2-in. metal tubing. During this conversion, a particularly toxic and corrosive by-product is formed, namely aqueous hydrofluoric acid (HF). The production of HF is a result of the hydrolysis of UF{sub 6} and subsequent steam treatments of UO{sub 2}F{sub 2}. For each mole of UF{sub 6} converted, 6 mol of HF are produced. The HF that forms during conversion combines with water to produce approximately 1.5 L of 33 wt % HF. As this mixture is transferred within the process system, the tubing and valves are exposed to high concentrations of HF in liquid and vapor form. Of particular concern in the system are the almost 30 valves that have the potential for exposure to HF. For these valves, a vendor-supplied UG valve was installed. UG valves consist of an Alloy 400 (Monel) body and stem tip and Alloy 600 (Inconel) bellows. These valves have been used under experimental conditions that simulate the CP. It has been established that they have a finite life when exposed to a HF and air environment. Most failures were seen around the flange at the bottom of the bellows, and it was suspected that this flange and the weld material were not Inconel. In December 2001, the vendor confirmed that this flange was not Inconel but instead was stainless steel 316. After discussions between the vendor and ORNL staff involved with the CP effort, it was decided that the entire wetted area of the bellows would be fabricated from Alloy 600. In March 2002, four newly fabricated bellows assemblies were received from the vendor for the purposes of corrosion testing in HF. This report presents results from the corrosion tests conducted to determine if the new design of the bellows would enhance their corrosion resistance.

Book review: Julian Thomas The Birth of Neolithic Britain: An Interpretive Account.

Directory of Open Access Journals (Sweden)

Marko Sraka

2014-12-01

Full Text Available The Birth of Neolithic Britain is the fourth major work by the acclaimed Julian Thomas, one of the leading proponents of interpretive archaeology or archaeology informed by philosophy, anthropology and discussions in the arts and social sciences in general. After exposing the assumption and prejudices of archaeologists’ narratives of the Neolithic and presenting innovative explanations of the shift from hunting-gathering to farming as well as other issues in Rethinking the Neolithic (1991; reworked and updated version Understanding the Neolithic in 1999, questioning Western conceptualisations of time, identity, materiality with the help of archaeological case studies in the ‘Heideggerian’ Time, Culture and Identity (1996 and further contextualised archaeology as part of a (postmodern worldview in Archaeology and Modernity (2004, this book seems to be a relevant continuation of Thomas’s work. This is probably the first significant work on Neolithisation since Graeme Barker’s global overview The Agricultural Revolution in Prehistory (2006, Oxford: Oxford University Press, this time with a focus on Europe and particularly Britain.

Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

DEFF Research Database (Denmark)

Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

2004-01-01

Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

Dohmen, Dieter, Erbes, Annegret, Fuchs, Kathrin & Günzel, Juliane (2008). Was wissen wir über Nachhilfe? Sachstand und Auswertung der Forschungsliteratur zu Angebot, Nachfrage und Wirkungen. Bielefeld: Bertelsmann, 150 S. [Rezension

OpenAIRE

Mayr, Thomas

2014-01-01

Rezension von Dohmen, Dieter, Erbes, Annegret, Fuchs, Kathrin & Günzel, Juliane (2008). Was wissen wir über Nachhilfe? Sachstand und Auswertung der Forschungsliteratur zu Angebot, Nachfrage und Wirkungen. Bielefeld: Bertelsmann, 150 S. 29,90 EUR, ISBN 978-3763936656

The strongest magnetic barrier in the DIII-D tokamak and comparison with the ASDEX UG

Science.gov (United States)

Ali, Halima; Punjabi, Alkesh

2013-05-01

Magnetic perturbations in tokamaks lead to the formation of magnetic islands, chaotic field lines, and the destruction of flux surfaces. Controlling or reducing transport along chaotic field lines is a key challenge in magnetically confined fusion plasmas. A local control method was proposed by Chandre et al. [Nucl. Fusion 46, 33-45 (2006)] to build barriers to magnetic field line diffusion by addition of a small second-order control term localized in the phase space to the field line Hamiltonian. Formation and existence of such magnetic barriers in Ohmically heated tokamaks (OHT), ASDEX UG and piecewise analytic DIII-D [Luxon, J.L.; Davis, L.E., Fusion Technol. 8, 441 (1985)] plasma equilibria was predicted by the authors [Ali, H.; Punjabi, A., Plasma Phys. Control. Fusion 49, 1565-1582 (2007)]. Very recently, this prediction for the DIII-D has been corroborated [Volpe, F.A., et al., Nucl. Fusion 52, 054017 (2012)] by field-line tracing calculations, using experimentally constrained Equilibrium Fit (EFIT) [Lao, et al., Nucl. Fusion 25, 1611 (1985)] DIII-D equilibria perturbed to include the vacuum field from the internal coils utilized in the experiments. This second-order approach is applied to the DIII-D tokamak to build noble irrational magnetic barriers inside the chaos created by the locked resonant magnetic perturbations (RMPs) (m, n)=(3, 1)+(4, 1), with m and n the poloidal and toroidal mode numbers of the Fourier expansion of the magnetic perturbation with amplitude δ. A piecewise, analytic, accurate, axisymmetric generating function for the trajectories of magnetic field lines in the DIII-D is constructed in magnetic coordinates from the experimental EFIT Grad-Shafranov solver [Lao, L, et al., Fusion Sci. Technol. 48, 968 (2005)] for the shot 115,467 at 3000 ms in the DIII-D. A symplectic mathematical map is used to integrate field lines in the DIII-D. A numerical algorithm [Ali, H., et al., Radiat. Eff. Def. Solids Inc. Plasma Sc. Plasma Tech. 165, 83

Wpływ informatyzacji Biblioteki Uniwersyteckiej w Poznaniu na zmiany organizacyjne i rozwój usług bibliotecznych

Directory of Open Access Journals (Sweden)

Piotr Karwasiński

2015-12-01

Full Text Available W artykule omówiono zagadnienia związane z procesami informatyzacji Biblioteki Uniwersyteckiej w Poznaniu. W celu dokładnego scharakteryzowania przemian, prócz rysu historycznego, przedstawiono obszary, które wyraźnie poprawiły jakość pracy personelu i obsługę czytelników oraz przyczyniły się do poznania, upowszechniania i wdrażania nowoczesnych rozwiązań technologicznych. Zaprezentowano proces zmian w zakresie funkcjonowania systemu biblioteczno-informacyjnego Horizon i współpracy z narodowym katalogiem centralnym NUKAT. Opisano etapy rozwoju elektronicznej przestrzeni informacyjnej, w tym budowania elektronicznych zasobów wiedzy i tworzenia narzędzi do ich obsługi i wykorzystania w procesach wyszukiwania źródeł informacji. Zaprezentowano Bibliotekę Uniwersytecką jako partnera w aranżowaniu instytucjonalnych platform cyfrowych do deponowania i udostępniania dorobku intelektualnego społeczności naukowej Uniwersytetu im. Adama Mickiewicza w Poznaniu. Wskazano także funkcjonalność zaprojektowanych i wdrożonych innowacyjnych usług wirtualnych pakietu Libsmart, optymalizujących funkcjonowanie Biblioteki Uniwersyteckiej.

Extratropical Forcing Triggered the 2015 Madden-Julian Oscillation-El Niño Event.

Science.gov (United States)

Hong, Chi-Cherng; Hsu, Huang-Hsiung; Tseng, Wan-Ling; Lee, Ming-Ying; Chow, Chun-Hoe; Jiang, Li-Chiang

2017-04-24

In this paper, we report the triggering effect of extratropical perturbation on the onset of an atypical Madden-Julian Oscillation (MJO) and onset of the 2015-16 El Niño in March 2015. The MJO exhibited several unique characteristics: the effect of extratropical forcing, atypical genesis location and timing in the equatorial western Pacific, and the extremity of amplitudes in many aspects. The southward-penetrating northerly associated with the extratropical disturbances in the extratropical western North Pacific contributed to triggering the deep convection and westerly wind burst (WWB) and onset of the MJO over the anomalously warm tropical western Pacific in early March. The persisting strong WWB forced downwelling Kelvin wave-like oceanic perturbation that propagated eastward and led to the onset of the 2015-16 El Niño. The proposed novel extratropical forcing mechanism explaining the unique extratropics-MJO-El Niño association, based on both data diagnostics and numerical experiments, warrants further attention for a more detailed understanding of the onset of the MJO and its potential effect on El Niño.

Modulation of Atlantic Aerosols by the Madden-Julian Oscillation

Science.gov (United States)

Tian, B.; Waliser, D. E.; Kahn, Ralph A.; Wong, S.

2010-01-01

Much like the better-known EI Nino-Southern Oscillation, the Madden-Julian Oscillation (MJO) is a global-scale atmospheric phenomenon. The MJO involves periodic, systematic changes in the distribution of clouds and precipitation over the western Pacific and Indian oceans, along with differences in wind intensity over even more extensive areas, including the north and subtropical Atlantic Ocean. The lead authors of this paper developed a sophisticated mathematical technique for mapping the spatial and temporal behavior of changes in the atmosphere produced by the MJO. In a previous paper, we applied this technique to search for modulation of airborne particle amount in the eastern hemisphere associated with the "wet" (cloudy) vs. "dry" phases of the MJO. The study used primarily AVHRR, MODIS, and TOMS satellite-retrieved aerosol amount, but concluded that other factors, such as cloud contamination of the satellite signals, probably dominated the observed variations. The current paper looks at MJO modulation of desert dust transport eastward across the Atlantic from northern Africa, a region much less subject to systematic cloud contamination than the eastern hemisphere areas studied previously. In this case, a distinct aerosol signal appears, showing that dust is transported westward much more effectively during the MJO phase that favors westward-flowing wind, and such transport is suppressed when the MJO reduces these winds. Aside form the significant achievement in identifying such an effect, the result implies that an important component of global dust transport can be predicted based on the phase of the MJO. As a consequence, the impact of airborne dust on storm development in the Atlantic, and on dust deposition downwind of the desert sources, can also be predicted and more accurately modeled.

The Madden-Julian Oscillation in NCEP Coupled Model Simulation

Directory of Open Access Journals (Sweden)

Wanqiu Wang Kyong-Hwan Seo

2009-01-01

Full Text Available This study documents a detailed analysis on the Madden-Julian Oscillation (MJO simulated by the National Centers for Environmental Prediction (NCEP using the Global Forecast System (GFS model version 2003 coupled with the Climate Forecast System model (CFS consisting of the 2003 version of GFS and the Geophysical Fluid Dynamics Laboratory (GFDL Modular Ocean Model V.3 (MOM3. The analyses are based upon a 21-year simulation of AMIP-type with GFS and CMIP-type with CFS. It is found that air-sea coupling in CFS is shown to improve the coherence between convection and large-scale circulation associated with the MJO. The too fast propagation of convection from the Indian Ocean to the maritime continents and the western Pacific in GFS is improved (slowed down in CFS. Both GFS and CFS produce too strong intraseasonal convective heating and circulation anomalies in the central-eastern Pacific; further, the air-sea coupling in CFS enhances this unrealistic feature. The simulated mean slow phase speed of east ward propagating low-wavenumber components shown in the wavenumber-frequency spectra is due to the slow propagation in the central-eastern Pacific in both GFS and CFS. Errors in model climatology may have some effect upon the simulated MJO and two possible influences are: (i CFS fails to simulate the westerlies over maritime continents and western Pacific areas, resulting in an unrealistic representation of surface latent heat flux associated with the MJO; and (ii vertical easterly wind shear from the Indian Ocean to the western Pacific in CFS is much weaker than that in the observation and in GFS, which may adversely affect the eastward propagation of the simulated MJO.

New Seeds are Resistant to Wheat Stem Rust (Ug99) Multinational Programme Supported by FAO and IAEA

International Nuclear Information System (INIS)

2013-01-01

Full text: A multinational effort supported by the International Atomic Energy Agency and the U.N. Food and Agriculture Organization marked a key milestone this week when a Kenyan university debuted two new varieties of disease-resistant wheat to the nation's farmers. Over the past two days, thousands of Kenyan farmers have visited Eldoret University in western Kenya for a two-day agriculture fair highlighting the latest farming technologies. Supporting the development of the new varieties were the IAEA's Technical Cooperation Department and the Joint FAO/IAEA Programme of Nuclear Techniques in Food and Agriculture. They manage an interregional Technical Cooperation project to develop varieties of wheat that are resistant to a devastating type of fungus, causing a disease known as wheat stem rust. Wheat stem rust under control for over 30 years, but a resurgence of the disease was discovered in 1999 in Uganda that swiftly spread to neighbouring Kenya. The wheat stem rust, caused by the strain of the fungus known as Ug99, named after its place and year of origin, has since spread to Iran, Yemen and South Africa and threatens crops as far away as India as spores are carried by wind. Parasitic rusts threaten global wheat production, reducing plant growth and crop yields. The disease can destroy up to 70-100 percent of the yield of wheat crop if not prevented. 'Improving food security in developing countries through the use of nuclear techniques is an important priority of the IAEA', said IAEA Director General Yukiya Amano. 'I am pleased that we have been able to make an important contribution to fighting wheat rust'. 'Wheat rusts, particularly the Ug99 strain, are a major threat to food security because rust epidemics can result in devastating yield losses. This international project involving affected countries, plant scientists and breeders and international organizations is a major breakthrough. It clearly shows the benefits of FAO/IAEA collaboration and that

The Modulation of Tropical Storm Activity in the Western North Pacific by the Madden-Julian Oscillation in GEOS-5 AGCM Experiments

Science.gov (United States)

Kim, Dongmin; Lee, Myong-In; Kim, Hye-Mi; Schubert, Siegfried D.; Yoo, Jin Ho

2014-01-01

This study examines the influence of the Madden-Julian Oscillation (MJO) on tropical storm (TS) activity in the western North Pacific, using observations and GEOS-5 simulations at 50-km horizontal resolution. While GEOS-5 produces an MJO of faster propagation and weaker amplitude, it nevertheless reproduces the observed modulation of TS activity by the MJO with the highest TS genesis and increased track density in the active phases of MJO. The study suggests that the simulation of the sub-seasonal variability of TS activity could be improved by improving the simulations of the MJO in climate models.

Prediction of North Pacific Height Anomalies During Strong Madden-Julian Oscillation Events

Science.gov (United States)

Kai-Chih, T.; Barnes, E. A.; Maloney, E. D.

2017-12-01

The Madden Julian Oscillation (MJO) creates strong variations in extratropical atmospheric circulations that have important implications for subseasonal-to-seasonal prediction. In particular, certain MJO phases are characterized by a consistent modulation of geopotential height in the North Pacific and adjacent regions across different MJO events. Until recently, only limited research has examined the relationship between these robust MJO tropical-extratropical teleconnections and model prediction skill. In this study, reanalysis data (MERRA and ERA-Interim) and ECMWF ensemble hindcasts are used to demonstrate that robust teleconnections in specific MJO phases and time lags are also characterized by excellent agreement in the prediction of geopotential height anoma- lies across model ensemble members at forecast leads of up to 3 weeks. These periods of enhanced prediction capabilities extend the possibility for skillful extratropical weather prediction beyond traditional 10-13 day limits. Furthermore, we also examine the phase dependency of teleconnection robustness by using Linear Baroclinic Model (LBM) and the result is consistent with the ensemble hindcasts : the anomalous heating of MJO phase 2 (phase 6) can consistently generate positive (negative) geopotential height anomalies around the extratropical Pacific with a lead of 15-20 days, while other phases are more sensitive to the variaion of the mean state.

Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

International Nuclear Information System (INIS)

Terry, S.S.; Cunningham, M.J.

1975-11-01

The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

Steve Boardman and Julian Goodare, eds., Kings, Lords and Men in Scotland and Britain, 1300–1625: Essays in Honour of Jenny Wormald. Edinburgh: Edinburgh University Press, 2014. Pp. 368. ISBN: 9780748691500. £75.00.

Directory of Open Access Journals (Sweden)

Lucinda Dean

2015-08-01

Full Text Available Steve Boardman and Julian Goodare, eds., Kings, Lords and Men in Scotland and Britain, 1300–1625: Essays in Honour of Jenny Wormald. Edinburgh: Edinburgh University Press, 2014. Pp. 368. ISBN: 9780748691500. £75.00.

Perswazyjność komunikatów reklamowych w Internecie na podstawie analizy usług finansowych SKOK-ów

OpenAIRE

Idzik, Beata

2014-01-01

Praca jest wynikiem kilkuletnich obserwacji praktycznej strony funkcjonowania reklamy w zakresie usług finansowych. Autorka starała się oddać wyraz swojemu zainteresowaniu psychologią konsumenta, marketingiem w sektorze finansowym a także fascynacji możliwościom, jakie stwarzają w tym zakresie nowe technologie oparte na Internecie. Praca ma charakter teoretyczno - badawczy. W założeniach metodologicznych sformułowano problem badawczy, cele oraz cztery hipotezy badawcze, które poddano wery...

A Mechanism Denial Study on the Madden-Julian Oscillation

Directory of Open Access Journals (Sweden)

In-Sik Kang

2011-12-01

Full Text Available A series of Madden-Julian oscillation (MJO mechanism-denial experiments is performed using an atmospheric general circulation model (AGCM. Daily climatological seasonal cycles of i surface latent heat flux, ii net radiative heating rate, and iii surface wind stress are obtained from a control simulation and prescribed in place of the normal interactive computations of these fields in order to turn off the i wind-induced surface heat exchange (WISHE, ii cloud-radiation interaction (CRI, and iii frictional wave-CISK (FWC mechanisms, respectively. Dual and triple mechanism denial experiments are also conducted by switching off multiple mechanisms together. The influence of each mechanism is assessed by comparing experiments with that mechanism turned off to those in which it is not. CRI and WISHE are both found to be important to the simulated MJO amplitude and propagation speed, while FWC has weaker and less systematic effects. The MJO is weakened when CRI is turned off, but strengthened when WISHE is turned off, indicating that CRI amplifies the MJO in the control simulation while WISHE weakens it. The negative influence of WISHE is shown to result from simulated phase relationships between surface winds, surface fluxes and convection which differ significantly from those found in observations, and thus is not interpreted as evidence against a positive role for WISHE in the development and maintenance of the observed MJO. The positive influence of CRI in the model is consistent with a strong simulated relationship between daily grid-point column-integrated radiative and convective heating; the mean ratio of the latter to the former exceeds 0.2 for rain rates less than 14 mm d-1. CRI is also shown to suppress an excessive excitation of the convectively coupled Kelvin wave so that the amplitude and frequency of the MJO is maintained.

Prediction of the Midlatitude Response to Strong Madden-Julian Oscillation Events on S2S Time Scales

Science.gov (United States)

Tseng, K.-C.; Barnes, E. A.; Maloney, E. D.

2018-01-01

The Madden-Julian Oscillation (MJO) forces strong variations in extratropical atmospheric circulations that have important implications for subseasonal-to-seasonal (S2S) prediction. In particular, certain MJO phases are characterized by a consistent modulation of geopotential height in the North Pacific and adjacent regions across different MJO events. Until recently, only limited research has examined the relationship between these robust MJO tropical-extratropical teleconnections and model prediction skill. In this study, reanalysis data and numerical forecast model ensemble hindcasts are used to demonstrate that robust teleconnections in specific MJO phases and time lags are also characterized by excellent agreement in the prediction of geopotential height anomalies across model ensemble members at forecast leads of up to 3 weeks. These periods of enhanced prediction capabilities extend the possibility for skillful extratropical weather prediction beyond traditional 10-13 day limits.

Um caso político-cultural na antiguidade tardia: o Imperador Juliano e seu conceito de educação = A political-culture case from late antiquity: the emperor julian and his concept of education

Directory of Open Access Journals (Sweden)

Margarida Maria de Carvalho

2010-01-01

Full Text Available Nesse artigo tenho como propósito conceituar o que é Paideiaou educação na concepção do Imperador Juliano. Para tanto trabalharei o significado de Logos cristão e Logos grego me utilizando também do discurso Contra Juliano de Gregório de Nazianzo. Verificar se a que o embate ocorrido entre Gregório Nazianzeno e Juliano foi político-religioso e, não somente religioso, pois nesse momento do século IV d. C. não havia separação dessas esferas. O texto está dividido em Considerações Preliminares, onde disserto que o conflito entre os dois autores é político-cultural; O Imperador Juliano e a Historiografia sobre seu Tempo, no qual demonstro que desde o próprio período do Imperador Juliano há uma construção mítica em torno de sua pessoa e, finalmente, sobre o propósito de Nazianzo em escreverContra Juliano. Todos esses pontos interligados levam à compreensão deste momento político específico da Antiguidade Tardia.In this article, I propose to appraise Emperor Julian’s conception of Paideiaor education. To this end, I will work from the meanings of theChristian Logos and the Greek Logos making use also of Gregory Nazianzen’s Against Julian, verifying whether the clash that occurred between Gregory Nazianzen and Julian was not only religious but politico-religious, taking into account that at that point of the 4th century AD no separation of these spheres had yet existed. The text is divided into Preliminary Considerations, where I argue that the conflict between the two authors is political-cultural; The Emperor Julian and the Historiography about his times, in which I demonstrate that since the Emperor Julian’s own time there was a myth built around him, and finally about Nazianzen’s purpose of writing Against Julian. All of these interlinked points lead to the comprehension of this specific political moment of Late Antiquity.

Rezension zu: Juliane Witzke: Paratext Literaturkritik Markt. Inszenierungspraktiken der Gegenwart am Beispiel Judith Hermanns. Würzburg: Verlag Königshausen & Neumann 2017.

Directory of Open Access Journals (Sweden)

Sandra Folie

2017-06-01

Full Text Available Juliane Witzke untersucht am Beispiel von Judith Hermanns Œuvre (1998–2014 die paratextuellen Inszenierungsstrategien der Gegenwart. Ihre Monographie schließt nicht nur eine Forschungslücke im Hinblick auf die wissenschaftliche Auseinandersetzung mit der Autorin, sondern bereichert auch die methodologische Fachdiskussion innerhalb der Literaturwissenschaften; ihr Analyseinstrumentarium ist vielseitig einsetzbar. Eine besondere Stärke der Untersuchung stellt zudem die umfassende Berücksichtigung medialer Veränderungen (z. B. Leser_innen als Kritiker_innen dar. Die immer wieder angesprochenen Genderaspekte – insbesondere die Interpretation von Hermanns gewandelter Strategie als erfolgreiche Inszenierung von ‚Natürlichkeit‘ – hätten stellenweise einer eingehenderen gendertheoretischen Reflexion bedurft.

Mapping resistance to the Ug99 race group of the stem rust pathogen in a spring wheat landrace.

Science.gov (United States)

Babiker, E M; Gordon, T C; Chao, S; Newcomb, M; Rouse, M N; Jin, Y; Wanyera, R; Acevedo, M; Brown-Guedira, G; Williamson, S; Bonman, J M

2015-04-01

A new gene for Ug99 resistance from wheat landrace PI 374670 was detected on the long arm of chromosome 7A. Wheat landrace PI 374670 has seedling and field resistance to stem rust caused by Puccinia graminis f. sp tritici Eriks. & E. Henn (Pgt) race TTKSK. To elucidate the inheritance of resistance, 216 BC1F2 families, 192 double haploid (DH) lines, and 185 recombinant inbred lines (RILs) were developed by crossing PI 374670 and the susceptible line LMPG-6. The parents and progeny were evaluated for seedling resistance to Pgt races TTKSK, MCCFC, and TPMKC. The DH lines were tested in field stem rust nurseries in Kenya and Ethiopia. The DH lines were genotyped with the 90K wheat iSelect SNP genotyping platform. Goodness-of-fit tests indicated that a single dominant gene in PI 374670 conditioned seedling resistance to the three Pgt races. The seedling resistance locus mapped to the long arm of chromosome 7A and this result was verified in the RIL population screened with the flanking SNP markers using KASP assays. In the same region, a major QTL for field resistance was detected in a 7.7 cM interval and explained 34-54 and 29-36% of the variation in Kenya and Ethiopia, respectively. Results from tests with specific Pgt races and the csIH81 marker showed that the resistance was not due to Sr22. Thus, a new stem rust resistance gene or allele, either closely linked or allelic to Sr15, is responsible for the seedling and field resistance of PI 374670 to Ug99.

Low and high frequency Madden-Julian oscillations in austral summer: interannual variations

Energy Technology Data Exchange (ETDEWEB)

Izumo, Takeshi [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); LOCEAN, IRD-CNRS-UPMC, Paris (France); Masson, Sebastien; Vialard, Jerome; Madec, Gurvan [LOCEAN, IRD-CNRS-UPMC, Paris (France); Boyer Montegut, Clement de [IFREMER, Brest (France); Behera, Swadhin K. [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); Takahashi, Keiko [Earth Simulator Center (JAMSTEC), Yokohama (Japan); Yamagata, Toshio [Research Institute For Global Change (JAMSTEC), Yokohama (Japan); University of Tokyo, Tokyo (Japan)

2010-09-15

The Madden-Julian oscillation (MJO) is the main component of intraseasonal variability of the tropical convection, with clear climatic impacts at an almost-global scale. Based on satellite observations, it is shown that there are two types of austral-summer MJO events (broadly defined as 30-120 days convective variability with eastward propagation of about 5 m/s). Equatorial MJO events have a period of 30-50 days and tend to be symmetric about the equator, whereas MJO events centered near 8 S tend to have a longer period of 55-100 days. The lower-frequency variability is associated with a strong upper-ocean response, having a clear signature in both sea surface temperature and its diurnal cycle. These two MJO types have different interannual variations, and are modulated by the Indian Ocean Dipole (IOD). Following a negative IOD event, the lower-frequency southern MJO variability increases, while the higher-frequency equatorial MJO strongly diminishes. We propose two possible explanations for this change in properties of the MJO. One possibility is that changes in the background atmospheric circulation after an IOD favour the development of the low-frequency MJO. The other possibility is that the shallower thermocline ridge and mixed layer depth, by enhancing SST intraseasonal variability and thus ocean-atmosphere coupling in the southwest Indian Ocean (the breeding ground of southern MJO onset), favour the lower-frequency southern MJO variability. (orig.)

The boreal winter Madden-Julian Oscillation's influence on summertime precipitation in the greater Caribbean

Science.gov (United States)

Curtis, Scott; Gamble, Douglas W.

2016-07-01

Precipitation totals in the greater Caribbean are known to be affected by interannual variability. In particular, dry conditions in the spring-summer have been physically linked to the positive phase of North Atlantic Oscillation (NAO) in the literature. In this study, it was found through regression analysis that an active Madden-Julian Oscillation (MJO) in winter geographically focused over the Maritime Continent contributes to a positive NAO in March via the generation of Rossby waves in the Northern Hemisphere. Specifically, a negative Pacific-North American pattern develops in the winter and transitions to an Atlantic pattern in spring. The positive NAO is a transient feature of this evolving wave train, but a center of significant positive 200 hPa geopotential heights is entrenched over the southeast U.S. throughout the February to May time period and is manifested as high pressure at the surface. The southern flank of this system increases the speeds of the trade winds and leads to a cooling of the Caribbean sea surface temperatures and, thus, convection suppression and reduced precipitation. Thus, this study advances our understanding of the climate of the greater Caribbean by using climate teleconnections to relate the MJO to rainfall in the region.

Atmospheric study of the impact of Borneo vortex and Madden-Julian oscillation over Western Indonesian maritime area

Science.gov (United States)

Saragih, R. M.; Fajarianti, R.; Winarso, P. A.

2018-03-01

During the Asian winter Monsoon (November-March), the Indonesia Maritime Continent is an area of deep convection. In that period, there is a synoptic scale disturbance over Northwest of Borneo Island called Borneo vortex. In addition to the impact of Asian Winter Monsoon, Madden-Julian Oscillation (MJO) also have an impact on deep convection during an active period. This study aims to study the impact of interaction Borneo vortex and MJO (during MJO active period in phase 3, 4 and 5) and rainfall condition over the western part of Indonesia Maritime Continent using compositing technique in the period of November-March 2015/2016. The parameters used to identify the incidence of Borneo vortex, MJO, and its interaction is vertical velocity. When MJO is active, Borneo vortex occurs most often in phase 5 and at least in phase 3. However, Borneo vortex occurs most often when the MJO is inactive. The interaction between Borneo vortex and MJO seems may affect not so much rainfall occurrence in the western part of IMC.

Identifying a key physical factor sensitive to the performance of Madden-Julian oscillation simulation in climate models

Science.gov (United States)

Kim, Go-Un; Seo, Kyong-Hwan

2018-01-01

A key physical factor in regulating the performance of Madden-Julian oscillation (MJO) simulation is examined by using 26 climate model simulations from the World Meteorological Organization's Working Group for Numerical Experimentation/Global Energy and Water Cycle Experiment Atmospheric System Study (WGNE and MJO-Task Force/GASS) global model comparison project. For this, intraseasonal moisture budget equation is analyzed and a simple, efficient physical quantity is developed. The result shows that MJO skill is most sensitive to vertically integrated intraseasonal zonal wind convergence (ZC). In particular, a specific threshold value of the strength of the ZC can be used as distinguishing between good and poor models. An additional finding is that good models exhibit the correct simultaneous convection and large-scale circulation phase relationship. In poor models, however, the peak circulation response appears 3 days after peak rainfall, suggesting unfavorable coupling between convection and circulation. For an improving simulation of the MJO in climate models, we propose that this delay of circulation in response to convection needs to be corrected in the cumulus parameterization scheme.

The role of unattended ground sensors (UGS) in regional confidence building and arms control

Energy Technology Data Exchange (ETDEWEB)

Vannoni, M.; Duggan, R.

1997-03-01

Although the Cold War has ended, the world has not become more peaceful. Without the stability provided by an international system dominated by two super-powers, local conflicts are more likely to escalate. Agreements to counter destabilizing pressures in regional conflicts can benefit from the use of cooperative monitoring. Cooperative monitoring is the collecting, analyzing, and sharing of information among parties to an agreement. Ground sensor technologies can contribute to the collection of relevant information. If implemented with consideration for local conditions, cooperative monitoring can build confidence, strengthen existing agreements, and set the stage for continued progress. This presentation describes two examples: the Israeli-Egyptian Sinai agreements of the 1970s and a conceptual example for the contemporary Korean Peninsula. The Sinai was a precedent for the successful use of UGS within the context of cooperative monitoring. The Korean Peninsula is the world`s largest military confrontation. Future confidence building measures that address the security needs of both countries could decrease the danger of conflict and help create an environment for a peace agreement.

Essential-Oil Variability in Natural Populations of Pinus mugo Turra from the Julian Alps.

Science.gov (United States)

Bojović, Srdjan; Jurc, Maja; Ristić, Mihailo; Popović, Zorica; Matić, Rada; Vidaković, Vera; Stefanović, Milena; Jurc, Dušan

2016-02-01

The composition and variability of the terpenes and their derivatives isolated from the needles of a representative pool of 114 adult trees originating from four natural populations of dwarf mountain pine (Pinus mugo Turra) from the Julian Alps were investigated by GC-FID and GC/MS analyses. In total, 54 of the 57 detected essential-oil components were identified. Among the different compound classes present in the essential oils, the chief constituents belonged to the monoterpenes, comprising an average content of 79.67% of the total oil composition (74.80% of monoterpene hydrocarbons and 4.87% of oxygenated monoterpenes). Sesquiterpenes were present in smaller amounts (average content of 19.02%), out of which 16.39% were sesquiterpene hydrocarbons and 2.62% oxygenated sesquiterpenes. The most abundant components in the needle essential oils were the monoterpenes δ-car-3-ene, β-phellandrene, α-pinene, β-myrcene, and β-pinene and the sesquiterpene β-caryophyllene. From the total data set of 57 detected compounds, 40 were selected for principal-component analysis (PCA), discriminant analysis (DA), and cluster analysis (CA). The overlap tendency of the four populations suggested by PCA, was as well observed by DA. CA also demonstrated similarity among the populations, which was the highest between Populations I and II. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

Major, trace and rate earth elements in sediments of the Julian Adame-Alatorre dam by instrumental neutron activation analysis

International Nuclear Information System (INIS)

Mireles, F.; Pinedo, J. L.; Davila, J. I.; Oliva, J. E.; Speakman, R. J.; Glascock, M. D.

2010-10-01

The rapid industrial development in regions of Mexico during recent years has had the side effect of introducing toxic metals, fertilizers, and pesticides into the ecosystem. Sediment cores were collected from eight locations around the Julian Adame-Alatorre dam located in Municipality of Villanueva in the Zacatecas State, Mexico. The cores were analyzed for 32 major, trace, and rare earth elements (As, La, Lu, Nd, Sm, U, Yb, Ce, Co, Cr, Cs, Eu, Fe, Hf, Rb, Sb, Sc, Sr, Ta, Tb, Th, Zn, Zr, Al, Ba, Ca, Dy, K, Mn, Na, Ti, V) in order to estimate the health risk. The samples were analyzed by instrument neutron activation analysis using thermal neutron fluxes of 8 x 10 13 and 5 x 10 13 n cm -2 s -1 for short and long irradiations, respectively. The results of the contamination levels for elements such as As, Ba, Cr, Fe, Mn, Ta, V, and Zn were compared with the Mexican regulations and the guidelines of US EPA. (Author)

A novel Robertsonian translocation event leads to transfer of a stem rust resistance gene (Sr52) effective against race Ug99 from Dasypyrum villosum into bread wheat.

Science.gov (United States)

Qi, L L; Pumphrey, M O; Friebe, Bernd; Zhang, P; Qian, C; Bowden, R L; Rouse, M N; Jin, Y; Gill, B S

2011-06-01

Stem rust (Puccinia graminis f. sp. tritici Eriks. & E. Henn.) (the causal agent of wheat stem rust) race Ug99 (also designated TTKSK) and its derivatives have defeated several important stem rust resistance genes widely used in wheat (Triticum aestivum L.) production, rendering much of the worldwide wheat acreage susceptible. In order to identify new resistance sources, a large collection of wheat relatives and genetic stocks maintained at the Wheat Genetic and Genomic Resources Center was screened. The results revealed that most accessions of the diploid relative Dasypyrum villosum (L.) Candargy were highly resistant. The screening of a set of wheat-D. villosum chromosome addition lines revealed that the wheat-D. villosum disomic addition line DA6V#3 was moderately resistant to race Ug99. The objective of the present study was to produce and characterize compensating wheat-D. villosum whole arm Robertsonian translocations (RobTs) involving chromosomes 6D of wheat and 6V#3 of D. villosum through the mechanism of centric breakage-fusion. Seven 6V#3-specific EST-STS markers were developed for screening F(2) progeny derived from plants double-monosomic for chromosomes 6D and 6V#3. Surprisingly, although 6D was the target chromosome, all recovered RobTs involved chromosome 6A implying a novel mechanism for the origin of RobTs. Homozygous translocations (T6AS·6V#3L and T6AL·6V#3S) with good plant vigor and full fertility were selected from F(3) families. A stem rust resistance gene was mapped to the long arm 6V#3L in T6AS·6V#3L and was designated as Sr52. Sr52 is temperature-sensitive and is most effective at 16°C, partially effective at 24°C, and ineffective at 28°C. The T6AS·6V#3L stock is a new source of resistance to Ug99, is cytogenetically stable, and may be useful in wheat improvement.

Optimal Initial Perturbations for Ensemble Prediction of the Madden-Julian Oscillation during Boreal Winter

Science.gov (United States)

Ham, Yoo-Geun; Schubert, Siegfried; Chang, Yehui

2012-01-01

An initialization strategy, tailored to the prediction of the Madden-Julian oscillation (MJO), is evaluated using the Goddard Earth Observing System Model, version 5 (GEOS-5), coupled general circulation model (CGCM). The approach is based on the empirical singular vectors (ESVs) of a reduced-space statistically determined linear approximation of the full nonlinear CGCM. The initial ESV, extracted using 10 years (1990-99) of boreal winter hindcast data, has zonal wind anomalies over the western Indian Ocean, while the final ESV (at a forecast lead time of 10 days) reflects a propagation of the zonal wind anomalies to the east over the Maritime Continent an evolution that is characteristic of the MJO. A new set of ensemble hindcasts are produced for the boreal winter season from 1990 to 1999 in which the leading ESV provides the initial perturbations. The results are compared with those from a set of control hindcasts generated using random perturbations. It is shown that the ESV-based predictions have a systematically higher bivariate correlation skill in predicting the MJO compared to those using the random perturbations. Furthermore, the improvement in the skill depends on the phase of the MJO. The ESV is particularly effective in increasing the forecast skill during those phases of the MJO in which the control has low skill (with correlations increasing by as much as 0.2 at 20 25-day lead times), as well as during those times in which the MJO is weak.

Role of Longwave Cloud-Radiation Feedback in the Simulation of the Madden-Julian Oscillation

Science.gov (United States)

Kim, Daehyun; Ahn, Min-Seop; Kang, In-Sik; Del Genio, Anthony D.

2015-01-01

The role of the cloud-radiation interaction in the simulation of the Madden-Julian oscillation (MJO) is investigated. A special focus is on the enhancement of column-integrated diabatic heating due to the greenhouse effects of clouds and moisture in the region of anomalous convection. The degree of this enhancement, the greenhouse enhancement factor (GEF), is measured at different precipitation anomaly regimes as the negative ratio of anomalous outgoing longwave radiation to anomalous precipitation. Observations show that the GEF varies significantly with precipitation anomaly and with the MJO cycle. The greenhouse enhancement is greater in weak precipitation anomaly regimes and its effectiveness decreases monotonically with increasing precipitation anomaly. The GEF also amplifies locally when convection is strengthened in association with the MJO, especially in the weak precipitation anomaly regime (less than 5 mm day(exp -1)). A robust statistical relationship is found among CMIP5 climate model simulations between the GEF and the MJO simulation fidelity. Models that simulate a stronger MJO also simulate a greater GEF, especially in the weak precipitation anomaly regime (less than 5 mm day(exp -1)). Models with a greater GEF in the strong precipitation anomaly regime (greater than 30 mm day(-1)) represent a slightly slower MJO propagation speed. Many models that lack the MJO underestimate the GEF in general and in particular in the weak precipitation anomaly regime. The results herein highlight that the cloud-radiation interaction is a crucial process for climate models to correctly represent the MJO.

Major, trace and rate earth elements in sediments of the Julian Adame-Alatorre dam by instrumental neutron activation analysis

Energy Technology Data Exchange (ETDEWEB)

Mireles, F.; Pinedo, J. L.; Davila, J. I.; Oliva, J. E. [Universidad Autonoma de Zacatecas, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Speakman, R. J. [Museum Conservation Institute, Smithsonian Institution, Suitland, MD 20746 (United States); Glascock, M. D., E-mail: fmireles@uaz.edu.m [Research Reactor Center, University of Missouri, Columbia, MO 65211 (United States)

2010-10-15

The rapid industrial development in regions of Mexico during recent years has had the side effect of introducing toxic metals, fertilizers, and pesticides into the ecosystem. Sediment cores were collected from eight locations around the Julian Adame-Alatorre dam located in Municipality of Villanueva in the Zacatecas State, Mexico. The cores were analyzed for 32 major, trace, and rare earth elements (As, La, Lu, Nd, Sm, U, Yb, Ce, Co, Cr, Cs, Eu, Fe, Hf, Rb, Sb, Sc, Sr, Ta, Tb, Th, Zn, Zr, Al, Ba, Ca, Dy, K, Mn, Na, Ti, V) in order to estimate the health risk. The samples were analyzed by instrument neutron activation analysis using thermal neutron fluxes of 8 x 10{sup 13} and 5 x 10{sup 13} n cm{sup -2} s{sup -1} for short and long irradiations, respectively. The results of the contamination levels for elements such as As, Ba, Cr, Fe, Mn, Ta, V, and Zn were compared with the Mexican regulations and the guidelines of US EPA. (Author)

Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

Directory of Open Access Journals (Sweden)

Teresa Kiziukiewicz

2009-03-01

Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

Intraseasonal interaction between the Madden-Julian Oscillation and the North Atlantic Oscillation.

Science.gov (United States)

Cassou, Christophe

2008-09-25

Bridging the traditional gap between the spatio-temporal scales of weather and climate is a significant challenge facing the atmospheric community. In particular, progress in both medium-range and seasonal-to-interannual climate prediction relies on our understanding of recurrent weather patterns and the identification of specific causes responsible for their favoured occurrence, persistence or transition. Within this framework, I here present evidence that the main climate intra-seasonal oscillation in the tropics-the Madden-Julian Oscillation (MJO)-controls part of the distribution and sequences of the four daily weather regimes defined over the North Atlantic-European region in winter. North Atlantic Oscillation (NAO) regimes are the most affected, allowing for medium-range predictability of their phase far exceeding the limit of around one week that is usually quoted. The tropical-extratropical lagged relationship is asymmetrical. Positive NAO events mostly respond to a mid-latitude low-frequency wave train initiated by the MJO in the western-central tropical Pacific and propagating eastwards. Precursors for negative NAO events are found in the eastern tropical Pacific-western Atlantic, leading to changes along the North Atlantic storm track. Wave-breaking diagnostics tend to support the MJO preconditioning and the role of transient eddies in setting the phase of the NAO. I present a simple statistical model to quantitatively assess the potential predictability of the daily NAO index or the sign of the NAO regimes when they occur. Forecasts are successful in approximately 70 per cent of the cases based on the knowledge of the previous approximately 12-day MJO phase used as a predictor. This promising skill could be of importance considering the tight link between weather regimes and both mean conditions and the chances of extreme events occurring over Europe. These findings are useful for further stressing the need to better simulate and forecast the tropical

Thermodynamics in the Suppressed Phase of the Madden-Julian Oscillation Using a Multiplatform Strategy

Science.gov (United States)

Roberts, J. Brent; Robertson, Franklin R.; Clayson, Carol Anne; Taylor, Patrick

2014-01-01

The Madden-Julian Oscillation (MJO) represents a prominent mode of intraseasonal tropical variability. It is manifest by coherent large-scale changes in atmospheric circulation, convection, and thermodynamic processes. Preconditioning of the environment prior to the active phase of the MJO has been noted, but the balance of theorized mechanisms to accomplish this process remains unresolved. Further, there is a lack of consensus on the means by which primary initiation of an MJO event occurs. Observational and modeling efforts have recently been undertaken to advance our understanding of the physical underpinnings governing MJO development. However these intensive studies are often limited in space and/or time and are potentially subject to model deficiencies. Satellite observations, especially those providing vertical resolution of temperature and moisture, provide an opportunity to expand our knowledge of processes critical to MJO initiation and preconditioning. This work will provide an analysis of suppressed phase thermodynamics with an emphasis on the use of a complementary suite of satellite observations including AIRS/AMSU-A profiles, CERES radiative fluxes, and cloud properties observed by MODIS. Emphasis of this work will regard the distribution of cloud regimes, their radiative-convective effects, and their relationship to moist static energy during the recharge and suppressed stages of MJO initiation and eastward propagation. The analyses will make use of cloud regimes from MODIS observations to provide a compositing technique that enables the identification of systematic connections between different cloud regimes and the larger scale environment. Within these cloud regimes, the relationship between the associated cloud-radiative effects observed by CERES, vertically-resolved and vertically-integrated thermodynamics using AIRS/AMSU-A observations, and atmospheric boundary layer fluxes will be demonstrated.

Enhancement of vegetation-rainfall feedbacks on the Australian summer monsoon by the Madden-Julian Oscillation

Science.gov (United States)

Notaro, Michael

2018-01-01

A regional climate modeling analysis of the Australian monsoon system reveals a substantial modulation of vegetation-rainfall feedbacks by the Madden Julian Oscillation (MJO), both of which operate at similar sub-seasonal time scales, as evidence that the intensity of land-atmosphere interactions is sensitive to the background atmospheric state. Based on ensemble experiments with imposed modification of northern Australian leaf area index (LAI), the atmospheric responses to LAI anomalies are composited for negative and positive modes of the propagating MJO. In the regional climate model (RCM), northern Australian vegetation feedbacks are characterized by evapotranspiration (ET)-driven rainfall responses, with the moisture feedback mechanism dominating over albedo and roughness feedback mechanisms. During November-April, both Tropical Rainfall Measuring Mission and RCM data reveal MJO's pronounced influence on rainfall patterns across northern Australia, tropical Indian Ocean, Timor Sea, Arafura Sea, and Gulf of Carpentaria, with the MJO dominating over vegetation feedbacks in terms of regulating monsoon rainfall variability. Convectively-active MJO phases support an enhancement of positive vegetation feedbacks on monsoon rainfall. While the MJO imposes minimal regulation of ET responses to LAI anomalies, the vegetation feedback-induced responses in precipitable water, cloud water, and rainfall are greatly enhanced during convectively-active MJO phases over northern Australia, which are characterized by intense low-level convergence and efficient precipitable water conversion. The sub-seasonal response of vegetation-rainfall feedback intensity to the MJO is complex, with significant enhancement of rainfall responses to LAI anomalies in February during convectively-active MJO phases compared to minimal modulation by the MJO during prior and subsequent calendar months.

Impact of Madden–Julian Oscillation upon Winter Extreme Rainfall in Southern China: Observations and Predictability in CFSv2

Directory of Open Access Journals (Sweden)

Hong-Li Ren

2017-09-01

Full Text Available The impact of Madden–Julian oscillation (MJO upon extreme rainfall in southern China was studied using the Real-time Multivariate MJO (RMM index and daily precipitation data from high-resolution stations in China. The probability-distribution function (PDF of November–March rainfall in southern China was found to be skewed toward larger (smaller values in phases 2–3 (6–7 of MJO, during which the probability of extreme rainfall events increased (reduced by 30–50% (20–40% relative to all days in the same season. Physical analysis indicated that the favorable conditions for generating extreme rainfall are associated with southwesterly moisture convergence and vertical moisture advection over southern China, while the direct contributions from horizontal moisture advection are insignificant. Based on the above results, the model-based predictability for extreme rainfall in winter was examined using hindcasts from the Climate Forecast System version 2 (CFSv2 of NOAA. It is shown that the modulations of MJO on extreme rainfall are captured and forecasted well by CFSv2, despite the existence of a relatively small bias. This study suggests the feasibility of deriving probabilistic forecasts of extreme rainfall in southern China based on RMM indices.

Molecular Cytogenetic Characterization of two Triticum–Secale–Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99

Directory of Open Access Journals (Sweden)

Yi Dai

2017-05-01

Full Text Available Fusarium head blight (FHB, leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host Dewey (2n = 2x = 14, EE is an excellent source of disease resistance genes. Two new Triticum–Secale–Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2n = 6x = 42, AABBRR and a hexaploid Triticum trititrigia (2n = 6x = 42, AABBEE, were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R, and four pairs of E-chromosomes (1E, 2E, 3E, and 5E for a total chromosome number of 2n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62 display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

Molecular Cytogenetic Characterization of two Triticum-Secale-Thinopyrum Trigeneric Hybrids Exhibiting Superior Resistance to Fusarium Head Blight, Leaf Rust, and Stem Rust Race Ug99.

Science.gov (United States)

Dai, Yi; Duan, Yamei; Liu, Huiping; Chi, Dawn; Cao, Wenguang; Xue, Allen; Gao, Yong; Fedak, George; Chen, Jianmin

2017-01-01

Fusarium head blight (FHB), leaf rust, and stem rust are the most destructive fungal diseases in current world wheat production. The diploid wheatgrass, Thinopyrum elongatum (Host) Dewey (2 n = 2 x = 14, EE) is an excellent source of disease resistance genes. Two new Triticum-Secale-Thinopyrum trigeneric hybrids were derived from a cross between a hexaploid triticale (X Triticosecale Wittmack, 2 n = 6 x = 42, AABBRR) and a hexaploid Triticum trititrigia (2 n = 6 x = 42, AABBEE), were produced and analyzed using genomic in situ hybridization and molecular markers. The results indicated that line RE21 contained 14 A-chromosomes, 14 B-chromosomes, three pairs of R-chromosomes (4R, 6R, and 7R), and four pairs of E-chromosomes (1E, 2E, 3E, and 5E) for a total chromosome number of 2 n = 42. Line RE62 contained 14 A-chromosomes, 14 B-chromosomes, six pairs of R-chromosomes, and one pair of translocation chromosomes between chromosome 5R and 5E, for a total chromosome number of 2 n = 42. At the seedling and adult growth stages under greenhouse conditions, line RE21 showed high levels of resistance to FHB, leaf rust, and stem rust race Ug99, and line RE62 was highly resistant to leaf rust and stem rust race Ug99. These two lines (RE21 and RE62) display superior disease resistance characteristics and have the potential to be utilized as valuable germplasm sources for future wheat improvement.

Simulations of the Madden-Julian oscillation in four pairs of coupled and uncoupled global models

Energy Technology Data Exchange (ETDEWEB)

Zhang, Chidong; Dong, Min [RSMAS, University of Miami, Miami, FL (United States); Gualdi, Silvio [National Institute of Geophysics and Volcanology, Bologna (Italy); Hendon, Harry H. [BMRC, Melbourne, VIC (Australia); Maloney, Eric D. [Oregon State University, Corvallis, OR (United States); Marshall, Andrew [Monash University, Melbourne, VIC (Australia); Sperber, Kenneth R. [PCMDI, Lawrence Livermore National Laboratory, Livermore, CA (United States); Wang, Wanqiu [CPC/NCEP/NOAA, Camp Springs, MD (United States)

2006-11-15

The status of the numerical reproduction of the Madden-Julian Oscillation (MJO) by current global models was assessed through diagnoses of four pairs of coupled and uncoupled simulations. Slow eastward propagation of the MJO, especially in low-level zonal wind, is realistic in all these simulations. However, the simulated MJO suffers from several common problems. The MJO signal in precipitation is generally too weak and often eroded by an unrealistic split of an equatorial maximum of precipitation into a double ITCZ structure over the western Pacific. The MJO signal in low-level zonal wind, on the other hand, is sometimes too strong over the eastern Pacific but too weak over the Indian Ocean. The observed phase relationship between precipitation and low-level zonal wind associated with the MJO in the western Pacific and their coherence in general are not reproduced by the models. The seasonal migration in latitude of MJO activity is missing in most simulations. Air-sea coupling generally strengthens the simulated eastward propagating signal, but its effects on the phase relationship and coherence between precipitation and low-level zonal wind, and on their geographic distributions, seasonal cycles, and interannual variability are inconsistent among the simulations. Such inconsistency cautions generalization of results from MJO simulations using a single model. In comparison to observations, biases in the simulated MJO appear to be related to biases in the background state of mean precipitation, low-level zonal wind, and boundary-layer moisture convergence. This study concludes that, while the realistic simulations of the eastward propagation of the MJO are encouraging, reproducing other fundamental features of the MJO by current global models remains an unmet challenge. (orig.)

Identification and mapping of Sr46 from Aegilops tauschii accession CIae 25 conferring resistance to race TTKSK (Ug99) of wheat stem rust pathogen.

Science.gov (United States)

Yu, Guotai; Zhang, Qijun; Friesen, Timothy L; Rouse, Matthew N; Jin, Yue; Zhong, Shaobin; Rasmussen, Jack B; Lagudah, Evans S; Xu, Steven S

2015-03-01

Mapping studies confirm that resistance to Ug99 race of stem rust pathogen in Aegilops tauschii accession Clae 25 is conditioned by Sr46 and markers linked to the gene were developed for marker-assisted selection. The race TTKSK (Ug99) of Puccinia graminis f. sp. tritici, the causal pathogen for wheat stem rust, is considered as a major threat to global wheat production. To address this threat, researchers across the world have been devoted to identifying TTKSK-resistant genes. Here, we report the identification and mapping of a stem rust resistance gene in Aegilops tauschii accession CIae 25 that confers resistance to TTKSK and the development of molecular markers for the gene. An F2 population of 710 plants from an Ae. tauschii cross CIae 25 × AL8/78 were first evaluated against race TPMKC. A set of 14 resistant and 116 susceptible F2:3 families from the F2 plants were then evaluated for their reactions to TTKSK. Based on the tests, 179 homozygous susceptible F2 plants were selected as the mapping population to identify the simple sequence repeat (SSR) and sequence tagged site (STS) markers linked to the gene by bulk segregant analysis. A dominant stem rust resistance gene was identified and mapped with 16 SSR and five new STS markers to the deletion bin 2DS5-0.47-1.00 of chromosome arm 2DS in which Sr46 was located. Molecular marker and stem rust tests on CIae 25 and two Ae. tauschii accessions carrying Sr46 confirmed that the gene in CIae 25 is Sr46. This study also demonstrated that Sr46 is temperature-sensitive being less effective at low temperatures. The marker validation indicated that two closely linked markers Xgwm210 and Xwmc111 can be used for marker-assisted selection of Sr46 in wheat breeding programs.

Playing with Quantum Toys: Julian Schwinger's Measurement Algebra and the Material Culture of Quantum Mechanics Pedagogy at Harvard in the 1960s

Science.gov (United States)

Gauvin, Jean-François

2018-03-01

In the early 1960s, a PhD student in physics, Costas Papaliolios, designed a simple—and playful—system of Polaroid polarizer filters with a specific goal in mind: explaining the core principles behind Julian Schwinger's quantum mechanical measurement algebra, developed at Harvard in the late 1940s and based on the Stern-Gerlach experiment confirming the quantization of electron spin. Papaliolios dubbed his invention "quantum toys." This article looks at the origins and function of this amusing pedagogical device, which landed half a century later in the Collection of Historical Scientific Instruments at Harvard University. Rendering the abstract tangible was one of Papaliolios's demonstration tactics in reforming basic teaching of quantum mechanics. This article contends that Papaliolios's motivation in creating the quantum toys came from a renowned endeavor aimed, inter alia, at reforming high-school physics training in the United States: Harvard Project Physics. The pedagogical study of these quantum toys, finally, compels us to revisit the central role playful discovery performs in pedagogy, at all levels of training and in all fields of knowledge.

Op-Ug TD Optimizer Tool Based on Matlab Code to Find Transition Depth From Open Pit to Block Caving / Narzędzie Optymalizacyjne Oparte O Kod Matlab Wykorzystane Do Określania Głębokości Przejściowej Od Wydobycia Odkrywkowego Do Wybierania Komorami

Science.gov (United States)

Bakhtavar, E.

2015-09-01

In this study, transition from open pit to block caving has been considered as a challenging problem. For this purpose, the linear integer programing code of Matlab was initially developed on the basis of the binary integer model proposed by Bakhtavar et al (2012). Then a program based on graphical user interface (GUI) was set up and named "Op-Ug TD Optimizer". It is a beneficial tool for simple application of the model in all situations where open pit is considered together with block caving method for mining an ore deposit. Finally, Op-Ug TD Optimizer has been explained step by step through solving the transition from open pit to block caving problem of a case ore deposit. W pracy tej rozważano skomplikowane zagadnienie przejścia od wybierania odkrywkowego do komorowego. W tym celu opracowano kod programowania liniowego w środowisku MATLAB w oparciu o model liczb binarnych zaproponowany przez Bakhtavara (2012). Następnie opracowano program z wykorzystujący graficzny interfejs użytkownika o nazwie Optymalizator Op-Ug TD. Jest to niezwykle cenne narzędzie umożliwiające stosowanie modelu dla wszystkich warunków w sytuacjach gdy rozważamy prowadzenie wydobycia metodą odkrywkową oraz wydobycie komorowe przy eksploatacji złóż rud żelaza. W końcowej części pracy podano szczegółową instrukcję stosowanie programu Optymalizator na przedstawionym przykładzie przejścia od wydobycia rud żelaza metodami odkrywkowymi poprzez wydobycie komorami.

The Madden-Julian oscillation in ECHAM4 coupled and uncoupled general circulation models

Energy Technology Data Exchange (ETDEWEB)

Sperber, Kenneth R. [Lawrence Livermore National Laboratory, Program for Climate Model Diagnosis and Intercomparison, Livermore, CA (United States); Gualdi, Silvio [National Institute of Geophysics and Volcanology, Bologna (Italy); Legutke, Stephanie; Gayler, Veronika [Max Planck Institute of Meteorology, Models and Data Group, Hamburg (Germany)

2005-08-01

The Madden-Julian oscillation (MJO) dominates tropical variability on timescales of 30-70 days. During the boreal winter/spring, it is manifested as an eastward propagating disturbance, with a strong convective signature over the eastern hemisphere. The space-time structure of the MJO is analyzed using simulations with the ECHAM4 atmospheric general circulation model run with observed monthly mean sea-surface temperatures (SSTs), and coupled to three different ocean models. The coherence of the eastward propagation of MJO convection is sensitive to the ocean model to which ECHAM4 is coupled. For ECHAM4/OPYC and ECHO-G, models for which 100 years of daily data is available, Monte Carlo sampling indicates that their metrics of eastward propagation are different at the 1% significance level. The flux-adjusted coupled simulations, ECHAM4/OPYC and ECHO-G, maintain a more realistic mean-state, and have a more realistic MJO simulation than the nonadjusted scale interaction experiment (SINTEX) coupled runs. The SINTEX model exhibits a cold bias in Indian Ocean and tropical West Pacific Ocean sea-surface temperature of 0.5 C. This cold bias affects the distribution of time-mean convection over the tropical eastern hemisphere. Furthermore, the eastward propagation of MJO convection in this model is not as coherent as in the two models that used flux adjustment or when compared to an integration of ECHAM4 with prescribed observed SST. This result suggests that simulating a realistic basic state is at least as important as air-sea interaction for organizing the MJO. While all of the coupled models simulate the warm (cold) SST anomalies that precede (succeed) the MJO convection, the interaction of the components of the net surface heat flux that lead to these anomalies are different over the Indian Ocean. The ECHAM4/OPYC model in which the atmospheric model is run at a horizontal resolution of T42, has eastward propagating zonal wind anomalies and latent heat flux anomalies

Overview of Proposal on High Resolution Climate Model Simulations of Recent Hurricane and Typhoon Activity: The Impact of SSTs and the Madden Julian Oscillation

Science.gov (United States)

Schubert, Siegfried; Kang, In-Sik; Reale, Oreste

2009-01-01

This talk gives an update on the progress and further plans for a coordinated project to carry out and analyze high-resolution simulations of tropical storm activity with a number of state-of-the-art global climate models. Issues addressed include, the mechanisms by which SSTs control tropical storm. activity on inter-annual and longer time scales, the modulation of that activity by the Madden Julian Oscillation on sub-seasonal time scales, as well as the sensitivity of the results to model formulation. The project also encourages companion coarser resolution runs to help assess resolution dependence, and. the ability of the models to capture the large-scale and long-terra changes in the parameters important for hurricane development. Addressing the above science questions is critical to understanding the nature of the variability of the Asian-Australian monsoon and its regional impacts, and thus CLIVAR RAMP fully endorses the proposed tropical storm simulation activity. The project is open to all interested organizations and investigators, and the results from the runs will be shared among the participants, as well as made available to the broader scientific community for analysis.

Effect of high-dose ginsenoside complex (UG0712 supplementation on physical performance of healthy adults during a 12-week supervised exercise program: A randomized placebo-controlled clinical trial

Directory of Open Access Journals (Sweden)

Eon Sook Lee

2018-04-01

Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial

Oil use of the effluent plant ETEO (Effluent Station of Oil Treatment) as combustible for generation of energy in the power plant UG-50Hz; Utulizacao de oleo da ETEO (Estacao de Tratamento de Efluentes Oleosos) para geracao de energia na UG-50Hz

Energy Technology Data Exchange (ETDEWEB)

Souza, Jose Francisco de; Nascimento, Jose Maria do; Silva, Luiz Antonio da; Salazar, Marcos Vinicios; Baptista, Reinaldo Lopes; Barros, Sueli Aguiar [Companhia Siderurgica Nacional (CSN), Volta Redonda, RJ (Brazil)

2009-11-01

The areas of finishing products of CSN Steel Plant generate contaminated effluents with oil and grease , that are treated in ETEO (Effluent Station of Oil Treatment). In this plant, the oil is processed to be sold for the consuming market. However, some seasons of the year, the market does not absorb the oil, and CSN is obliged to defray the burning of this oil, to not interrupt the productive process and cause an environmental impact. Because of this situation, we search alternatives for the viable use of this oil inside CSN steel plant, taking care for the security of the processes and the impact to the environment. This paper describes the details of the work and the implantation of the burning of this oil of the ETEO with BPF oil (type of petrochemical oil) as combustible in the boiler 7 of the power plant UG 50 Hz. For the implantation of this project, operational contingencies of security for equipment was prepared . Moreover, the work included chemical analyses of the oil and the conditions of the boiler using this mixing of oils. The reached results demonstrate the total viability of this project and it was proved another alternative of the use of this residue, with reduction of the fuel costs , steam costs and the electric energy generated in the power plant of CSN. (author)

Variability of oceanic deep convective system vertical structures observed by CloudSat in Indo-Pacific regions associated with the Madden-Julian oscillation

Science.gov (United States)

Yuan, Jian

2016-09-01

Vertical structures of deep convective systems during the Madden-Julian oscillation (MJO) are investigated using CloudSat radar measurements in Indo-Pacific oceanic areas. In active phases of the MJO, relatively more large systems and connected mesoscale convective systems (CMCSs) occur. The occurrence frequency of CMCSs peaks in the onset phase, a phase earlier than separated mesoscale convective systems (SMCSs). Compared with SMCSs, CMCSs of all sizes have weaker reflectivity above 8 km in their deep precipitating portions and thick anvil clouds closely linked to them, suggesting more "stratiform" physics associated with them. SMCSs and CMCSs together produce relatively the least anvil clouds in the onset phase, while their deep precipitating portions show stronger/weaker reflectivity above 8 km before/after the onset phase. Thus, after the onset phase of the MJO, mesoscale convective systems shift toward a more "convective" organization because SMCSs maximize after the onset, while their internal structures appear more stratiform because internally they have weaker reflectivity above 8 km. CMCSs coincide with a more humid middle troposphere spatially, even at the same locations a few days before they occur. Middle-tropospheric moistening peaks in the onset phase. Moistening of the free troposphere around deep convective systems shows relatively stronger moistening/drying below 700 hPa before/after the onset phase than domain-mean averages. Low-topped clouds occur most frequently around CMCSs and in active phases, consistent with the presence of a moister free troposphere. Coexistence of these phenomena suggests that the role of middle troposphere moisture in the formation of CMCSs should be better understood.

Variability of Oceanic Mesoscale Convective System Vertical Structures Observed by CloudSat in Indo-Pacific Regions Associated with the Madden-Julian Oscillation

Science.gov (United States)

Yuan, J.

2016-12-01

Vertical structures of mesoscale convective systems (MCSs) during the Madden-Julian-Oscillation (MJO) are investigated using 2006-2011 CloudSat radar measurements for Indo-Pacific oceanic areas. In active phases of the MJO relatively more large MCSs and connected MCSs occur. The frequency of occurrence of connected MCSs peaks in the onset phase, a phase earlier than separated MCSs. Compared to separated MCSs, connected MCSs in all sizes have weaker reflectivity above 8 km in their deep precipitating portions and thick anvil clouds closely linked to them, suggesting more "stratiform" physics associated with them. Separated MCSs and connected MCSs together produce relatively the least anvil clouds in the onset phase while their deep precipitating portions show stronger/weaker reflectivity above 8 km before/after the onset phase. Thus after the onset phase of the MJO, MCSs shift toward more "convective" organization because separated MCSs maximize after the onset, while their internal structures appear more "stratiform" because internally they have weaker reflectivity above 8km. Connected MCSs coincide with a more humid middle troposphere spatially, even at the same places a few days before they occur. Middle-tropospheric moistening peaks in the onset phase. Moistening of the free troposphere around deep convective systems shows relatively stronger moistening/drying below the 700 hPa before/after the onset phase compared to domain-mean averages. Lower-topped clouds occur most frequently around CMCSs and in active phases, consistent with the presence of a moister free troposphere. Coexistence of these phenomena suggests that the role of middle troposphere moisture in the formation of CMCSs needs to be better understood.

Intraseasonal variability of upper-ocean currents and photosynthetic primary production along the U.S. west coast associated with the Madden-Julian Oscillation

Science.gov (United States)

Barrett, B.; Davies, A. R.; Steppe, C. N.; Hackbarth, C.

2017-12-01

In the first part of this study, time-lagged composites of upper-ocean currents from February to May of 1993-2016 were binned by active phase of the leading atmospheric mode of intraseasonal variability, the Madden-Julian Oscillation (MJO). Seven days after the convectively active phase of the MJO enters the tropical Indian Ocean, anomalously strong south-southeastward upper-ocean currents are observed along the majority of U.S. west coast. Seven days after the convectively active phase enters the tropical western Pacific Ocean, upper-ocean current anomalies reverse along the U.S. west coast, with weaker southward flow. A physical pathway to the ocean was found for both of these: (a) tropical MJO convection modulates upper-tropospheric heights and circulation over the Pacific Ocean; (b) those anomalous atmospheric heights adjust the strength and position of the Aleutian Low and Hawaiian High; (c) surface winds change in response to the adjusted atmospheric pressure patterns; and (d) those surface winds project onto upper-ocean currents. In the second part of this study, we investigated if the MJO modulated intraseasonal variability of surface wind forcing and upper-ocean currents projected onto phytoplankton abundance along the U.S. west coast. Following a similar methodology, time-lagged, level 3 chlorophyll-a satellite products (a proxy for photosynthetic primary production) were binned by active MJO phase and analyzed for statistical significance using the Student's t test. Results suggest that intraseasonal variability of biological production along the U.S. west coast may be linked to the MJO, particularly since the time scale of the life cycle of phytoplankton is similar to the time scale of the MJO.

The Influence of the Madden-Julian Oscillation (mjo) on Extreme Rainfall Over the Central and Southern Peruvian Andes

Science.gov (United States)

Heidinger, H.; Jones, C.; Carvalho, L. V.

2015-12-01

Extreme rainfall is important for the Andean region because of the large contribution of these events to the seasonal totals and consequent impacts on water resources for agriculture, water consumption, industry and hydropower generation, as well as the occurrence of floods and landslides. Over Central and Southern Peruvian Andes (CSPA), rainfall exceeding the 90th percentile contributed between 44 to 100% to the total Nov-Mar 1979-2010 rainfall. Additionally, precipitation from a large majority of stations in the CSPA exhibits statistically significant spectral peaks on intraseasonal time-scales (20 to 70 days). The Madden-Julian Oscillation (MJO) is the most important intraseasonal mode of atmospheric circulation and moist convection in the tropics and the occurrence of extreme weather events worldwide. Mechanisms explaining the relationships between the MJO and precipitation in the Peruvian Andes have not been properly described yet. The present study examines the relationships between the activity and phases of the MJO and the occurrence of extreme rainfall over the CSPA. We found that the frequency of extreme rainfall events increase in the CSPA when the MJO is active. MJO phases 5, 6 and 7 contribute to the overall occurrence of extreme rainfall events over the CSPA. However, how the MJO phases modulate extreme rainfall depends on the location of the stations. For instance, extreme precipitation (above the 90th percentile) in stations in the Amazon basin are slightly more sensitive to phases 2, 3 and 4; the frequency of extremes in stations in the Pacific basin increases in phases 5, 6 and 7 whereas phase 2, 3 and 7 modulates extreme precipitation in stations in the Titicaca basin. Greater variability among stations is observed when using the 95th and 99th percentiles to identify extremes. Among the main mechanisms that explain the increase in extreme rainfall events in the Peruvian Andes is the intensification of the easterly moisture flux anomalies, which

Application of instrumental neutron activation analysis to assess dietary intake of selenium in Korean adults from meat and eggs

International Nuclear Information System (INIS)

Moon, Jong-Hwa; Kim, Sun-Ha; Chung, Yong-Sam; Lee, Ok-Hee

2013-01-01

Selenium is a key constituent of enzyme in glutathione peroxidase, which is effective in decreasing various types of oxidative stress, Thus, the adequacy of selenium intake is very important in decreasing the risks of various degenerating diseases such as cardiovascular disease, or certain cancers. Lately, the intake of animal foods is increasing among Koreans owing to a dietary transition toward a western style. This study was conducted to measure the selenium content in meat and eggs, and then assessed the selenium intake from these foods. Forty frequently eaten items among meat and eggs were analyzed using an Instrumental Neutron Activation Analysis. The selenium content in 100g of raw meat and eggs ranged from 8.1ug to 50.9ug. In particular, 100g of beef contained 12.4ug to 50.9ug of selenium; pork, 11.2ug to 22.6ug chicken, 10.2ug to 13.7ug and eggs, 28.6ug to 43.0ug. Thus, beef viscera and chicken eggs contain the highest amounts of selenium among these groups. 100g of Pork belly, the most frequently eaten meat type among Koreans, contains 14.6ug of selenium. An evaluation of dietary selenium intake shows that the total selenium supply from meats and eggs was 28.4ug/day and 27.5 ug/day in adult men and women, respectively. These are over one-half of the Korean RNI (Recommended Daily Intake) of 55ug/day. (author)

Role of the atmospheric mean state on the initiation of the Madden-Julian oscillation in a tropical channel model

Energy Technology Data Exchange (ETDEWEB)

Ray, Pallav; Zhang, Chidong [University of Miami, RSMAS/MPO, Miami, FL (United States); Moncrieff, Mitchell W.; Dudhia, Jim; Caron, Julie M.; Bruyere, Cindy [National Center for Atmospheric Research, Boulder, CO (United States); Ruby Leung, L. [Pacific Northwest National Laboratory, Richland, WA (United States)

2011-01-15

Tropical channel models, defined as models that are global in the zonal direction but bounded in the meridional direction, are particularly useful for simulating the Madden-Julian oscillation (MJO) and understanding its physical and dynamical basis. Influences from the extratropics through the lateral boundaries have been found to be essential to the reproduction of the initiation of certain MJO events. This led to a hypothesis that multi-year simulations using a tropical channel model would reproduce reasonable MJO statistics under the influence of prescribed lateral boundary conditions derived from global reanalyses. Interestingly, the MJO statistics in such a multi-year simulation by a high-resolution tropical channel model are not better than those from global climate models. The error in the atmospheric mean state is found to be a possible reason for the poor MJO statistics in the simulation. Nevertheless, even with a large error in the mean state, the multi-year simulation captures two MJO events previously found to be initiated by extratropical influences. However, the model does not reproduce a third event, whose initiation is not directly influenced by the extratropics. This implies that in the absence of dynamical interactions between the MJO and the lateral boundary conditions, the error in the mean state could be sufficient to prevent the MJO initiation. To explore this third MJO event further, a series of sensitivity tests are conducted. These tests show that the simulation of this event is neither critically influenced by the cumulus parameterization employed, nor the initial conditions when the model is integrated 2 weeks prior to the MJO initiation. The model captures this event when the MJO signal is already present in the initial conditions. The use of high-resolution sea surface temperature does not improve the simulation of the third MJO event. A higher-resolution nested domain covering the Indo-Pacific warm pool region and including a cloud

Evaluación de la susceptibilidad antimicrobiana de cepas de Salmonella spp. aisladas del beneficio porcino en Colombia / Evaluation of antimicrobial susceptibility of Salmonella spp. strains isolated from pork carcasses on Colombia

Directory of Open Access Journals (Sweden)

Paula M. Bermúdez D

2014-01-01

Full Text Available Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando 30 patrones diferentes de multiresistencia; el más común fue Ampicilina, Amoxicilina, Cloranfenicol, Florfenicol y Tetraciclina en el 16,77% (n=26 de las cepas. Tetraciclina y Florfenicol fueron los antimicrobianos menos efectivos en el 94,84% (n=147 y 47,74% (n=74 de cepas resistentes, respectivamente. Discusión: se deben consolidar los sistemas de monitoreo, y de vigilancia y control de las resistencias antimicrobianas para prevenir, con un enfoque de cadena productiva, la diseminación de cepas multiresistentes en alimentos de origen animal, como parte integral del sistema de gestión de inocuidad de los alimentos en Colombia. - Objetivo: el estudio buscó establecer patrones de resistencia antimicrobiana de 155 cepas de Salmonella spp., aisladas de la superficie de canales de cerdo, procedentes de plantas de beneficio en Colombia. Metodología: mediante el método de difusión en disco (Bauer et. Kirby, 1966 se evaluaron nueve antimicrobianos: Amoxicilina y ácido clavulánico (30 ug, Ampicilina (10 ug, Ceftiofur (30 ug, Ciprofloxacina (5 ug, Cloranfenicol (30 ug, Florfenicol (30 ug, Gentamicina (10 ug, Sulfadiazina y Trimetoprim (25 ug y Tetraciclina (30 ug. Resultados: los resultados confirmaron la presencia de cepas multiresistentes de Salmonella spp. de origen porcino, mostrando

Extratropical response to Fast and Slow episodes of Madden-Julian Oscillation in observation and using intervention experiments with CFSv2

Science.gov (United States)

Yadav, P.; Straus, D. M.

2017-12-01

The Madden-Julian Oscillation (MJO) is a potential source of predictability in the extratropics in extended range weather forecasting. The nature of MJO is sporadic and therefore, the mid-latitude response may depend on the nature of the MJO event, in particular the phase speed. We discuss the results of our observational and modeling study of mid-latitude circulation response to Fast and Slow MJO episodes using wintertime ERA-Interim reanalysis data and the CFSv2 coupled model of NOAA. The observational study shows that the mid-latitude response to different propagating speeds is not the same. The propagation speed is defined by the time the OLR takes to propagate from phase 3 to phase 6. The mid-latitude response is assessed in terms of composite maps and frequency of occurrence of robust circulation regimes. Fast episode composite anomalies of 500hPa height show a developing Rossby wave in the mid-Pacific with downstream propagation through MJO phases 2- 4. Development of NAO+ teleconnection pattern is stronger in Slow that in Fast MJO episodes, and occurs with a greater time lag after MJO heating is in the Indian Ocean (phase 3). Previous results find an increase in occurrence of NAO- regime following phase 6. We have found that much of this behavior is due to the slow episodes. Based on these observational results, intervention experiments using CFSv2 are designed to better understand the impact of heating/cooling and to estimate mid-latitude response to Fast and Slow MJO episodes. The added heating experiments consist of 31 year reforecasts for December 1 initial conditions from CFS reanalysis (1980-2011) in which the identical MJO evolution of three-dimensional diabatic heating has been added, thus producing fast and slow MJO episodes with well-defined phase speeds. We will discuss the results of these experiments with a focus on understanding the role of phase speed and interference in setting up the response, and to understand the mechanisms that

Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI

Directory of Open Access Journals (Sweden)

Halina Waniak-Michalak

2017-06-01

Full Text Available Porównywalność w czasie informacji o wynikach działalności społecznie odpowiedzialnej firm raportujących według zasad GRI The involvement of corporations in corporate social responsibility (CSR activities with respect for work- ers' rights and ethical principles brings tangible benefits to the enterprise. CSR activities can therefore be considered as an investment, the effects of which should be measured. CSR benefits derive from im- proved assessment of the corporation by the stakeholders and increased social trust. However, in order to achieve the desired results of CSR activities, it is necessary to provide adequate information to customers, employees and owners. Moreover, the measurement of CSR results is necessary to determine the effec- tiveness of the actions taken. The aim of the article was to answer the question if companies present the same measures in successive CSR reports and whether it is possible to compare the CSR activity results for successive years. Examination of 31 CSR reports for two consecutive editions of the reporting showed that companies change the number and type of disclosed measures.

Green justice in the city

DEFF Research Database (Denmark)

Rutt, Rebecca Leigh; Gulsrud, Natalie Marie

2016-01-01

tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment of andde...... of anddecision-making around UGS. On this basis we discuss potentials for European urban green space researchto take up a more explicit environmental justice framing to shed much-needed light on injustices inEuropean cities and inspire change in policy and practice.......tIn this short communication, we discuss European urban green space (UGS) research from an environ-mental justice perspective. We show that European UGS scholarship primarily focuses on functionalvalues and managerial aspects of UGS, while paying less attention to equity in the enjoyment...

Comparative Education in the Nineteenth Century

Science.gov (United States)

Brickman, William W.

2010-01-01

In this previously unpublished essay, William W. Brickman complicates the traditional conception of the historical foundations of comparative education--that is, the role of Marc-Antoine Julian as a "father figure." The article examines influences on Julian (by Cesar-Auguste Basset's influential publications, for example) and discusses…

List of Participants

Science.gov (United States)

2011-08-01

Abigail Alvarez OlarteCINVESTAV Alba Leticia Carrillo MonteverdeDCI-UG Alberto CarramiñanaINAOE Aldo MorselliFERMI Alejandro CastillaDCI-UG Alejandro IbarraTechnical University of Munich Alma D Rojas PachecoFCFM-BUAP Alma Xochitl Gonzalez MoralesInstituto de Ciencias Nucleares, UNAM Andrew Walcott BeckwithAmerican Institute of Beam Energy Physics Ariadna Montiel ArenasDepartamento de Física, CINVESTAV Arnulfo ZepedaCinvestav Arturo Alvarez CruzInstituto de Fisica, UNAM Axel de la MacorraUNAM, IAC Azar MustafayevUniversity of Minnesota Benjamin JaramilloDCI-UG Vincent BertinCPPM-Marseille Carlos Alberto Vaquera-AraujoDCI-UG Carlos MuñozMadrid Autonoma U. & Madrid, IFT Carmine PagliaroneINFN, FNAL Carolina Lujan PeschardDCI-UG Christiane Frigerio MartinsUniversidade Federal do ABC-São Paulo Csaba BalazsMonash University David DelepineDCI-UG David G CerdenoUniversidad Autonoma de Madrid & Instituto de Fisica Teorica Debasish MajumdarSaha Institute of Nuclear Physics, Kolkata, India Dibyendu PanigrahiKandi Raj College, Kandi, Murshidabad, INDIA-742137 Dupret Alberto Santana BejaranoUniversidad de Sonora Departamento de Investigacion en Fisica Ernest MaRiverside U.C. Esteban Alejandro Reyes Pírez MontañezInstituto de Física, UNAM Federico Ortiz TrejoINSTITUTO DE ASTRONOMÍA - UNAM Francisco José de Anda NavarroUniversidad de Guadalajara González Alvarez Francisco JavierCINVESTAV-Depto. Física Gustavo Medina TancoICN-UNAM Hernando Efrain Caicedo OrtizInstituto Politecnico Nacional - IPN J D VergadosCERN & Ioannina U. James R BoyceJefferson Lab Jason SteffenFERMILAB Javier Montaño DomínguezDCI-UG Jeevan SolankiMandsaur Institue of Technology MP India Joe SatoSaitama University Jorge Luis Navarro EstradaUNAM-ICN and Universidad del Atlantico (B/quilla-Col.) Jose A R CembranosUniversity of Minnesota José DíazIFIC Jose Didino Garcia AguilarDepto. de Fisica. Cinvestav Keith OliveUniversity of Minnesota Konstantia BalasiUniversity of Ioannina, Greece Lilian Prado

Processes controlling the surface temperature signature of the Madden-Julian oscillation in the thermocline ridge of the Indian Ocean

Energy Technology Data Exchange (ETDEWEB)

Jayakumar, A.; Gnanaseelan, C. [Indian Institute of Tropical Meteorology, Pune (India); Vialard, Jerome; Lengaigne, M. [CNRS, UPMC, IRD, Case 100, Universite P. et M. Curie, Laboratoire d' Oceanographie Experimentation et Approches Numeriques, LOCEAN, Paris Cedex 05 (France); National Institute of Oceanography, Goa (India); McCreary, Julian P. [University of Hawaii, International Pacific Research Centre, Hawaii (United States); Praveen Kumar, B. [National Institute of Oceanography, Goa (India)

2011-12-15

During boreal winter, there is a prominent maximum of intraseasonal sea-surface temperature (SST) variability associated with the Madden-Julian Oscillation (MJO) along a Thermocline Ridge located in the southwestern Indian Ocean (5 S-10 S, 60 E-90 E; TRIO region). There is an ongoing debate about the relative importance of air-sea heat fluxes and oceanic processes in driving this intraseasonal SST variability. Furthermore, various studies have suggested that interannual variability of the oceanic structure in the TRIO region could modulate the amplitude of the MJO-driven SST response. In this study, we use observations and ocean general circulation model (OGCM) experiments to quantify these two effects over the 1997-2006 period. Observational analysis indicates that Ekman pumping does not contribute significantly (on average) to intraseasonal SST variability. It is, however, difficult to quantify the relative contribution of net heat fluxes and entrainment to SST intraseasonal variability from observations alone. We therefore use a suite of OGCM experiments to isolate the impacts of each process. During 1997-2006, wind stress contributed on average only about 20% of the intraseasonal SST variability (averaged over the TRIO region), while heat fluxes contributed about 70%, with forcing by shortwave radiation (75%) dominating the other flux components (25%). This estimate is consistent with an independent air-sea flux product, which indicates that shortwave radiation contributes 68% of intraseasonal heat flux variability. The time scale of the heat-flux perturbation, in addition to its amplitude, is also important in controlling the intraseasonal SST signature, with longer periods favouring a larger response. There are also strong year-to-year variations in the respective role of heat fluxes and wind stress. Of the five strong cooling events identified in both observations and the model (two in 1999 and one in 2000, 2001 and 2002), intraseasonal-wind stress dominates

The anger-infused Ultimatum Game: A reliable and valid paradigm to induce and assess anger.

Science.gov (United States)

Gilam, Gadi; Abend, Rany; Shani, Hagai; Ben-Zion, Ziv; Hendler, Talma

2018-03-22

The Ultimatum Game (UG) is a canonical social decision-making task whereby a proposer divides a sum of money between himself and a responder who accepts or rejects the offer. Studies consistently demonstrate that unfair offers induce anger, and that rejecting such offers relates to aggression. Nevertheless, the UG is limited in interpersonal provocations common to real-life experiences of anger. Moreover, the psychometric properties of the UG as an anger-induction paradigm have yet to be evaluated. Here, to induce a more intense and genuine anger experience, we implemented a modified UG whereby short written provocations congruent with unfairness levels accompanied each offer. We aimed to test whether this anger-infused UG led to more anger and aggressive responses relative to the standard UG and to establish the reliability and validity of both versions. Participants performed either the anger-infused UG or a standard version, repeated twice, a week apart. They also performed the Taylor Aggression Paradigm, a reactive aggression paradigm, and completed emotion ratings and a trait anger inventory. Results indicate similar decreases in acceptance rates with increase in offer unfairness, and increases in reported anger, across both UG versions. Both versions demonstrated strong test-retest reliability. However, the anger-infused UG led to significantly stronger relations with reactive aggression and trait anger compared to the standard UG, providing evidence for better validity. The development of the anger-infused UG as a reliable and valid paradigm is pivotal for the induction and assessment of interpersonal anger and its aggressive expression in basic and clinical research settings. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

In Situ Bioremediation of Chlorinated Solvent Source Areas with Enhanced Mass Transfer

Science.gov (United States)

2008-09-01

three-dimensional view with iso -surface of LIF counts • GMS support files needed to operate GMS (for example, bor, .map, .mat, .img, .mat, and .sol...DCE (ug/L) trans-DCE (ug/L) VC (ug/L) Ethane (ug/L) Ethene (ug/L) Chloride (ug/L) 5C2C43 11/9/2005 440 J,B,D 27000 D 0 540 D 4.0 J 8.6 J...0.43 J 0.64 J 2C2D21 7/18/2005 29000 D 2C2D22 7/19/2005 530 J, D 30000 B, D, E 0 0 0 0 2C2D22 7/19/2005 27000 D 2C2D23 7/20/2005 180 J

Thermoelectric properties of unoxidized graphene/Bi{sub 2}Te{sub 2.7}Se{sub 0.3} composites synthesized by exfoliation/re-assembly method

Energy Technology Data Exchange (ETDEWEB)

Kim, Jin Il; Lee, Eun Sil; Kim, Jong-Young [Icheon Branch, Korea Institute of Ceramic Engineering and Technology, Gyeonggi-do (Korea, Republic of); Choi, Soon-Mok [School of Energy, Materials and Chemical Engineering, Korea University of Technology and Education, Cheonan (Korea, Republic of); Lee, Kyu Hyoung [Materials R and D Center, Samsung Advanced Institute of Technology, Yongin (Korea, Republic of); Seo, Won-Seon [Energy and Environmental Division, Korea Institute of Ceramic Engineering and Technology, Seoul (Korea, Republic of)

2014-04-15

Nanocomposites of n-type thermoelectric Bi{sub 2}Te{sub 2.7}Se{sub 0.3} (BTS) and unoxidized graphene (UG) were prepared from the exfoliated BTS and UG nanoplatelets. Polycrystalline BTS ingots were exfoliated into nanoscroll-type crystals by chemical exfoliation, and were re-assembled with UG nanoplatelets. The composites were chemically reduced by hydrazine hydrate and sintered by a spark-plasma-sintering method. The thermoelectric properties of the sintered composites were evaluated and exhibited decreased carrier concentration and increased thermal conductivity due to the embedded graphene. The peak ZT values for the UG/BTS-US and UG/BTS-EX composites were ∝0.8 at the UG concentration of 0.05 wt%. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Madden-Julian Oscillation (MJO) Signal over Kototabang, West Sumatera Based on the Mini Automatic Weather Station (MAWS) Data Analysis Using the Wavelet Technique

Science.gov (United States)

Hermawan, E.

2018-04-01

This study is mainly concerned an application of Mini Automatic Weather Station (MAWS) at Kototabang, West Sumatera nearby the location of an Equatorial Atmosphere Radar (EAR) side. We are interest to use this data to investigate the propagation of the Madden-Julian Oscillation (MJO). We examined of daily MAWS data for 3 years observations started from January 2001 to Mei 2004. By applying wavelet analysis, we found the MJO at Kototabang have 32 days oscillations as shown in Fig.1 below. In this study, we concentrate just for local mechanis only. We will show in this paper that at the phase of the MJO with a dipole structure to the convection anomalies, there is enhanced tropical convection over the eastern Indian Ocean and reduced convection over the western Pacific. Over the equatorial western Indian Ocean, the equatorial Rossby wave response to the west of the enhanced convection includes a region of anomalous surface divergence associated with the anomalous surface westerlies and pressure ridge. This tends to suppress ascent in the boundary layer and shuts off the deep convection, eventually leading to a convective anomaly of the opposite sign. Over the Indonesian sector, the equatorial Kelvin wave response to the east of the enhanced convection includes a region of anomalous surface convergence into the anomalous equatorial surface easterlies and pressure trough, which will tend to favour convection in this region. The Indonesian sector is also influenced by an equatorial Rossby wave response (of opposite sign) to the west of the reduced convection over the western Pacific, which also has a region of anomalous surface convergence associated with its anomalous equatorial surface easterlies and pressure trough. Hence, convective anomalies of either sign tend to erode themselves from the west and initiate a convective anomaly of opposite sign via their equatorial Rossby wave response, and expand to the east via their equatorial Kelvin wave response.

Ultrasound-Guided Miniscalpel-Needle Release versus Dry Needling for Chronic Neck Pain: A Randomized Controlled Trial

Directory of Open Access Journals (Sweden)

Yongjun Zheng

2014-01-01

Full Text Available Objective. To compare ultrasound-guided miniscalpel-needle (UG-MSN release versus ultrasound-guided dry needling (UG-DN for chronic neck pain. Methods. A total of 169 patients with chronic neck pain were randomized to receive either UG-MSN release or UG-DN. Before treatment and at 3 and 6 months posttreatment, pain was measured using a 10-point visual analogue scale (VAS. Neck function was examined using the neck disability index. Health-related quality of life was examined using the physical component score (PCS and mental component score (MCS of the SF-36 health status scale. Results. Patients in the UG-MSN release had greater improvement on the VAS (by 2 points at 3 months and 0.9 points at 6 months versus in the UG-DN arm; (both P<0.0001. Patients receiving UG-MSN release also showed significantly lower scores on the adjusted neck disability index, as well as significantly lower PCS. No severe complications were observed. Conclusion. UG-MSN release was superior to UG-DN in reducing pain intensity and neck disability in patients with chronic neck pain and was not associated with severe complications. The procedural aspects in the two arms were identical; however, we did not verify the blinding success. As such, the results need to be interpreted with caution.

Effect of anti-inflamentation extracts from Korean traditional medicinal herb

Directory of Open Access Journals (Sweden)

Zhang Xiaowan

2014-09-01

Full Text Available Five Mix Plant Extracts according to different extraction solvents were assessed for its cell viability and anti-inflammatory activity by in vitro methods. The single plant extract was extracted with 70% ethanol(EtOH and the mix plants(C.kousa, R.multiflora, T.nucifera, M.basjoo and S.glabra were extracted with EtOH 30%, 70%; Butylene Glycol(BG 30%, 70%; Propylene Glycol(PG 30%, 70%; Distilled Water(D.W. Cell viability was measured using the Micro culture tetrazolium (MTT assay method and Human fibroblast cells, CCD 1102 KERTr were used. The plant extracts with the maximum concentration that none toxic to the cells were evaluated for anti-inflammatory activity. Anti-inflammatory activity was evaluated using lipoxygenase inhibition assay method. A dose response curve was plotted to determine the IC50 values. Results showed that, at the 5 kinds of single plant extracts by 70% EtOH extraction solvent, it showed the IC50 was 280ug/ml of S1, 370ug/ml of S2, 380ug/ml of S3, 170ug/ml of S4 and 190ug/ml of S5. At the mix plant extracts by 7 kinds of extraction solvents (70%, 30% EtOH; 70%, 30% BG; 70%, 30% PG; D.W, it showed the IC50 was 140ug/ml of M E70, 140ug/ml of M E30, 120ug/ml of M BG70, 110ug/ml of M BG30, 120ug/ml of M PG70, 136ug/ml of M PG30 and 120ug/ml of M D.W. From the results, it is concluded that when these five plants mixed before extraction, it will extract more active ingredients with anti-inflammatory effects. Further study we will analyzing plants effective single compound using high performance liquid chromatography (HPLC profiling and progressing the experiments in vivo.

NEOEVOLUCIONISMO Y ECOLOGÍA CULTURAL. LA OBRA DE JULIAN STEWARD Y LA RENOVACIÓN DE LA ENSEÑANZA DE LA ANTROPOLOGÍA EN LA ARGENTINA / Neo-evolutionism and cultural ecology. The Argentine Renovation of Anthropology Teaching under the influence of J. Steward

Directory of Open Access Journals (Sweden)

Gastón Julián Gil

2010-12-01

Full Text Available La introducción de la obra del antropólogo norteamericano Julian Haynes Steward (1902-1972 produjo una parcial renovación de la enseñanza de la antropología en la Argentina desde mediados de la década del cincuenta. Principalmente en arqueología (y más tarde en lo que comenzaría a llamarse antropología social, el enfoque materialista, neoevolucionista y ecológico entró en tensión con la corriente histórico-cultural alemana que había hegemonizado el campo antropológico nacional liderado por el italiano José Imbelloni desde la Universidad de Buenos Aires. La circulación de estas nuevas ideas -que también provocaron fuertes polémicas en su ámbito de gestación original- es abordada principalmente a partir de la labor transformadora y revitalizadora de Alberto Rex González, posgraduado en la Universidad de Columbia y alumno de Steward a fines de los años cuarenta. De este modo, se propone un análisis de las maneras en que nuevos postulados conceptuales provenientes de una tradición metropolitana se difundieron en un contexto periférico.Palabras Clave: Antropología argentina; Neoevolucionismo; Ecología cultural; UniversidadAbstractThe introduction of the U.S. anthropologist Julian Haynes Steward (1902-1972 to the Argentine courses of Anthropology in the mid-50´s, launched a process of partial renovation in Argentine anthropology.  His materialistic, neoevolutionist, and ecological scope applied to Archeology and, later, to what would become Social Anthropology, differed from more established views such as German historical-cultural theory led by Italian anthropologist José Imbelloni and Austrian archaeologist Oswald Menghin. This paper describes and analyzes the arrival of Steward’s ideas to some Argentine schools of Anthropology (Córdoba, Litoral/Rosario and La Plata in the late 40s, by means of archaeologist Alberto Rex González, a Columbia Ph.D. and one of Steward’s students. In fact, studying Steward�

Ugonin U stimulates NLRP3 inflammasome activation and enhances inflammasome-mediated pathogen clearance

Directory of Open Access Journals (Sweden)

Chun-Yu Chen

2017-04-01

Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.

Geomechanical Assessments of Simultaneous Operation in the Case of Transition from Open Pit to Underground Mine in Vietnam

Science.gov (United States)

Niedbalski, Zbigniew; Nguyen, Phu Minh Vuong; Widzyk-Capehart, Eleonora

2018-03-01

Nowadays, for a number of reasons, many open pit mines are considering a transition from Open Pit (OP) to Underground (UG) to remain competitive. In OP-UG transition, UG operation is operated simultaneously with the OP operation for a certain period of time. Guidelines for the simultaneous operation of OP and UG are very difficult to establish, as there are very few case studies available. Yet, because of the OP-UG interactions; the operation has a higher safety, technical and management requirements than the OP or UG methods when considered separately. In Vietnam, Cao Son is one of many OP mines, which decided to change the operational system from OP to UG. Simultaneous operation started in 2015 and will be conducted until 2030 when the OP mine Cao Son ends its mining activities. In this paper, selected geomechanical considerations of the simultaneous operation are presented. A number of numerical modelling calculations using finitedifference software with code FLAC were carried out for calibration process, slope stability analysis and the OP-UG interaction analysis for the Cao Son - Khe Cham II-IV mine. Based on the results obtained from numerical modelling, the geomechanical assessments of simultaneous operation Cao Son - Khe Cham II-IV are discussed in this paper.

Decision Making on Allocating Urban Green Spaces Based upon Spatially-Varying Relationships between Urban Green Spaces and Urban Compaction Degree

Directory of Open Access Journals (Sweden)

Hsueh-Sheng Chang

2015-09-01

Full Text Available The compact city is becoming a prevailing paradigm in the world to control urban sprawl and achieve a pattern of sustainable urban development. However, discussions of the area's overcrowded neighborhoods, its health problems, and the destruction of its green areas have inspired self-examination with respect to the compact city paradigm. High population density attracts even more residents and frequently renders the existing urban green space (UGS insufficient for use as part of a living environment. Due to the unique benefits that these qualities confer, UGS allocation is now considered a significant contributing factor to urban livability. In addition, the UGS allocation may be different due to the presence of many spatial non-stationarity processes. Therefore, this study employs geographically-weighted regression (GWR to explore the unique and spatially-explicit relationships between the degree of urban compaction and UGS within the Taipei metropolitan area. Maps summarizing the GWR results demonstrate that there is significantly insufficient UGS allocation in the central area, which consists mainly of Taipei City. Townships with higher parameters contain UGS levels that better meet the needs of their residents. Overall, the exploration of conceptualizing spatial heterogeneity of relationships between the degree of urban compaction and UGS can provide insightful analyses for decision-making on allocating UGS.

Characterization of oils from Duranta repens leaf and seed

Directory of Open Access Journals (Sweden)

Agomuo Emmanuel

2017-11-01

Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p  oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.

Advanced MicroObserver UGS integration with and cueing of the BattleHawk squad level loitering munition and UAV

Science.gov (United States)

Steadman, Bob; Finklea, John; Kershaw, James; Loughman, Cathy; Shaffner, Patti; Frost, Dean; Deller, Sean

2014-06-01

Textron's Advanced MicroObserver(R) is a next generation remote unattended ground sensor system (UGS) for border security, infrastructure protection, and small combat unit security. The original MicroObserver(R) is a sophisticated seismic sensor system with multi-node fusion that supports target tracking. This system has been deployed in combat theaters. The system's seismic sensor nodes are uniquely able to be completely buried (including antennas) for optimal covertness. The advanced version adds a wireless day/night Electro-Optic Infrared (EOIR) system, cued by seismic tracking, with sophisticated target discrimination and automatic frame capture features. Also new is a field deployable Gateway configurable with a variety of radio systems and flexible networking, an important upgrade that enabled the research described herein. BattleHawkTM is a small tube launched Unmanned Air Vehicle (UAV) with a warhead. Using transmitted video from its EOIR subsystem an operator can search for and acquire a target day or night, select a target for attack, and execute terminal dive to destroy the target. It is designed as a lightweight squad level asset carried by an individual infantryman. Although BattleHawk has the best loiter time in its class, it's still relatively short compared to large UAVs. Also it's a one-shot asset in its munition configuration. Therefore Textron Defense Systems conducted research, funded internally, to determine if there was military utility in having the highly persistent MicroObserver(R) system cue BattleHawk's launch and vector it to beyond visual range targets for engagement. This paper describes that research; the system configuration implemented, and the results of field testing that was performed on a government range early in 2013. On the integrated system that was implemented, MicroObserver(R) seismic detections activated that system's camera which then automatically captured images of the target. The geo-referenced and time-tagged Micro

Enumeration of Mars years and seasons since the beginning of telescopic exploration

Science.gov (United States)

Piqueux, Sylvain; Byrne, Shane; Titus, Timothy N.; Hansen, Candice J.; Kieffer, Hugh H.

2015-01-01

A clarification for the enumeration of Mars Years prior to 1955 is presented, along with a table providing the Julian dates associated with Ls = 0° for Mars Years -183 (beginning of the telescopic study of Mars) to 100. A practical algorithm for computing Ls as a function of the Julian Date is provided. No new science results are presented

Aryl hydrocarbon receptors in urogenital sinus mesenchyme mediate the inhibition of prostatic epithelial bud formation by 2,3,7,8-tetrachlorodibenzo-p-dioxin

International Nuclear Information System (INIS)

Ko, Kinarm; Moore, Robert W.; Peterson, Richard E.

2004-01-01

In utero exposure of male C57BL/6 mice to 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) prevents prostatic epithelial buds from forming in the ventral region of the urogenital sinus (UGS) and reduces the number of buds that form in the dorsolateral region. This inhibition of budding is aryl hydrocarbon receptor (AHR) dependent and appears to be the primary cause of lobe-specific prostate abnormalities in TCDD-exposed mice. TCDD can inhibit prostatic epithelial bud formation by acting directly on the UGS in vitro, but whether it does so via AHR in UGS mesenchyme, epithelium, or both was unknown. To address this issue, UGS mesenchyme and epithelium from gestation day (GD) 15 wild-type C57BL/6J male mice were isolated, recombined, and cultured in vitro for 5 days with 10 -8 M 5α-dihydrotestosterone (DHT) and either 10 -9 M TCDD or vehicle. Prostatic epithelial buds were viewed by light microscopy after removal of mesenchyme. Effects depended greatly on which portions of the mesenchyme were used: TCDD had little if any effect when whole UGS epithelium (UGE) was recombined with ventral plus dorsolateral mesenchyme, tended to reduce bud numbers in recombinants made with UGE and dorsolateral mesenchyme, and severely reduced bud numbers in recombinants made with UGE and ventral mesenchyme (VM). [VM + UGE] recombinants prepared from wild-type and AHR knockout (Ahr -/- ) mice were then cultured with DHT to determine the site of action of TCDD. AHR null mutation alone had no effect on budding. TCDD severely inhibited prostatic epithelial bud formation in recombinants that contained mesenchymal AHR, whereas bud formation was not inhibited by TCDD in recombinants lacking mesenchymal AHR, regardless of epithelial AHR status. These results demonstrate that UGS mesenchyme and not UGS epithelium is the site of action of TCDD. Therefore, the initial events responsible for abnormal UGS (and ultimately prostate) development occur within the UGS mesenchyme, and changes in gene expression

Concentraciones de yodo en orina y en sal de consumo en mujeres entre 12 a 49 años del Perú

Directory of Open Access Journals (Sweden)

Carolina Tarqui-Mamani

Full Text Available Objetivos. Determinar las concentraciones de yodo en orina y sal de consumo en mujeres entre 12 a 49 años en Perú. Materiales y métodos. Se realizó un estudio observacional y transversal. Durante el 2012 y 2013, se incluyó mujeres entre 12 a 49 años residentes en los hogares peruanos seleccionadas mediante un muestreo probabilístico, estratificado y multietápico. La determinación de yodo en orina se realizó por espectrofotometría basada en la reacción de Sandell-Kolthoff. La evaluación cualitativa de yodo en sal se realizó por yoditest y la cuantitativa por volumetría. El procesamiento se realizó mediante muestras complejas con ponderaciones. Se obtuvo medianas, rango intercuartílico y percentiles. Resultados. La mediana de yoduria en las participantes fue 250,4 ug/L; los departamentos con medianas de yoduria elevadas fueron: Moquegua (389,3 ug/L; Tacna (320,5 ug/L; Madre de Dios (319,8 ug/L, y Ucayali (306,0 ug/L; mientras que Puno (192,9 ug/L; Piura (188,1 ug/L y Tumbes (180,5 ug/L tuvieron medianas dentro de lo recomendado por la OMS. La mediana de yoduria en gestantes fue 274,6 ug/L (RIQ: 283 ug/L. El 82,5% de las muestras de sal tuvieron yodo ≥30 ppm y 1,9% tuvo valores de 0 ppm. Conclusiones. La mediana de yoduria en las mujeres peruanas está por encima de lo recomendado por la OMS y la mayoría de las muestras de sal tuvieron concentraciones adecuadas de yodo según la OMS

SUSCEPTIBILIDAD ANTIMICROBIANA DE AISLAMIENTOS DE Salmonella enterica PROVENIENTES DE PISOS, EQUIPOS, UTENSILIOS Y PRODUCTO TERMINADO EN PLANTAS DE BENEFICIO PORCINO EN COLOMBIA

Directory of Open Access Journals (Sweden)

P. M. Bermúdez

2016-01-01

Full Text Available La diseminación de Salmonella spp. resistente a antimicrobianos en las cadenas productivas de alimentos de origen animal es una preocupación de salud pública de carácter mundial. Este estudio describe los patrones de resistencia antimicrobiana de 283 aislamientos de Salmonella enterica procedentes de plantas de beneficio porcino en Colombia. Se evaluó la susceptibilidad antimicrobiana frente a diez antimicrobianos mediante el método de difusión en disco: amoxacilina-ácido clavulánico (30 ug, ampicilina (10 ug, ceftiofur (30 ug, ciprofloxacina (5 ug, cloranfenicol (30 ug, florfenicol (30 ug, gentamicina (10 ug, sulfadiazina/trimetroprim (25 ug, tetraciclina (30 ug y tilmicosina (15 ug. Los resultados evidenciaron la presencia de 279 aislamientos multirresistentes de Salmonella enterica de origen porcino provenientes del ambiente y del producto terminado en las plantas de beneficio evaluadas (46,64% n: 132. Se detectaron 52 patrones de multiresistencia: el más común fue ceftiofur-tetraciclina-tilmicosina en el 9,89% (n: 28 de los aislamientos. Con referencia a estos antimicrobianos, 96,82% (n: 274 de los aislamientos fueron resistentes a tetraciclina, 73,14% (n: 207 a tilmicosina y 28,27% (n: 80 a ceftiofur. De especial interés fue la alta proporción de aislamientos resistentes a ceftiofur, debido a una posible resistencia cruzada con ceftriaxona. Los resultados obtenidos demuestran la necesidad de promover el diseño e implementación de un Programa oficial Integrado de Vigilancia de la Resistencia Antimicrobiana, además de sistemas de monitoreo voluntario en cada eslabón de la cadena productiva porcina, para contribuir a la prevención y control de la transmisión de microorganismos resistentes de origen alimentario en el marco del sistema de gestión de inocuidad alimentaria en Colombia.

Factors Associated with Redundant Sigmoid Colon at Mulago ...

African Journals Online (AJOL)

jen

economic factors between 68 patients .... 50,000 Uganda shillings (Ug. Shs) compared to only 19.9% of the controls (1 US $ = Ug shs 1500). ... the majority of the affected patients in this study had a family income of below 50,000 Ug. shs per month.

Environmental and occupational exposures to mercury among indigenous people in Dunkwa-On-Offin, a small scale gold mining area in the South-West of Ghana.

Science.gov (United States)

Kwaansa-Ansah, E E; Basu, N; Nriagu, J O

2010-11-01

Total mercury concentrations in human hair and urine samples were determined to ascertain the extent of environmental and occupational mercury exposure in Dunkwa-On-Offin, a small scale gold mining area of the central-west region of Ghana. In all ninety-four (94) hair and urine samples comprising of forty (40) small scale miners and fifty-four (54) farmers were collected and analyzed for their total mercury levels using the cold vapour atomic absorption spectrometry. The hair total mercury concentrations ranged from 0.63 to 7.19 ug/g with a mean of 2.35 ± 1.58 ug/g for the farmers and 0.57-6.07 ug/g with a mean of 2.14 ± 1.53 ug/g for the small scale gold miners. There was no significant correlation between the total mercury concentration and the average weekly fish diet. The total mercury concentrations in urine of the miners were higher than those of the farmers and ranged from 0.32 to 3.62 ug/L with a mean of 1.23 ± 0.86 ug/L. The urine concentrations of farmers ranged from 0.075 to 2.31 ug/L with a mean of 0.69 ± 0.39 ug/L. Although the results indicate elevated internal dose of mercury the current levels of exposures do not appear to pose a significant health threat to the people.

Simultaneous determination of sulphaquinoxaline and amprolium in veterinary mixture by HPLC and first derivative ultraviolet spectrophotometry

International Nuclear Information System (INIS)

El-Sattar, Osama Abd

2002-01-01

Two simple and reliable methods are described for the determination of sulphaquinoxaline (SQX) and amprolium (AMP) combined in veterinary powder. The first method depends on high performance liquid chromatography on a reversed phase column (Bondapak-C18) using mobile phase consisting of acetonitrile-methanol-water-phosphoric acid (30: 5: 55: 0.7, by volumes) at a flow rate of 1 ml min with UV detection at 254 nm. The detection limits were 0.2 ug ml and 0.35 ug ml and linearity ranges were 2-20 ug ml and 4-40ug ml for SQX and AMP, respectively. The second one deals with the first derivative (D) spectrophotometry with zero-crossing measurement at 253 nm and 226 nm for SQX and AMP respectively. The detection limits were 0.3 ug ml and linearity ranges were 1-18 ug ml and 4-32 ug-ml for SQX and AMP respectively. The proposed procedures were successfully applied to the determination of these drugs in laboratory prepared mixtures with mean percentage recovery ranged from 98.50 to 99.75 and in commercial preparation ranged from 103.85 to 104.85. (author)

A cognitively plausible model for grammar induction

Directory of Open Access Journals (Sweden)

Roni Katzir

2015-01-01

Full Text Available This paper aims to bring theoretical linguistics and cognition-general theories of learning into closer contact. I argue that linguists' notions of rich UGs are well-founded, but that cognition-general learning approaches are viable as well and that the two can and should co-exist and support each other. Specifically, I use the observation that any theory of UG provides a learning criterion -- the total memory space used to store a grammar and its encoding of the input -- that supports learning according to the principle of Minimum Description-Length. This mapping from UGs to learners maintains a minimal ontological commitment: the learner for a particular UG uses only what is already required to account for linguistic competence in adults. I suggest that such learners should be our null hypothesis regarding the child's learning mechanism, and that furthermore, the mapping from theories of UG to learners provides a framework for comparing theories of UG.

Optimization of extraction parameters for recovery of a-amylase from the fermented bran of Bacillus circulans GRS313

Directory of Open Access Journals (Sweden)

Palit Soumen

2001-01-01

Full Text Available The extraction of alpha-amylase in the solid state fermentation of wheat bran by Bacillus circulans GRS313 was optimized. Among various solvents tested, maximum extraction was achieved when 2.5% (v/v glycerol was added. The optimum conditions for extraction were 2.5 hrs soaking time at 30° C under recirculation and agitated condition, which yielded 590 U/g bran of enzyme activity. Whereas under stationary soaking condition the activity of the enzyme was 439.58U/g bran. With repeated wash under the above optimum conditions showed that 600 U/g and 184.2 U/g of enzyme extracted in the 1st and 2nd washes respectively and only 36.84 U/g was recovered in the 3rd wash

Isomeric rations study for the α + 70 Ge

International Nuclear Information System (INIS)

Hora Villano, M.H. da.

1984-12-01

Isomeric ratios for 73 Se F,I produced in the reaction α + 70 Ge with incidence laboratory energy ranging from 8 to 28 MeV, have been measured using off-line γ-ray spectroscopy. Relative formation cross-section for isomeric and ground states were obtained with NAT Ge targets. Compound nucleus statistical analyses were performed using computer codes Alice and Julian. Unlike to Alice code, the Julian code predictions agreed quite well with the experimental results. This agreement may be explained by the inclusion of the γ competition in the deexcitation channels of the compound nucleus and by the correct level density calculation of the emission probabilities in the Julian code. Finally angular momentum populations for isomers formations in the reaction 70 Ge(α, n) 73 have been determined. (author)

Effect of gamma-irradiation on the natural occurence of Fusarium mycotoxins in wheat, flour and bread

International Nuclear Information System (INIS)

Aziz, N.H.; Attia, E.-S.A.; Farag, S.A.

1997-01-01

A survey was carried out to obtain data on the occurence of Fusarium mycotoxin in wheat and flour samples collected from local markets in Egypt and to study the influence of gamma-irradiation on controlling the occurrence of thesemycotoxins in wheat, flour and bread. Deoxynivalenol (DON) was detected in five samples of wheat at levels ranging from 103 to 287 ug/kg and one sample each of flour and bread concentrations 188 and 170 ug/kg. Zearaleone (ZEN) was detected in ten samples of wheat at levels from 28 to 42 ug/kg and four samples each of flour and bread at concentrations of 95 and 34 ug/kg, respectively. T-2 toxin was detected only in one sample each of wheat, flour and bread at concentrations of 2.9, 2.2, and 2.3 ug/kg, respectively. Gamma-irradiation at dose level of 6 kGy completely eliminated fungal flora in flour and wheat. DON, ZEN and T-2 toxin concentrations are reduced to 85, 20 and 2.0 ug/kg for wheat and to 125, 45, and 1.0 ug/kg for flour after 4 kGy exposure and a sharp drop in Fusarium toxin levels occured at 6 kGy and was eliminated at 8 kGy. Bread prepared from 6 kGy was contaminate4d with Fusarium toxin at levels below 5 ug/kg. It was noticed that gamme-irradiation reduce greatly the natural occurrence of Fusarium mycotoxins in bread

Heavy Metal Contents of Municipal and Rural Dumpsite Soils and Rate of Accumulation by Carica papaya and Talinum triangulare in Uyo, Nigeria

Directory of Open Access Journals (Sweden)

G. A. Ebong

2008-01-01

Full Text Available Dumpsites in Uyo and most cities in Nigeria are used nutrients rich soils for cultivating fruits and vegetables without regards to the risk of toxic metal pollution by the wastes. This development necessitated the research on the assessment of the impact of municipal and rural dumpsites on the metal levels of the underlying soils, the relationship between the dumpsite- soil metal content and the rate of bio-accumulation by plants, the effect of plant specie and plant part on the rate of metal uptake. Atomic absorption spectrophotometer was employed for the analysis of the samples and results obtained from municipal dumpsite soil indicated the following mean concentrations: Fe, 1711.20 μg/g; Pb, 43.28 ug/g; Zn, 88.34 ug/g; Ni, 12.18 ug/g; Cd, 14.10 ug/g and Cu, 56.33 ug/g. These concentrations were relatively higher than the following concentrations: Fe, 1016.98 ug/g; Pb, 18.57 ug/g; Zn, 57.90 ug/g; Ni, 7.98 ug/g; Cd, 9.25 ug/g and Cu, 33.70 ug/g recorded for the rural dumpsite soil. Consequently, plants grown on municipal dumpsites soil accumulated higher concentrations of the metals than those on rural dumpsites. Results obtained from this study also revealed that plants grown on dumpsite soils bio-accumulated higher metal concentrations than their counterparts obtained from normal agricultural soils. The ability of plants to bioaccumulate these metals were also observed as being different from one plant to the other and from one plant parts to the other. And apart from Fe and Zn which recorded higher concentrations in the leaves of the plants studied, other metals recorded higher concentrations in the roots. The general results obtained revealed that the levels of Cd in dumpsite-soil were above the standard while the levels of Cd and Pb in plants were also above the recommended levels in plants. The implications of these high concentrations of these metals in soil and plants have been discussed. Some useful recommendations on the proper

Power to punish norm violations affects the neural processes of fairness-related decision making

Directory of Open Access Journals (Sweden)

Xuemei eCheng

2015-12-01

Full Text Available Punishing norm violations is considered an important motive during rejection of unfair offers in the Ultimatum Game (UG. The present study investigates the impact of the power to punish norm violations on people’s responses to unfairness and associated neural correlates. In the UG condition participants had the power to punish norm violations, while an alternate condition, the Impunity Game (IG, was presented where participants had no power to punish norm violations since rejection only reduced the responder’s income to zero. Results showed that unfair offers were rejected more often in UG compared to IG. At the neural level, anterior insula and dorsal anterior cingulate cortex were more active when participants received and rejected unfair offers in both UG and IG. Moreover, greater dorsolateral prefrontal cortex activity was observed when participants rejected than accepted unfair offers in UG but not in IG. Ventromedial prefrontal cortex activation was higher in UG than IG when unfair offers were accepted as well as when rejecting unfair offers in IG as opposed to UG. Taken together, our results demonstrate that the power to punish norm violations affects not only people’s behavioral responses to unfairness but also the neural correlates of the fairness-related social decision-making process.

Urinary continence following repair of intermediate and high urogenital sinus in CAH. Experience with 55 cases.

Directory of Open Access Journals (Sweden)

Maria Marcela Bailez

2014-07-01

Full Text Available Aim :Evaluate postoperative urinary continence in patients withcongenital adrenal hyperplasia(CAHwith intermediate (ITand high urogenital sinus (UGS who underwent a UGS mobilization maneuver .Methods: We called IT to those that although needing an aggressive dissection to get to the vagina, still have enough urethra proximal to the vaginal confluence. Very low variants are excluded from this analysis. Dissection always started in the posterior wall of the UGS with an aggressive separation from the anterior rectal wall. If the wide portion of the vagina was reached dissection stopped and the UGS opened ventrally widening to the introitus. Nineteen patients were treated using this maneuver (Group1. When more dissection was required the anterior wall of the UGS was dissected and carefully freed from the low retropubic space. Then the UGS was opened either ventrally or dorsally. Thirty three patients required this approach (Group 2 .Combined procedures were used in 3 patients with high UGS (Group 3. Results : Mean age at the time of the repair and length of the UGS were 12.2 years (4 months to 18 years and 3.75 cm (3 -8 cmfor G 1; 8 years (5 months to 17 years and 6.34 cm ( 4-12 cm in G2 and 8,3 years (2 -14 y and 11.5cm (11-12cm in G3. All patients had been regularly followed. Mean age at last follow up of 14.3y, 17y and 9.9y for groups 1, 2 and 3 respectively. All patients continue to void normally and are continent. All patients have 2 separate visible orifices in the vulva. Only 3 are sexually active.Conclusion: UGS mobilization for vaginoplasty in girls with CAH does not compromise voiding function or urinary continence,

Promotion of hepatic preneoplastic lesions in male B6C3F1 mice by unleaded gasoline.

Science.gov (United States)

Standeven, A M; Wolf, D C; Goldsworthy, T L

1995-01-01

In previous studies, unleaded gasoline (UG) vapor was found to be a liver tumor promoter and hepatocarcinogen in female mice, but UG was not a hepatocarcinogen in male mice. However, UG vapor had similar transient mitogenic effects in nonlesioned liver of both male and female mice under the conditions of the cancer bioassay. We used an initiation-promotion protocol to determine whether UG vapor acts as a liver tumor promoter in male mice and to examine proliferative effects that may be critical to tumor development. Twelve-day-old male B6C3F1 mice were injected with N-nitrosodiethylamine (DEN; 5 mg/kg, intraperitoneally) or vehicle. Starting at 5-7 weeks of age, mice were exposed by inhalation 6 hr/day, 5 days/week for 16 weeks to 0 or 2046 ppm of PS-6 blend UG. UG treatment caused a significant 2.3-fold increase in the number of macroscopic hepatic masses in DEN-initiated mice, whereas no macroscopic masses were observed in non-initiated mice. Altered hepatic foci (AHF), which were predominantly basophilic in phenotype, were found almost exclusively in DEN-initiated mice. UG treatment significantly increased both the mean volume (threefold) and the volume fraction (twofold) of the AHF without increasing the number of AHF per unit area. UG also induced hepatic pentoxyresorufin-O-dealkylase (PROD) activity, a marker of CYP2B, by more than 12-fold over control with or without DEN cotreatment. To study hepatocyte proliferative effects of UG, we treated mice with 5-bromo-2'-deoxyuridine (BrdU) via osmotic pump for 3 days before necropsy and measured hepatocyte BrdU labeling index (LI) in AHF and nonlesioned liver.(ABSTRACT TRUNCATED AT 250 WORDS) Images Figure 1. PMID:7588481

Addition of Aegilops U and M Chromosomes Affects Protein and Dietary Fiber Content of Wholemeal Wheat Flour

Directory of Open Access Journals (Sweden)

Marianna Rakszegi

2017-09-01

Full Text Available Cereal grain fiber is an important health-promoting component in the human diet. One option to improve dietary fiber content and composition in wheat is to introduce genes from its wild relatives Aegilops biuncialis and Aegilops geniculata. This study showed that the addition of chromosomes 2Ug, 4Ug, 5Ug, 7Ug, 2Mg, 5Mg, and 7Mg of Ae. geniculata and 3Ub, 2Mb, 3Mb, and 7Mb of Ae. biuncialis into bread wheat increased the seed protein content. Chromosomes 1Ug and 1Mg increased the proportion of polymeric glutenin proteins, while the addition of chromosomes 1Ub and 6Ub led to its decrease. Both Aegilops species had higher proportions of β-glucan compared to arabinoxylan (AX than wheat lines, and elevated β-glucan content was also observed in wheat chromosome addition lines 5U, 7U, and 7M. The AX content in wheat was increased by the addition of chromosomes 5Ug, 7Ug, and 1Ub while water-soluble AX was increased by the addition of chromosomes 5U, 5M, and 7M, and to a lesser extent by chromosomes 3, 4, 6Ug, and 2Mb. Chromosomes 5Ug and 7Mb also affected the structure of wheat AX, as shown by the pattern of oligosaccharides released by digestion with endoxylanase. These results will help to map genomic regions responsible for edible fiber content in Aegilops and will contribute to the efficient transfer of wild alleles in introgression breeding programs to obtain wheat varieties with improved health benefits.Key Message: Addition of Aegilops U- and M-genome chromosomes 5 and 7 improves seed protein and fiber content and composition in wheat.

Metabolomic effects in HepG2 cells exposed to CeO2, SiO2 and CuO nanomaterials.

Science.gov (United States)

To better assess potential hepatotoxicity of nanomaterials, human liver HepG2 cells were exposed for three days to 5 different CeO2 (either 30 or 100 ug/ml), 3 SiO2 based (30 ug/ml) or 1 CuO (3 ug/ml) nanomaterials with dry primary particle sizes ranging from 15 to 213 nm. Metab...

Radiation sensitivity of two Ginger varieties (Zingiber officinale Rosc.) to gamma irradiation

International Nuclear Information System (INIS)

Nwachukwu, E.C.; Ene, L.S.O.; Mbanaso, E.N.A.

1994-01-01

The mutability and radiosensitivity of two local ginger varieties in Nigeria ''Tafin Giwa'' (UG 1) and ''Yatsun Biri'' (UG 2) were studied using gamma rays from a 60Co gamma source. There was a high frequency of chlorophyll mutations indicating a high mutability in ginger. GR 50 was obtained at 5.0 and 6.0 Gy in UG1, and UG2, respectively, while LD50 was obtained at 8.75 Gy in both varieties. The dose limitation range for ginger was estimated to be 5.0-9.0 Gy [es

Small battery operated unattended radar sensor for security systems

Science.gov (United States)

Plummer, Thomas J.; Brady, Stephen; Raines, Robert

2013-06-01

McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.

Associations between physical activity and characteristics of urban green space

DEFF Research Database (Denmark)

Schipperijn, Jasper; Bentsen, Peter; Troelsen, Jens

2013-01-01

of the nearest UGS, and the presence of certain features. However, the evidence to date is somewhat inconclusive, and dominated by studies from North America and Australia. There is a large variation in city structures, and recommendations for North American or Australian cities are not automatically valid...... was found. The amount and number of UGS within one kilometre revealed no association either. For PA in the nearest UGS positive associations with size, walking/cycling routes, wooded areas, water features, lights, pleasant views, bike rack, and parking lot were found. This indicates that PA in an UGS might...

The Development of Theory of Mind and Positive and Negative Reciprocity in Preschool Children.

Science.gov (United States)

Schug, Joanna; Takagishi, Haruto; Benech, Catalina; Okada, Hiroyuki

2016-01-01

This study examined the relation between the acquisition of false-beliefs theory of mind (ToM) and reciprocity in preschoolers. Preschool-aged children completed a task assessing the understanding of false beliefs, and played an Ultimatum Game (UG) with another child in a face-to-face setting. Negative reciprocity was assessed by examining the rejection of unfair offers made by another child in the UG, while positive reciprocity was assessed by examining allocations made by participants in a Dictator Game (DG) following the UG. The results indicated that children who had passed a task assessing first-order false beliefs were more likely to make generous offers in a DG following a fair offer made by their partner in a proceeding UG, but that false beliefs ToM was unrelated to the rejection of unfair offers in the UG.

ANTIBACTERIAL PROPERTIES OF PHARMACEUTICAL COMPOSITION OF HEPATOPROTECTORS

Directory of Open Access Journals (Sweden)

Aslanian MA

2016-12-01

Full Text Available Pathology problemof hepatobiliary system (HBS of contagious origin becomes relevant with the increase of disturbance and complications of lipid metabolism and bile pigments among young people. Leading role in prophylaxis and treatment in the context of this pathology belongs to antibacterialc hemotherapeutic agents. However, along with antimicrobial activity, numerous side effects can be observed during treatment with antibacterial agents. According to the recent study on hepatobiliary system (HBS, therapeutic effect can be seen only while using herbal medicine with choleretic action as well as their various compositions.Amountof medicine with the appropriate effect is insufficient, that is why the study was conducted towards finding effective combinations of plant substances of different groups for the purpose of creatingan effective medicine for treatment of hepatobiliary system (HBS of contagious origin. Aim of the work The purpose of study was to examine antibacterial properties of different combinations with flamin and lavender oil in combined medicine during the course of treatment of cholecystitis and cholangitis. Materials and methods. It the result of study 61 microbial strains were distinguished and identified from the pathological material taken from 53 patients with cholecystitis and cholangitis. All distinguished clinical microbial strains taken from the patients were tested for sensitivity to combined medicine in the form of tablets with flamin and lavender oil. Minimal inhibitory concentration for S. aureus АТСС 25923 amounted to 250-350 ug/ml, for E. coli АТСС 25922 - 350±50,0 ug/ml, for P. aeruginosa АТСС 27853 750±100,0 ug/ml, for Р. vulgaris АТСС 4636 - 850±100,0 ug/ml, minimal inhibitory concentration to the tablets № 2 та № 3 amounted to > 1000 мкг/мл. Minimal inhibitory concentration for B. subtilis АТСС 6633 amounted to 250±50,0 ug/ml, for C. albicans ATCC 885/653 300±50,0 ug

Establishment of Uropygial Gland Growth Curves for White, Three-Way Crossed Mule Ducklings

Directory of Open Access Journals (Sweden)

YH Chen

2015-06-01

Full Text Available Growth curves for the uropygial gland (UG of white, 3-way crossed mule ducklings were established using the Gompertz function. In total, 144 ducklings were fed in 12 floor pens with 12 birds in each pen. Each pen contained an equal number of animals of each sex. Feed and water were supplied ad libitumthroughout the entire experimental period. The weekly change in UG weight was recorded in males and females from hatch to 8 weeks of age. The weight and length of the UG, the width of the lobus glandulae uropygialis, the length and width of the pluma of the circulus uropygialis, and the index of the papilla uropygialis were measured once a week in individual ducklings in one pen. The average UG weight gain observed in white, 3-way crossed drakes was significantly higher than that of ducks of 21-56 days of age (P< 0.05. The UG length was 1.64-2.23 times the width of the left or right lobe, and the development of the UG was delayed from 3-4 weeks of age. The morphology of the UG changed from elliptical to elongated-elliptical with age. The right and left lobus glandulae uropygialis were symmetrical. The Gompertz growth functions of the UG in drakes and ducks were W=5.49e-e-0.675(t-1.955 and W=4.76e-e-0.685(t-1.936, respectively, where t represents age in weeks. These equations indicated that the maximum growth rate for drakes occurred at 14.1 days of age and for ducks at 13.6 days of age.

Les relations du sculpteur américain George Julian Zolnay avec la Roumanie, son pays natal

Directory of Open Access Journals (Sweden)

Adrian-Silvan Ionescu

2011-01-01

Full Text Available Born on 4th of July 1862 in Bucharest, of a former 1848 Hungarian revolutionist father, and a Romanian mother, George Julian Zolnay was a graduate of the School of Fine Arts and a good violin player too. While following the sculpture classes of the Vienna Fine Arts Academy his professor recommended him to go to the United States to give a helping hand to the completion of the 1893 Chicago Columbian Exhibition. He settled there and in 1897 received his American citizenship. Zolnay eventually became a reputed American sculptor but he had never forgotten his native country. On the contrary, he kept a constant correspondence with former friends, colleagues and army comrades. As a tribute to his native country, in 1899, he offered to the Art Museum in Bucharest a gesso model of his most recent sculpture. Called Grief, his work was a funerary monument for Winnie Davis’s tomb in Hollywood Cemetery in Richmond, Virginia. His gift was gratefully received and King Carol I awarded him the Bene Merenti Medal. This distinction made a great sensation among his American colleagues from the Arts Club in New York who offered a dinner in his honor. In 1902, while paying a visit to Romania, he was received by King Carol in a private audience at the Peleș Castle in Sinaia. Years later, in 1929, Zolnay wrote a comprehensive autobiography for his two daughters in which he described this important event in his life. King Carol seemed interested in everything American and asked him a lot of questions on various topics thus prolonging the meeting to more than an hour, a fact which was unheard at the Romanian Court where stern rules where duly observed.In 1911 he planned another visit to Romania, to show it to his wife and introduce her to his family. The young lady prepared a Romanian folk costume, precious wedding gift from her mother-in-low, to wear at the audience to the Royal Court. But a cholera epidemic prevented the Zolnays to travel down the Danube and all

Textural properties of low-fat set-type yoghurt depending on mTG addition

Directory of Open Access Journals (Sweden)

Lívia Darnay

2016-07-01

Full Text Available Our aim was to determine how 0.5-2 U/g non-inactivated mTG affects the pH development and apparent viscosity during fermentation. Furthermore we wished to examine how the enzyme addition could change protein structure, gel strength and sensory characteristics by healthy low-fat set-type yoghurt product. Therefore commercial mTG enzyme preparation was added in different concentrations (0.5-2.0 U/g, in 0.5 U/g steps to 1.5 % bovine milk simultaneously with DVS starter culture. Our study revealed that enzyme dosage (0.5-2 U/g protein had no impact on pH development and apparent viscosity during fermentation when manufacturing low-fat (1.5 % set-type yoghurt. The addition of mTG contributed to 38 % more whey retention with incorporation of β-casein, and caused 44 % higher gel strength up to a level of 1 U/g protein.

Ultrasonic destruction of albumin microbubbles enhances gene transfection and expression in cardiac myocytes.

Science.gov (United States)

Wang, Guo-zhong; Liu, Jing-hua; Lü, Shu-zheng; Lü, Yun; Guo, Cheng-jun; Zhao, Dong-hui; Fang, Dong-ping; He, Dong-fang; Zhou, Yuan; Ge, Chang-jiang

2011-05-01

It has been proven that ultrasonic destruction of microbubbles can enhance gene transfection efficiency into the noncardiac cells, but there are few reports about cardiac myocytes. Moreover, the exact mechanisms are not yet clear; whether the characteristic of microbubbles can affect the gene transfection efficiency or not is still controversial. This study was designed to investigate whether the ultrasound destruction of gene-loaded microbubbles could enhance the plasmids carried reporter gene transfection in primary cultured myocardial cell, and evaluate the effects of microbubbles characteristics on the transgene expression in cardiac myocytes. The β-galactosidase plasmids attached to the two types of microbubbles, air-contained sonicated dextrose albumin (ASDA) and perfluoropropane-exposed sonicated dextrose albumin (PESDA) were prepared. The gene transfection into cardiac myocytes was performed in vitro by naked plasmids, ultrasound exposure, ultrasonic destruction of gene-loaded microbubbles and calcium phosphate precipitation, and then the gene expression and cell viability were analyzed. The ultrasonic destruction of gene-loaded microbubbles enhanced gene expression in cardiac myocytes compared with naked plasmid transfection ((51.95 ± 2.41) U/g or (29.28 ± 3.65) U/g vs. (0.84 ± 0.21) U/g, P ASDA ((51.95 ± 2.41) U/g vs. (29.28 ± 3.65) U/g, P < 0.05). Ultrasonic destruction of microbubbles during calcium phosphate precipitation gene transfection enhanced β-galactosidase activity nearly 8-fold compared with calcium phosphate precipitation gene transfection alone ((111.35 ± 11.21) U/g protein vs. (14.13 ± 2.58) U/g protein, P < 0.01). Even 6 hours after calcium phosphate precipitation gene transfection, ultrasound-mediated microbubbles destruction resulted in more intense gene expression ((35.63 ± 7.65) U/g vs. (14.13 ± 2.58) U/g, P < 0.05). Ultrasonic destruction of microbubbles might be a promising method for the delivery of non-viral DNA into

Mineralogic sources of metals in leachates from the weathering of sedex, massive sulfide, and vein deposit mining wastes

Science.gov (United States)

Diehl, S.F.; Hageman, P.L.; Seal, R.R.; Piatak, N.M.; Lowers, H.

2011-01-01

Weathered mine waste consists of oxidized primary minerals and chemically unstable secondary phases that can be sources of readily soluble metals and acid rock drainage. Elevated concentrations of metals such as Cd, Cu, Fe, Mn, Ni, Pb, and Zn are observed in deionized water-based leachate solutions derived from complex sedex and Cu-Pb-Zn mine wastes. Leachate (USGS FLT) from the Elizabeth mine, a massive sulfide deposit, has a pH of 3.4 and high concentrations of Al (16700 ug/L), Cu (440 ug/L), and Zn (8620 ug/L). Leachate from the sedex Faro mine has a pH of 3.5 and high concentrations of Al (2040 ug/L), Cu (1930 ug/L), Pb (2080 ug/L), and Zn (52900 ug/L). In contrast, higher-pH leachates produced from tailings of polymetallic vein deposits have order of magnitude lower metal concentrations. These data indicate that highly soluble secondary mineral phases exist at the surface of waste material where the samples were collected. Sulfide minerals from all sites exhibit differential degrees of weathering, from dissolution etched grain rims, to rinds of secondary minerals, to skeletal remnants. These microscale mineral-dissolution textures enhance weathering and metal teachability of waste material. Besides the formation of secondary minerals, sulfide grains from dried tailings samples may be coated by amorphous Fe-Al-Si minerals that also adsorb metals such as Cu, Ni, and Zn.

Email: pattuquayefio@ug.edu.gh

African Journals Online (AJOL)

Apusigah

making. ... study, the article hints at possible implications of the co-optation of human ... shortage, health challenges such as the Human Immunodeficiency Virus (HIV), and the causes ... appropriate framework for considering such challenges.

Asian Dust Observed During the KORUS Air Quality Mission Creates Significant Super-Micron NO3-, NH4+, and SO42- Aerosols.

Science.gov (United States)

Heim, E. W.; Dibb, J. E.; Scheuer, E. M.

2017-12-01

The KORUS mission was a collaborative effort between the Korean Institute of Environmental Research and NASA. KORUS provided a comprehensive assessment of air quality in Korea during early 2016. The intensive sampling campaign was timed to assess local photochemistry during increasing solar insolation and biogenic emissions; after the April peak in outflow of pollution and dust from central China. Chinese outflow is well characterized by Silica-Calcium rich dust. Despite the effort to avoid the period with strongest dust outflow, Ca2+ was well represented in all bulk (particle diameters up to 4.5 micron) aerosol filter samples filter measurements and submicron measurements of NH4+, SO42, and NO3- made by AMS indicates substantial super-micron fractions of these anthropogenic ions at times during KORUS-AQ. During the dustiest samples (Ca2+ > 1.5ug/m3) we see marked increases in super-micron concentration of NH4+, SO42-, and NO3-, m = 1.113 ug/m3 , 2.621 ug/m3 , 4.413 ug/m3, with the super-micron contribution to total concentration averaging 47%, 45%, and 81% respectively. In contrast, low dust days (Ca2+ < 0.2ug/m3) the super-micron concentrations averaged 0.262 ug/m3, 0.510 ug/m3, -0.029 ug/m3, respectively and accounted for just 20%, 14%, and 8% of total mass. During the dust events, samples that have trajectories passing over industrial centers in eastern China approached equivalence balance between Ca2++ NH4+ and SO42-+NO3-. In contrast dusty samples that did not pass over these industrial centers during transport to the West Sea and Korea maintained excess cations, dominantly Ca2+. This suggests that dust can act as an important carrier of Chinese pollution to Korea when this saturated dust reaches the peninsula.

Uropygial gland volatiles may code for olfactory information about sex, individual, and species in Bengalese finches Lonchura striata

Directory of Open Access Journals (Sweden)

Jian-Xu ZHANG et al.

2009-10-01

Full Text Available Over-shadowed by eye-catching vocal and visual signals, chemical communication has long been overlooked in birds. This study aimed at exploring whether volatile composition of the uropygial gland secretion (UGS of birds was associated with the information about sex, individual and species. By using dichloromethane extraction and gas chromatography-mass spectrometry (GC-MS, we analyzed the UGS volatiles of domesticated Bengalese finches (Lonchura striata, Estrildiea which is also known as white-rumped munias. We characterized 16 volatile molecules from the UGS, including eight n-alkanols, five diesters, an ester, an aldehyde and a fatty acid, and quantified them in terms of GC peak area percentages (relative abundances. Among these compounds, hexadecanol and octadecanol were major components in both sexes. The former was richer in males than females and the latter richer in females than males, suggesting that they might be male and female pheromone candidates, respectively. The high inter-individual variations, in relative abundance, of the UGS volatiles implied that they might carry information about individuality. The similarity between GC profiles of the UGS and wing feather from same individuals indicates that the birds might preen the secretion to their feathers to transmit chemical cues. Additionally, by comparing with three sympatric passerine species,i.e., zebra finches Taeniopygia guttata, yellow-bowed buntings Emberiza chrysophrys and rooks Corvus frugilegus, we found that the composition of C13-C18 alkanols in the UGS might contain information about species. Our study also show that quantitative differences (degree of same UGS volatiles might be the key for the Bengalese finch to code for information about sex and individuality whereas both the kind and degree of UGS constituents could be utilized to code for information about species [Current Zoology 55 (5:–2009].

Enhanced technologies for unattended ground sensor systems

Science.gov (United States)

Hartup, David C.

2010-04-01

Progress in several technical areas is being leveraged to advantage in Unattended Ground Sensor (UGS) systems. This paper discusses advanced technologies that are appropriate for use in UGS systems. While some technologies provide evolutionary improvements, other technologies result in revolutionary performance advancements for UGS systems. Some specific technologies discussed include wireless cameras and viewers, commercial PDA-based system programmers and monitors, new materials and techniques for packaging improvements, low power cueing sensor radios, advanced long-haul terrestrial and SATCOM radios, and networked communications. Other technologies covered include advanced target detection algorithms, high pixel count cameras for license plate and facial recognition, small cameras that provide large stand-off distances, video transmissions of target activity instead of still images, sensor fusion algorithms, and control center hardware. The impact of each technology on the overall UGS system architecture is discussed, along with the advantages provided to UGS system users. Areas of analysis include required camera parameters as a function of stand-off distance for license plate and facial recognition applications, power consumption for wireless cameras and viewers, sensor fusion communication requirements, and requirements to practically implement video transmission through UGS systems. Examples of devices that have already been fielded using technology from several of these areas are given.

Azobenzene dye-coupled quadruply hydrogen-bonding modules as colorimetric indicators for supramolecular interactions

Directory of Open Access Journals (Sweden)

Yagang Zhang

2012-04-01

Full Text Available The facile coupling of azobenzene dyes to the quadruply hydrogen-bonding modules 2,7-diamido-1,8-naphthyridine (DAN and 7-deazaguanine urea (DeUG is described. The coupling of azobenzene dye 2 to mono-amido DAN units 4, 7, and 9 was effected by classic 4-(dimethylaminopyridine (DMAP-catalyzed peptide synthesis with N-(3-dimethylaminopropyl-N’-ethyl carbodiimide hydrochloride (EDC as activating agent, affording the respective amide products 5, 8, and 10 in 60–71% yield. The amide linkage was formed through either the aliphatic or aromatic ester group of 2, allowing both the flexibility and absorption maximum to be tuned. Azobenzene dye 1 was coupled to the DeUG unit 11 by Steglich esterification to afford the product amide 12 in 35% yield. Alternatively, azobenzene dye 16 underwent a room-temperature copper-catalyzed azide–alkyne Huisgen cycloaddition with DeUG alkyne 17 to give triazole 18 in 71% yield. Azobenzene coupled DAN modules 5, 8, and 10 are bright orange–red in color, and azobenzene coupled DeUG modules 12 and 18 are orange–yellow in color. Azobenzene coupled DAN and DeUG modules were successfully used as colorimetric indicators for specific DAN–DeUG and DAN–UPy (2-ureido-4(1H-pyrimidone quadruply hydrogen-bonding interactions.

Low-frequency oscillations in radiative-convective models

Energy Technology Data Exchange (ETDEWEB)

Hu, Qi; Randall, D.A.

1991-12-31

Although eastward propagation is usually regarded as an essential feature of the low-frequency ``Madden-Julian oscillation`` observed in the tropical atmosphere, many observations indicate that there is an important stationary or quasi-stationary component of the oscillation. Yasunari (1979), for example, investigated the stationary 30--60 day variation in upper tropospheric cloudiness in the Asian summer monsoon region. In a case study of the 30--60 day oscillation. Hsu et al. (1990) found a strong stationary oscillation of the divergence, outgoing longwave mdiadon and other fields. A recent observational study by Weickmann and Khalsa (1990) offers further evidence that the Madden-Julian oscillation has an important stationary component. In this paper, we present evidence that intraseasonal oscillations can be produced by local radiative and convective processes. This suggests that the observed propagating Madden-Julian wave is produced by interactions between these local processes and the large scale motion field, and is not essential for the existence of the observed oscillation.

Low-frequency oscillations in radiative-convective models

Energy Technology Data Exchange (ETDEWEB)

Hu, Qi; Randall, D.A.

1991-01-01

Although eastward propagation is usually regarded as an essential feature of the low-frequency Madden-Julian oscillation'' observed in the tropical atmosphere, many observations indicate that there is an important stationary or quasi-stationary component of the oscillation. Yasunari (1979), for example, investigated the stationary 30--60 day variation in upper tropospheric cloudiness in the Asian summer monsoon region. In a case study of the 30--60 day oscillation. Hsu et al. (1990) found a strong stationary oscillation of the divergence, outgoing longwave mdiadon and other fields. A recent observational study by Weickmann and Khalsa (1990) offers further evidence that the Madden-Julian oscillation has an important stationary component. In this paper, we present evidence that intraseasonal oscillations can be produced by local radiative and convective processes. This suggests that the observed propagating Madden-Julian wave is produced by interactions between these local processes and the large scale motion field, and is not essential for the existence of the observed oscillation.

Homocysteine-lowering effect of 500 ug folic acid every other day versus 250 ug/day

NARCIS (Netherlands)

Brouwer, I.A.; Rooij, van I.A.L.M.; Dusseldorp, van M.; Thomas, C.M.G.; Blom, H.J.; Hautvast, J.G.A.J.; Eskes, T.K.A.B.

2000-01-01

Elevated plasma total homocysteine (tHcy) concentrations are a risk factor for neural tube defects and vascular diseases. Supplementation with folic acid decreases tHcy. We investigated whether supplementation with 500 ?g folic acid every other day is as effective in lowering tHcy as 250 ?g folic

Next-generation Surface Enhanced Raman Scattering (SERS) Substrates for Hazard Detection

Science.gov (United States)

2012-09-01

substrates at differing concentrations ranging from 0.05 ug/cm2 to 50 ug/cm2. These concentrations were independently validated by UV -Vis...standard Klarite substrates at a concentration of 5.0 ug/cm2. The concentration jetted was validated using a secondary UV -Vis technique.(20, 81) After... Spectros ., 994 (1997). [58] Alexander, T.A., Le, D.M., "Characterization of a commercialized SERS-active substrate and its application to the

Enhancement Nisin Activity By Some Natural Additives

International Nuclear Information System (INIS)

Hussien, H.A.; El-Fouly, M.E.; Zayed, M.N.; Harroun, M.B.

2010-01-01

Nisin showed great inhibition of gram positive bacteria while it had no effect on gram negative bacteria or yeast.It is clear from the present study that 250ug/ml of nisin was lethal for S .aureus but this dose decreased to 25 ug/ml when combined with 0.05% of citric acid or 0.1% of lactic acid or 0.4% of cinnamon. Although nisin had no effect on P. aeruginosa but when 200ug/ml of nisin combined with 0.2% of citric acid or 0.1% of lactic acid or 2% of cinnamon P. aeruginosa completely inhibited.In the same manner 200ug/ml of nisin was sufficient to inhibit Debaryomyces sp. growth when combined by 3% of citric or 3.5% of lactic or 2% of cinnamon. On the other hand, 25 μg/ml of nisin reduced the following lethal concentrations of S .aureus from0.2% to 0.05%, 0.15% to 0.1% and from 1.2% to 0.4% for citric acid, lactic acid and cinnamon, respectively. While. 200 ug/ml of nisin decreased the following lethal concentrations of P. aeruginosa from 0.3% to 0.2%, 0.3% to 0.1% and from 4% to 2% for citric acid, lactic acid and cinnamon, respectively. Two hundred ug/ml of nisin decreased lethal concentrations of Debaryomyces sp. from4% to 3%, 4.5% to 3.5% for citric acid and lactic acid, respectively. Two hundred ug/ml of nisin did not reduce cinnamon lethal dose.

Persistence of 14C maneb in lettuce plants an soil

International Nuclear Information System (INIS)

Bennaceur, M.; Sennaoui, Z.; Meguenni, H.

1992-10-01

Maneb residue is studied on lettuce plant and soil after spraying on greenhouse with 14C maneb. The residues declined with time. After 37 days from the application, 14C maneb residues in water extracts declined to 1,5. 10-2ug/g from 5,8. 10-1ug/g of the zero day sample in lettuce plants and 4,6. 10-3ug/g from 1,73. 10-1ug/g in soil. The 14C internals residues in lettuce and soil increase respectively till 16 days and 24 days, then decrease to 88% and 4,05% after 37 days. ETU was present in lettuce plant after 8 days then decreases with time. Two metabolites were identified by TLC (EU,ETU)

Underground gas storage Lobodice geological model development based on 3D seismic interpretation

International Nuclear Information System (INIS)

Kopal, L.

2015-01-01

Aquifer type underground gas storage (UGS) Lobodice was developed in the Central Moravian part of Carpathian foredeep in Czech Republic 50 years ago. In order to improve knowledge about UGS geological structure 3D seismic survey was performed in 2009. Reservoir is rather shallow (400 - 500 m below surface) it is located in complicated locality so limitations for field acquisition phase were abundant. This article describes process work flow from 3D seismic field data acquisition to geological model creation. The outcomes of this work flow define geometry of UGS reservoir, its tectonics, structure spill point, cap rock and sealing features of the structure. Improving of geological knowledge about the reservoir enables less risky new well localization for UGS withdrawal rate increasing. (authors)

Efecto de un extracto hidroalcohólico de Uncaria tomentosa (uña de gato sobre la población de células dendríticas y sus moléculas hla-dr y cd86 ante el estímulo con lipopolisacáridos

Directory of Open Access Journals (Sweden)

Iván Lozada-Requena

2009-04-01

Full Text Available Objetivo. Determinar el efecto de un extracto hidroalcohólico de uña de gato, Uncaria tomentosa (UG sobre células dendríticas (DC de sangre periférica y la expresión de HLA-DR y CD86 en muestras de sangre periférica de individuos sanos tratadas con lipopolisacáridos (LPS. Materiales y métodos. El polvo de la corteza de UG se preparó como una decocción estéril a 30g/L por 30 minutos. Se obtuvo muestras de sangre periférica de individuos sanos. Las células mononucleares de sangre periférica (CMSP fueron separadas por gradiente de centrifugación, pretratadas o no durante dos horas con distintas concentraciones de UG y estimuladas 24 h con LPS, luego fueron marcadas con anticuerpos monoclonales fluorescentes específicos para HLA-DR, Linaje tipo 1 (Lin1, CD11c y CD86 y preparadas para la citometría de flujo. Resultados. Comparando con el grupo de CMSP con LPS pero sin UG se observó, de manera dosis dependiente, una disminución en el porcentaje de DC mieloides (DCm (p<0,05 y una tendencia a incrementar el porcentaje de DC plasmacitoides (DCp. En las DCp se observó una disminución de la intensidad de fluorescencia media (IFM de HLA-DR sólo a 500 y 1000 μg/mL de UG (p<0,001; mientras que hubo un incremento de la IFM de CD86 en todo el rango (p<0,05. En DCm a las mismas concentraciones no se observó efecto de UG sobre la IFM de HLA-DR y CD86. Conclusiones. Este extracto estandarizado de UG tiende a incrementar el porcentaje de DCp y disminuye el porcentaje de DCm. UG no afecta la expresión de HLA-DR y CD86 en DCm. Este estudio demuestra que este extracto de UG favorece la activación/diferenciación de DCp, la cual participa en mecanismos de respuesta inmune adaptativa.

Underground gas storage in the World - Cedigaz survey

International Nuclear Information System (INIS)

Benquey, R.

2010-01-01

The 2010 edition of 'Underground Gas Storage in the World' provides an update to the previous survey released by CEDIGAZ in 2006. At that time, 610 underground gas storage (UGS) facilities were in operation worldwide, with a working capacity of 319 billion cubic metres (bcm). As of 1 January 2010, this number had reached 642 facilities with a working gas capacity of 333 bcm, or 10.8% of world gas consumption. By 2020, the global UGS demand is expected to grow at a pace of 3.3% per year, and according to the projects identified, more than 760 UGS sites could be active in the world with a total working capacity of approximately 465 bcm. In this survey, CEDIGAZ analyses the following trends which characterise the rapid development of underground gas storage in the world: - the strong dynamics of the European storage market, where 127 projects could add 75 bcm of working capacity by 2020, - the continued development of the UGS market in the United States (49 projects), encouraged by market-based rates allowed by the FERC, and rapid permitting processes, - the development of facilities in countries with little or no storage capacities at present, in Asia/Oceania, the C.I.S., and Eastern Europe in particular. This survey provides an analysis of the recent evolutions in the technic-economic aspects of the underground gas storage business, as well as an overview of the UGS markets and their developments in the world, country by country. A specific section is dedicated to the analysis of future UGS needs in Europe by 2020: - Technic-economic aspects of UGS: This part of the survey analyses the latest technical improvements and research axes in the field of underground gas storage. As it is more difficult to build greenfield storage facilities, a lot of work has been done to improve the performance and flexibility of existing storage sites. This section also deals with the evolution of investment and operational costs in storage over the last few years. Furthermore, the

Digital Archiving: Where the Past Lives Again

Science.gov (United States)

Paxson, K. B.

2012-06-01

The process of digital archiving for variable star data by manual entry with an Excel spreadsheet is described. Excel-based tools including a Step Magnitude Calculator and a Julian Date Calculator for variable star observations where magnitudes and Julian dates have not been reduced are presented. Variable star data in the literature and the AAVSO International Database prior to 1911 are presented and reviewed, with recent archiving work being highlighted. Digitization using optical character recognition software conversion is also demonstrated, with editing and formatting suggestions for the OCR-converted text.

The Clinical Spectrum of Plumbism; an Experience from a Tertiary Care Hospital in Karachi, Pakistan

Directory of Open Access Journals (Sweden)

Lena Jafri

2017-12-01

Full Text Available Background:Lead toxicity continues to remain a concerning health problem for developing nations like Pakistan. Due to the lack of studies, we aim to highlight the clinical spectrum of lead poisoning in patients presenting to an urban-based tertiary care hospital in Pakistan. Method:This is a retrospective review of patients admitted form January 2011 to December 2014 using a structured questionnaire for recording demographics, comorbidities, clinical findings, biochemical abnormalities, clinical findings and treatment provided. Patients were categorized as children (≤18yrs and adults (>18yrs, further divided into three groups; desired blood lead levels (BLLs [lead levels 70ug/dl]. Result: A total of 86 patients were included in the final analysis, majority (69.6% of whom were adult males with median age of 35 yrs. Median (IQR BLL was 6.3 ug/dl (12.8-2.7 in all age groups with BLL in children and adults of 4.2 ug/dl (3.1-5.7 and 6.5 ug/dl (2.6-14.7, respectively. 72% of the children had complaints related to the central nervous system with majority complaining of irritability. The gastrointestinal system was most commonly implicated in adults (93% with most common complaint of abdominal pain. The commonest risk factor showing a positive correlation with BLLs was battery handling in adults [median (IQR BLL 18.4ug/dl (8.35-36.1] and pica eating in children with BLLs in high but non-toxic range [median (IQR BLL 5.2ug/dl (2.7-5.7]. The highest BLLs were observed to lie within the high but non-toxic range group in one adult herbal medicine user (54.4 ug/dl and in children observed in the toxic range group (>10ug/dl due to occupational battery work exposure and residence in a congested zone.   Conclusion:Lead toxicity continues to be hazardous due to unchecked environmental and occupational exposure. Increasing awareness is tantamount in order to find a solution.

Immobilization of Aspergillus niger. beta. -D-glucosidase on aminated chitin and alumina/alginate

Energy Technology Data Exchange (ETDEWEB)

Bon, E.; Freire, D.; Mendes, M.F.; Soares. V.F.

1986-01-01

The immobilization of ..beta..-glucosidase was studied by (a) covalent coupling to aminated chitin (IME-C) and (b) adsorption onto alumina followed by gel entrapment of the suspension with calcium alginate (IME-A). The levels of catalytic activity determined against salicin at 50 C were 23.0 U/g and 0.2 U/g for the IME-C and IMA-A respectively. The first system was shown to be quite stable with a loss of only 2% of the initial activity over 14 days. The IME-A system had a half life of 14 days. The activity of IME-C was studied using cellobiose and enzymatic hydrolysates of sugar cane bagasse at several cellobiose concentrations. The activities obtained with cellobiose were 104.0 U/g and 72.0 U/g respectively. 13 references.

BIOACTIVITIES AND MECHANISM OF SPIRO ENOL ETHER ANALOGUES AGAINST PIERIS RAPAE

Institute of Scientific and Technical Information of China (English)

Zhi-xiangZhang; Dong-meiCheng; Han-hongXu; Yu-linWu; andJun-faFan

2004-01-01

Nineteen kinds of spiro enol ether analogues were screened with larvae of Pieris rapae for antifeedant activity. The results showed that the antifeedant activity of compounds No.20 and No.12 was higher than others. In non-choice test, AFC50 values within 24 h of compounds No.20 and No.12 against 3rd instar larvae of P. rapae were 226.93ug/mL and 370.00ug/mL, and that in choice test against 4th larvae were 280.54 ug/mL and 398.88 ug/mL, respectively. Compd. No.20 could prolong the eggs hatch time and reduce the haemolymph content and the protein content in haemolymph of 4th instar larvae obviously. Compd. No.20 could protect tested leaves and control larvae of P. rapae effectively.

The concentration of cadmium in hepatoma among Filipinos

International Nuclear Information System (INIS)

Alejandrino, A.L.; Goze, C.B.; Paradero, R.R.

1977-08-01

The concentration of cadmium in liver hepatoma and in normal liver in Filipinos was determined by atomic absorption spectrophotometry. Using NBS Bovine Liver (SRM1577) as reference material, a value of 0.28+-0.025 ug/g dry weight was obtained for cadmium which is close to the certified NBS value of 0.27+-0.04 ug/g. The mean percentage recovery for cadmium determination by AAS was 98.38%. A mean value of 2.14+-1.58 ug Cd/g liver hepatoma was observed for the 12 cases investigated, showing decreased cadmium levels in the cancerous liver compared to the mean value of 12.62 ug Cd/g observed for normal liver obtained from 10 cases of accidental deaths. The values are expressed on a dry weight basis

Lipase production by Penicillium restrictum using solid waste of industrial babassu oil production as substrate.

Science.gov (United States)

Palma, M B; Pinto, A L; Gombert, A K; Seitz, K H; Kivatinitz, S C; Castilho, L R; Freire, D M

2000-01-01

Lipase, protease, and amylase production by Penicillium restrictum in solid-state fermentation was investigated. The basal medium was an industrial waste of babassu oil (Orbignya oleifera) production. It was enriched with peptone, olive oil, and Tween-80. The supplementation positively influenced both enzyme production and fungal growth. Media enriched with Tween-80 provided the highest protease activity (8.6 U/g), whereas those enriched with peptone and olive oil led to the highest lipase (27.8 U/g) and amylase (31.8 U/g) activities, respectively.

Use of a simplified spectrophotometric method for quantitative determination of glucose-6-phosphate dehydrogenase activity in normal children from two day-care centers of the city of São Paulo

Directory of Open Access Journals (Sweden)

Roberto Muller

2003-06-01

Full Text Available Objective: To evaluate the applicability of a simplified method forquantitative determination of glucose-6-phosphate dehydrogenaseactivity in normal children; to determine the mean, standarddeviation and threshold value under which the enzyme activity isconsidered deficient. Methods: Blood samples were collected from201 children from two day-care centers in the city of São Paulo.The subjects were considered normal based on physicalexamination and laboratory tests. The enzyme activity wasdetermined in red blood cells of normal children using the “TestCombination G-6-PDH®” kit. The following statistical analyses werecarried out: the results were submitted to Student’s t test,Kolmogorov-Smirnov test, lower confidence interval (one-tailedtest and Spearman’s correlation coefficient. Results: The meanhemoglobin value for girls was slightly higher than the mean valuefor boys, but this difference was not statistically significant. Therewas no statistical difference in mean enzyme activities for Caucasianand non-Caucasian children. There was no significant correlation amongenzyme activity levels, red blood cells, hemoglobin levels,hematocrit, reticulocytes, white blood cells and age of patients.The mean enzyme activity for boys was 4.448 U/g Hb, standarddeviation = 1.380 U/g Hb. For girls, the mean enzyme activity was4.531 U/g Hb, standard deviation = 1.386 U/g Hb, and the differencewas not statistically significant. Therefore, the two populationgroups were considered as one single population, presenting amean enzyme activity of 4.490 U/g Hb, standard deviation = 1.380 U/g Hb.Since the distribution curve of enzyme activity values was normal,a lower confidence interval was determined (one-tailed test, witha cutoff point of 2.227 U/g Hb. Conclusion: The method used bySolem proved to be simple, fast, very accurate and useful to detectglucose-6-phosphate dehydrogenase activity and to identifychildren with enzyme deficiency.

Cloning the uteroglobin gene promoter from the relic volcano rabbit (Romerolagus diazi) reveals an ancient estrogen-response element.

Science.gov (United States)

Acosta-MontesdeOca, Adriana; Zariñán, Teresa; Macías, Héctor; Pérez-Solís, Marco A; Ulloa-Aguirre, Alfredo; Gutiérrez-Sagal, Rubén

2012-05-01

To gain further insight on the estrogen-dependent transcriptional regulation of the uteroglobin (UG) gene, we cloned the 5'-flanking region of the UG gene from the phylogenetically ancient volcano rabbit (Romerolagus diazi; Rd). The cloned region spans 812 base pairs (bp; -812/-1) and contains a noncanonical TATA box (TACA). The translation start site is 48 bp downstream from the putative transcription initiation site (AGA), and is preceded by a consensus Kozak box. Comparison of the Rd-UG gene with that previously isolated from rabbits (Oryctolagus cuniculus) showed 93% in sequence identity as well as a number of conserved cis-acting elements, including the estrogen-response element (ERE; -265/-251), which differs from the consensus by two nucleotides. In MCF-7 cells, 17β-estradiol (E(2)) induced transcription of a luciferase reporter driven by the Rd-UG promoter in a similar manner as in an equivalent rabbit UG reporter; the Rd-UG promoter was 30% more responsive to E(2) than the rabbit promoter. Mutagenesis studies on the Rd-ERE confirmed this cis-element as a target of E(2) as two luciferase mutant reporters of the Rd-promoter, one with the rabbit and the other with the consensus ERE, were more responsive to the hormone than the wild-type reporter. Gel shift and super-shift assays showed that estrogen receptor-α indeed binds to the imperfect palindromic sequence of the Rd-ERE. Copyright © 2012 Wiley Periodicals, Inc.

Smartphone and Universal Goniometer for Measurement of Elbow Joint Motions: A Comparative Study

Science.gov (United States)

Behnoush, Behnam; Tavakoli, Nasim; Bazmi, Elham; Nateghi Fard, Fariborz; Pourgharib Shahi, Mohammad Hossein; Okazi, Arash; Mokhtari, Tahmineh

2016-01-01

Background Universal goniometer (UG) is commonly used as a standard method to evaluate range of motion (ROM) as part of joint motions. It has some restrictions, such as involvement of both hands of the physician, leads to instability of hands and error. Nowadays smartphones usage has been increasing due to its easy application. Objectives The study was designed to compare the smartphone inclinometer-based app and UG in evaluation of ROM of elbow. Materials and Methods The maximum ROM of elbow in position of flexion and pronation and supination of forearm were examined in 60 healthy volunteers with UG and smartphone. Data were analyzed using SPSS (ver. 16) software and appropriate statistical tests were applied, such as paired t-test, ICC and Bland Altman curves. Results The results of this study showed high reliability and validity of smartphone in regarding UG with ICC > 0.95. The highest reliability for both methods was in elbow supination and the lowest was in the elbow flexion (0.84). Conclusions Smartphones due to ease of access and usage for the physician and the patient, may be good alternatives for UG. PMID:27625754

Taking it easy when playing ultimatum game with a Down syndrome proposer: Effects on behavior and medial frontal negativity.

Science.gov (United States)

Rêgo, Gabriel Gaudencio; Campanhã, Camila; do Egito, Julia Horta Tabosa; Boggio, Paulo Sérgio

2017-10-01

The ultimatum game (UG) is an endowment sharing game in which a proposer suggests a division of an asset to a recipient, who must accept or reject it. Economic studies showed that despite recipients usually rejecting unfair offers, perception and reaction to unfairness are highly dependent on who is the proposer. Event-related potentials (ERPs) commonly detected in UG games are the medial frontal negativity (MFN), a component detected in recipients facing unfair offers, and the P300, a component related to attentional and memory processes. Given this, we aimed to investigate the behavioral and ERP responses of healthy people playing the UG game with Down syndrome (DS) and typical development (TD) proposers. Nineteen subjects participated in this study. The UG behavioral data were similar to previous studies. ERP analysis showed no MFN in participants facing unfair offers. A higher P300 amplitude was detected when participants faced fair offers from TD compared to DS fair offers. We also found a positive correlation between P300 amplitude for TD offers and self-esteem scale score. Together these findings indicate that insertion of an atypical player in the UG led to changes in participants' perception and expectancy of the game.

Unigene BLAST: CBRC-MDOM-06-0030 [SEVENS

Lifescience Database Archive (English)

Full Text Available ed neurotrophic factor (BDNF), mRNA /cds=p(1,786) /gb=XM_001368353 /gi=126332213 /ug=Mdm.339 /len=786 0.026 33% ... ...CBRC-MDOM-06-0030 gnl|UG|Mdm#S37377868 PREDICTED: Monodelphis domestica brain-deriv

report general | 1-Overview | 5-Publications | Indian Academy of ...

Indian Academy of Sciences (India)

In this process, the advantages offered by distance education methods should also be exploited. ... The U.G. course should be solid and broad based, providing a good ... Thus all U.G. students should take some common courses in physics, ...

Heavy Metals Contamination in Coastal Sediments of Karachi, Pakistan

Science.gov (United States)

Siddique, A.; Mumtaz, M.; Zaigham, N. A.; Mallick, K. A.; Saied, S.; Khwaja, H. A.

2008-12-01

Toxic compounds such as heavy metals exert chronic and lethal effects in animals, plants, and human health. With the rapid industrialization, urbanization, and economic development in Karachi, heavy metals are continuing to be introduced to estuarine and coastal environment through rivers, runoff and land-based point sources. Pollution in the Karachi coastal region (167 km long) is mainly attributed to Lyari and Malir Rivers flowing through the city of Karachi. Both rivers are served by various channels of domestic and industrial wastes carrying more than 300 million gallons per day untreated effluent of 6000 industries and ultimately drain into the beaches of Arabian Sea. Concentrations of selected heavy metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) in surface sediments from eighty-eight sites in Karachi coastal region were studied in order to understand metal contamination due to industrialization, urbanization, and economic development in Karachi. Sediment samples were collected in 2005 and 2006. We have found that heavy metal concentrations in surface sediments varied from 0.006 to 24.3 ug/g for Cd, 5.1 to 95 ug/g for Co, 2.9 to 571 ug/g for Cr, 6.9 to 272 ug/g for Cu, 0.55 to 6.5% for Fe, 1.2 to 318 ug/g for Mn, 7.5 to 75 ug/g for Ni, 6.3 to 121 ug/g for Pb, and 3.3 to 389 ug/g for Zn. Enrichment factors (EFs) were calculated to assess whether the concentrations observed represent background or contaminated levels. The highest levels of metals were found to be at the confluence of the Lyari and Malir River streams at the Arabian Sea, indicating the impact of the effluents of the highly urbanized and industrialized city of Karachi. Furthermore, this study assessed heavy metal toxicity risk with the application of Sediment Quality Guideline (SQG) indices (effect range low/effect range median values, ERL/ERM). Results indicated that the potential toxicity of marine environment can cause adverse biological effects to the biota directly and the human health

Effects of visibility and types of the ground surface on the muscle activities of the vastus medialis oblique and vastus lateralis

Science.gov (United States)

Park, Jeong-ki; Lee, Dong-yeop; Kim, Jin-Seop; Hong, Ji-Heon; You, Jae-Ho; Park, In-mo

2015-01-01

[Purpose] The purpose of this study was to compare the effects of visibility and types of ground surface (stable and unstable) during the performance of squats on the muscle activities of the vastus medialis oblique (VMO) and vastus lateralis (VL). [Subjects and Methods] The subjects were 25 healthy adults in their 20s. They performed squats under four conditions: stable ground surface (SGS) with vision-allowed; unstable ground surface (UGS) with vision-allowed; SGS with vision-blocked; and UGS with vision-blocked. The different conditions were performed on different days. Surface electromyogram (EMG) values were recorded. [Results] The most significant difference in the activity of the VMO and VL was observed when the subjects performed squats on the UGS, with their vision blocked. [Conclusion] For the selective activation of the VMO, performing squats on an UGS was effective, and it was more effective when subjects’ vision was blocked. PMID:26356407

Hedonic pricing analysis of the influence of urban green spaces onto residential prices : the case of Leipzig, Germany

NARCIS (Netherlands)

Liebelt, Veronika; Bartke, Stephan; Schwarz, Nina

2018-01-01

In the light of global urbanization and biodiversity loss, ecosystem services provided by urban green spaces (UGS) are becoming increasingly important, not least as a recovery and recreation opportunity for citizens. The valuation of UGS is significant for urban planners, who make decisions on the

Unigene BLAST: CBRC-TGUT-29-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-29-0000 gnl|UG|Tgu#S36163076 Taeniopygia guttata clone 0057P0006B02 megalencephalic leukoencephalo...pathy with subcortical cysts 1-like mRNA, complete sequence /gb=EF191703 /gi=120431699 /ug=Tgu.3485 /len=1532 1.8 21% ...

Language specific bootstraps for UG categories

NARCIS (Netherlands)

van Kampen, N.J.

2005-01-01

This paper argues that the universal categories N/V are not applied to content words before the grammatical markings for reference D(eterminers) and predication I(nflection) have been acquired (van Kampen, 1997, contra Pinker, 1984). Child grammar starts as proto-grammar with language-specific

Laparoscopic-assisted vaginal pull-through: A new approach for congenital adrenal hyperplasia patients with high urogenital sinus

Directory of Open Access Journals (Sweden)

Jacques Birraux

2015-01-01

Full Text Available Background: To open vaginal cavity to the pelvic floor is part of surgical treatment for urogenital sinus (UGS in girls with congenital adrenal hyperplasia (CAH. For high UGS, this operative procedure can be challenging and may jeopardise urinary continence. Combined perineal and laparoscopic approaches could be useful to minimise perineal dissection and to facilitate the vaginal lowering. Patients and Methods: We report the procedure of a laparoscopic-assisted vaginal pull-through for supra-sphincteric UGS in a 5-year-old girl with CAH. Laparoscopic dissection of the vagina from the posterior wall of the bladder and urethra, division of the confluence and vaginal pull-through to the perineum are described. Discussion: The technique is derived from laparoscopic-assisted treatment for high ano-rectal malformations. Compared with current procedures for treatment for high UGS, laparoscopic-assisted approach allows mobilising vagina with minimal dissection of perineum and complete preservation of urethra. Another major advantage is to provide a direct vision for dissection of the space between rectum and urethra prior to vaginal pull-through. Conclusion: Laparoscopic-assisted vaginal pull-through appears to be an interesting approach for high UGS in CAH patients, reducing dissection and risk of urinary incontinence. This new approach needs to be strengthened by other cases.

When Will It Be …?: U.S. Naval Observatory Religious Calendar Computers Expanded

Science.gov (United States)

Bartlett, Jennifer L.; Chizek Frouard, Malynda; Ziegler, Cross; Lesniak, Michael V.

2017-01-01

Reflecting increasing sensitivity to differing religious practices, the U.S. Naval Observatory (USNO) has expanded its on-line calendar resources to compute additional religious dates for specific years via an Application Programming Interface (API). This flexible method now identifies Christian, Islamic, and Jewish events in JavaScript Object Notation (JSON) that anyone can use.Selected Christian Observances (http://aa.usno.navy.mil/data/docs/easter.php) returns dates of eight events for years after 1582 C.E. (A.D. 1582): Ash Wednesday, Palm Sunday, Good Friday, Easter, Ascension, Whit Sunday, Trinity Sunday, and the first Sunday of Advent. The determination of Easter, a moveable feast, uses the method of western Christian churches.Selected Islamic Observances (http://aa.usno.navy.mil/data/docs/islamic.php) returns approximate Gregorian dates of three events for years after 1582 C.E. (A.H. 990) and Julian dates for 622-1582 C.E. (A.H. 1-990) along with the corresponding Islamic year (anno Hegirae). Ramadân, Shawwál, and the Islamic year begin at sunset on the preceding Gregorian or Julian date. For planning purposes, the determination of these dates uses a tabular calendar; in practice, observation of the appropriate waxing crescent Moon determines the actual date, which may vary.Selected Jewish Observances (http://aa.usno.navy.mil/data/docs/passover.php) returns Gregorian dates of six events for years after 1582 C.E. (A.M. 5342) and Julian dates for the years 360-1582 C.E. (A.M. 4120-5342) along with the corresponding Jewish year (anno Mundi). Passover, Shavuot, Rosh Hashanah, Yom Kippur, and Hanukkah begin at sunset on the preceding Gregorian or Julian date.On-line documentation for using the API-enabled calendar computers, including sample calls, is available (http://aa.usno.navy.mil/data/docs/api.php). The webpage also describes how to use the API with the Complete Sun and Moon Data for One Day, Phases of the Moon, Solar Eclipse Computer, Day and Night

Unigene BLAST: CBRC-ATHA-03-0010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ATHA-03-0010 gnl|UG|At#S11719378 Arabidopsis thaliana ATARP9 (ACTIN-RELATED PR...OTEIN 9); protein binding (ATARP9) mRNA, complete cds /cds=p(235,2025) /gb=NM_123716 /gi=30694311 /ug=At.26311 /len=2187 0.47 36% ...

Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 0.0 100% ...

Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 100% ...

Unigene BLAST: CBRC-HSAP-23-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-23-0071 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 0.0 95% ...

Unigene BLAST: CBRC-ATHA-05-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ATHA-05-0034 gnl|UG|At#S11736431 Arabidopsis thaliana ATMPK19 (Arabidopsis tha...liana MAP kinase 19); MAP kinase (ATMPK19) mRNA, complete cds /cds=p(1,1761) /gb=NM_112333 /gi=30683276 /ug=At.8069 /len=1897 6.9 42% ...

Pramana – Journal of Physics | News

Indian Academy of Sciences (India)

A novel pedagogical technique is presented that can be used in the undergraduate (UG) class to formulate a relativistically extended kinetic theory of gases and thermal speed distribution, while assuming the basic thermal symmetry arguments of the famous Maxwell–Boltzmann distribution as presented at the UG level.

Unigene BLAST: CBRC-FRUB-02-0691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0691 gnl|UG|Tru#S21434263 AL836416 EFRd Takifugu rubripes cDNA clone EFRd031apc...G19, mRNA sequence /clone=EFRd031apcG19 /gb=AL836416 /gi=21878378 /ug=Tru.2410 /len=418 0.24 31% ...

Unigene BLAST: CBRC-FRUB-02-0424 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0424 gnl|UG|Tru#S21433401 AL835449 EFRb Takifugu rubripes cDNA clone EFRb017apc...D5, mRNA sequence /clone=EFRb017apcD5 /gb=AL835449 /gi=21877411 /ug=Tru.1107 /len=522 8.4 39% ...

Unigene BLAST: CBRC-FRUB-02-0750 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0750 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.9 26% ...

Unigene BLAST: CBRC-FRUB-02-0743 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0743 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 1.4 26% ...

Unigene BLAST: CBRC-FRUB-02-0642 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0642 gnl|UG|Tru#S21434581 AL836626 EFRe Takifugu rubripes cDNA clone EFRe005apc...A11, mRNA sequence /clone=EFRe005apcA11 /gb=AL836626 /gi=21878588 /ug=Tru.118 /len=378 3.6 33% ...

Unigene BLAST: CBRC-FRUB-02-0924 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0924 gnl|UG|Tru#S21434557 AL836584 EFRe Takifugu rubripes cDNA clone EFRe005apc...K15, mRNA sequence /clone=EFRe005apcK15 /gb=AL836584 /gi=21878546 /ug=Tru.1833 /len=509 7.4 31% ...

Unigene BLAST: CBRC-FRUB-02-0627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0627 gnl|UG|Tru#S21434842 AL836687 EFRe Takifugu rubripes cDNA clone EFRe005apc...N22, mRNA sequence /clone=EFRe005apcN22 /gb=AL836687 /gi=21878649 /ug=Tru.3747 /len=363 1.4 48% ...

Unigene BLAST: CBRC-FRUB-02-0118 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0118 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 2.4 33% ...

Unigene BLAST: CBRC-FRUB-02-0587 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0587 gnl|UG|Tru#S21435116 AL837106 EFRf Takifugu rubripes cDNA clone EFRf030apc...H13, mRNA sequence /clone=EFRf030apcH13 /gb=AL837106 /gi=21879068 /ug=Tru.387 /len=294 4.9 35% ...

Unigene BLAST: CBRC-FRUB-02-0677 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0677 gnl|UG|Tru#S21435495 AL837483 EFRj Takifugu rubripes cDNA clone EFRj028apc...P21, mRNA sequence /clone=EFRj028apcP21 /gb=AL837483 /gi=21879445 /ug=Tru.1777 /len=323 7.9 50% ...

Unigene BLAST: CBRC-FRUB-02-0784 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0784 gnl|UG|Tru#S21434499 AL836465 EFRd Takifugu rubripes cDNA clone EFRd031apc...H15, mRNA sequence /clone=EFRd031apcH15 /gb=AL836465 /gi=21878427 /ug=Tru.81 /len=452 2.0 26% ...

Unigene BLAST: CBRC-FRUB-02-0299 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0299 gnl|UG|Tru#S21434159 AL836234 EFRd Takifugu rubripes cDNA clone EFRd007apc...O23, mRNA sequence /clone=EFRd007apcO23 /gb=AL836234 /gi=21878196 /ug=Tru.1814 /len=463 0.63 32% ...

Unigene BLAST: CBRC-FRUB-02-0473 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0473 gnl|UG|Tru#S21435395 AL837361 EFRh Takifugu rubripes cDNA clone EFRh101apc...A11, mRNA sequence /clone=EFRh101apcA11 /gb=AL837361 /gi=21879323 /ug=Tru.2111 /len=407 0.47 28% ...

Unigene BLAST: CBRC-FRUB-02-0104 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0104 gnl|UG|Tru#S21435233 AL837260 EFRg Takifugu rubripes cDNA clone EFRg101apc...H6, mRNA sequence /clone=EFRg101apcH6 /gb=AL837260 /gi=21879222 /ug=Tru.2053 /len=465 3.3 30% ...

Unigene BLAST: CBRC-FRUB-02-0391 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0391 gnl|UG|Tru#S21434264 AL836417 EFRd Takifugu rubripes cDNA clone EFRd031apc...K15, mRNA sequence /clone=EFRd031apcK15 /gb=AL836417 /gi=21878379 /ug=Tru.1810 /len=428 0.75 34% ...

Unigene BLAST: CBRC-FRUB-02-0702 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0702 gnl|UG|Tru#S21434160 AL836235 EFRd Takifugu rubripes cDNA clone EFRd007apc...K11, mRNA sequence /clone=EFRd007apcK11 /gb=AL836235 /gi=21878197 /ug=Tru.2312 /len=411 6.4 28% ...

Investigation of Turkish marbles as shielding materials

International Nuclear Information System (INIS)

Atasoy, H.; Tarcan, G.; Doekmen, S.

1992-01-01

The natural Turkish marbles, especially Usak Green (UG), Aegean Purple (AP), and Marmara White (MW) were tested as shielding materials using standard gamma sources such as Co-60, Cs-137 and Eu-152. The experiment showed that UG, AP and MW are very effective shields against gamma-rays. The result for this experiment is that the gamma-ray attenuation coefficients of UG, AP and MW are almost equal for the energy range from 0.1 MeV to 1.4 MeV. Also, the elemental compositions of the natural UG, AP and MW marbles have been determined by fast and thermal neutron activation analysis and fourteen elements including Na, Mg, Al, Si, Cl, K, Ca, V, Ti, Mn, Fe, La, Ba and Sc have been found using the gamma spectroscopic method. The range of element contents of all Turkish marbles are remarkably different, but most of the elements are common such as Ca, Fe, Na, Cl, Mg, Si. (orig.)

Studies on the preparation of radioactive labelled compounds

International Nuclear Information System (INIS)

Kim, Jae-Rok; Park, Kyung-Bae; Awh, Ok-Doo

1985-04-01

To deveolp 99 mTc instant labelling kits of dimercaptosuccinic acid (DMSA), glucoheptonic acid (GH), and tin colloid, molar ratios of the host compound to the stannous chloride, amount of the stannous chloride and pH were, respectively, controlled. The labelling yields and radiochemical purities were checked by means of a paper chromatography. Animal studies and clinical applications were also carried out. The results indicated that DMSA/SnCl 2 2H 2 O 3/1(mole/mole), SnCl 2 2H 2 O 410ug/ml/vial, pH 2.5, Ca GH/SnCl 2 2H 2 O 53/1(mole/mole), SnCl 2 2H 2 O 350 ug/ml/vial, pH 6.5, NaF 100ug/vial, SnCl 2 2H 2 O 150 ug/ml/vial, pH. 5.6 etc, were optimal conditions for the preparation of DMSA-, GH-, and tin colloid-kits, respectively. (Author)

High Magnetic Field in THz Plasma Wave Detection by High Electron Mobility Transistors

Science.gov (United States)

Sakowicz, M.; Łusakowski, J.; Karpierz, K.; Grynberg, M.; Valusis, G.

The role of gated and ungated two dimensional (2D) electron plasma in THz detection by high electron mobility transistors (HEMTs) was investigated. THz response of GaAs/AlGaAs and GaN/AlGaN HEMTs was measured at 4.4K in quantizing magnetic fields with a simultaneous modulation of the gate voltage UGS. This allowed us to measure both the detection signal, S, and its derivative dS/dUGS. Shubnikov - de-Haas oscillations (SdHO) of both S and dS/dUGS were observed. A comparison of SdHO observed in detection and magnetoresistance measurements allows us to associate unambiguously SdHO in S and dS/dUGS with the ungated and gated parts of the transistor channel, respectively. This allows us to conclude that the entire channel takes part in the detection process. Additionally, in the case of GaAlAs/GaAs HEMTs, a structure related to the cyclotron resonance transition was observed.

The Extended Likeability Framework: A Theoretical Framework for and a Practical Case of Designing Likeable Media Applications for Preschoolers

Directory of Open Access Journals (Sweden)

Vero vanden Abeele

2008-01-01

Full Text Available A theoretical framework and practical case for designing likeable interactive media applications for preschoolers in the home environment are introduced. First, we elaborate on the theoretical framework. We introduce the uses and gratifications paradigm (U&G. We argue that U&G is a good approach to researching likeability of media applications. Next, we complete the U&G framework with expectancy-value (EV theory. EV theory helps us move from theoretical insights to concrete design guidelines. Together, the U&G framework and the EV model form the foundation of our extended likeability framework for the design and evaluation of interactive media applications, for preschoolers in the home environment. Finally, we demonstrate a practical case of our extended likeability framework via the research project CuTI. The CuTI project aims at revealing those particular user gratifications and design attributes that are important to support playful behaviour and fun activities of preschoolers in the home environment.

Aion, Eros e Hades nei frammenti caldaici

Directory of Open Access Journals (Sweden)

Silvia Lenzi

2006-01-01

Full Text Available The essay deals with some aspects of the knotty question concerning the presence of Aion, Eros and Hades in the variegated universe of the Chaldean Oracles, traditionally attributed to a collaboration between two “Hellenized Magi” of the second c. AD: Julian “the Chaldean” and his son Julian “the Theurgist” (even if the theurgical expertise of the elder Julian, the repository of a more ancient Chaldean tradition, might not involve a direct eastern origin but only his knowledge of “Chaldean” sciences such as astrology and divination”. Aion, who is examined here in terms of his relationship with Chronos, as a more or less autonomous divinity, is mentioned only in the context of some fragments, but his name never appears in the oracular verses. Eros (beloging also to the triad of fr. 46, along with “Faith” and “Truth” stands for an independent cosmological principle whose task is to preserve the universe and the armony of the cosmos. The Chaldean Oracles never make any explicit mention of Hades, who anyway is cited by the Byzantine scholar Psellos as an autonomous divinity of the Chaldeans.

Obituary: Thomas Julian Ahrens (1936-2010)

Science.gov (United States)

Jeanloz, Raymond; Asimow, Paul

2011-12-01

Thomas J. Ahrens, a leader in the use of shock waves to study planetary interiors and impact phenomena, died at his home in Pasadena, California on November 24, 2010, at the age of 74. He was the California Institute of Technology's Fletcher Jones Professor of Geophysics, formally emeritus since 2005 but professionally active to the end. Tom was a pioneer in experimental and numerical studies of the effects of hypervelocity impact, arguably the most important geophysical process in the formation, growth and - in many cases - surface evolution of planets. As a professor at Caltech, he established the foremost university laboratory for shock wave experiments, where students and research associates from around the world pursued basic research in geophysics, planetary science and other disciplines. Previously, high-pressure shock experiments were primarily conducted in national laboratories, where they were initially associated with development of nuclear weapons. The shock wave laboratory at Caltech was noted for key measurements addressing major questions in planetary geophysics. Equation-of-state studies on silicate melts showed that magma deep in Earth's mantle could be denser than the coexisting crystals, implying downward transport of melts (and associated heat) rather than the upward eruption of lavas observed in volcanic regions at Earth's surface. Shock-melting experiments on iron at pressures of Earth's core provide a crucial constraint on the temperature at the center of our planet. And studies of hydrous, carbonate and sulphate minerals under shock compression document how climate-altering molecules can be released by major impacts, such as the K/T event associated with the most recent mass extinction of biota in Earth history. In addition, Tom was a leader in numerical simulation of cratering, bringing the most recent laboratory measurements into the modeling of planetary impacts. Tom's training was in geophysics and applied experimental physics, as exemplified by the ultrasonic wave-velocity measurements of his Ph.D. research at Rensselaer Polytechnic Institute (geophysics Ph.D. in 1962, following a B.S. in geology and geophysics from Massachusetts Institute of Technology in 1957, and M.S. in geophysics from Caltech in 1958). He served in the U.S. Army (1959-60) and was employed at Stanford Research Institute (1962-67), where he conducted shock wave experiments, before joining the faculty at Caltech in 1967. With such a broad background, Tom combined condensed-matter physics, continuum mechanics, petrology and seismology, for instance in characterizing polymorphic phase transformations in Earth's mantle (1967 J. Geophys. Res. Paper with Y. Syono); using shock wave measurements to interpret seismological data on Earth's deep interior (1969 Rev. Geophysics paper with D. L. Anderson and A. E. Ringwood); modeling geodynamic effects of phase-transition kinetics (1975 Rev. Geophysics paper with G. Shubert); characterizing the effects of gravity and crustal strength on crater formation (1981 Rev. Geophysics paper with J. D. O'Keefe); and quantifying impact erosion of terrestrial planetary atmospheres (1993 Annual Review of Earth and Planetary Sciences). The span of his science was also reflected in collaborations with - among others - Paul D. Asimow, George R. Rossman and Edward M. Stolper at Caltech, as well as Arthur C. Mitchell and William J. Nellis at Lawrence Livermore National Laboratory. His accomplishments included conducting the first shock-wave experiments on lunar samples and solid hydrogen; measuring the first absorption spectra of minerals under shock loading; discovering major phase changes in CaO, FeO, KAlSi3O8, and KFeS2; measuring shock temperatures in silicates, metals, and oxides; conducting the first planetary cratering calculations for mass of melted and vaporized material, and mass and energy of ejecta as a function of planetary escape velocity; experimentally documenting shock vaporization on volatile-bearing minerals, and applying the results to understanding the formation of oceans and atmospheres; conducting the first dynamic-compression experiments on molten silicates, with applications to characterizing the maximum depth of volcanism on terrestrial planets, as well as the crystallization sequence of magma oceans; performing the first thermodynamic calculations delineating the impact-shock conditions for melting and vaporization of planetary materials; carrying out the first smoothed particle hydrodynamic calculations to investigate energy partitioning upon impact in self-gravitating planetary systems; and conducting the first quantitative tensile failure studies for brittle media, relating crack-density to elastic velocity deficits and the onset of damage. Tom was also Co-Investigator on the NASA Cosmic Dust Analyzer Experiment, and the NASA/ESA Cassini Mission to Saturn. Honors included the AGU Hess Medal, Geological Society of America Day Medal, Meteoritical Society Barringer Medal, APS Shock Compression of Condensed Matter' Topical Groups's Duvall Medal and AAAS Newcomb-Cleveland Prize. He had been President of AGU's Tectonophysics Section, Editor of Journal of Geophysical Research, founding member of both the Mineral and Rock Physics and Study of Earth's Deep Interior focus groups, and Editor - more like key driving force - for AGU's Handbook of Physical Constants. He was a fellow of the AGU, American Academy of Arts and Sciences, American Association for the Advancement of Science, and Geochemical Society; and member of the U.S. National Academy of Sciences, as well as Foreign Associate of the Russian Academy of Sciences. Main-belt asteroid 4739 Tomahrens (1985 TH1) was named after him. Tom made it clear, however, that it was his students (more than 30), research associates (15 or more) and many collaborators who were the real mark of success. No doubt driven by the need to sustain a major, expensive research facility, as well as to satisfy an inner drive, he maintained a daunting work schedule - including evenings, weekends and holidays - that challenged and stimulated so many around him, perhaps even frightening or frustrating some. He could play as hard as he worked, enjoying sailing, skiing and other outdoor activities over the years.

[Correlation and interconversion between erythrocyte cholinesterase values obtained by the Michel and the EQM techniques].

Science.gov (United States)

Carmona-Fonseca, Jaime

2006-12-01

Several techniques are available to measure red cell cholinesterase; therefore, evaluations with several methods provide a measure of concordance. An equation was formulated to transform native data of reference values to reference units of cholinesterase activity as measured by Michel and EQM tests. The experimental design was descriptive, transversal and prospective. The group sampled was a representative adult working population, aged 18-75, without previous exposure to cholinesterase inhibitors pesticides. The individuals were affiliated to the Social Security System and resided in Valle de Aburrá and Cercano Oriente Antioqueño (Antioquia Province, northwestern Colombia). Of 827 individuals, quantitative erythrocytes (Michel y EQM) tests exhibited "r" coefficients between 0.67 and R2 coefficient of 44%.,This indicated that one test explained the results in other test in 44% of the cases. The corelation was higher in Aburrá than in Oriente. The linear model for the 827 individuals was as follows: EQM U/g oxy-hemoglobin = 9.575 U/ g oxy-hemoglobin + 29.791 (Michel delta pH/hour). Michel delta pH/hr = 0.3312 delta pH/hour + 0.0149 (EQM U/g oxy-hemoglobin), where EQM was expressed in U/g oxy-hemoglobin and Michel pH change/hr. Inter-sections (coefficient a) and inclines (coefficient b) were significant in this model. In the adjusted equations, after exclusion of 12 extreme data (1.5% of 827), the r coefficient increased from 0.67 to 0.72 The adjusted equations were as follows: EQM U/g oxy-hemoglobin = 8.1884 U/g oxy-hemoglobin + 31.3920 (Michel delta pH/hour); Michel delta pH/hr = 0.2925 delta pH/hr + 0.0161 (EQM U/g oxy-hemoglobin). This system of linear equations permitted the transformation of Michel (delta PH/ hr) units to EQM (U/g oxy-hemoglobin) units and vice versa. This will facilitate data comparisons by clinicians and epidemiologists who are using these methods of cholinesterase measurement.

Unigene BLAST: CBRC-MMUS-14-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0020 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 9e-37 29% ...

Unigene BLAST: CBRC-HSAP-23-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-23-0073 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

Unigene BLAST: CBRC-MMUS-03-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-03-0073 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-27 27% ...

Unigene BLAST: CBRC-GGAL-03-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 3e-50 34% ... ...CBRC-GGAL-03-0016 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Blood Lead Levels And Potental Environmental Exposures Among ...

African Journals Online (AJOL)

p = 0.439). Low risk parental occupation (p = 0.001) and. Kales sourced from the market/kiosks (p = 0.001) were significantly associated with BLL ≥ 10ug/dl. Soil lead levels (Soil Pb) ranged from 3,000 to 90,000ug/kg, which was very high ...

Unigene BLAST: CBRC-GGAL-02-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-02-0038 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 4e-30 25% ...

Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-12-0011 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 5e-38 44% ...

Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-26-0008 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli...ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-82 44% ...

Unigene BLAST: CBRC-GGAL-04-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-30 26% ... ...CBRC-GGAL-04-0034 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-06-0012 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 2e-85 49% ... ...CBRC-GGAL-06-0012 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-05-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 4e-09 24% ... ...CBRC-GGAL-05-0037 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-07-0070 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-07-0070 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 1e-80 43% ...

Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-24 29% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-MMUS-20-0033 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-20-0033 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 5e-78 42% ...

Unigene BLAST: CBRC-GGAL-06-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-36 29% ... ...CBRC-GGAL-06-0000 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 6e-26 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 4e-34 27% ...

Unigene BLAST: CBRC-GGAL-04-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 1e-25 28% ... ...CBRC-GGAL-04-0026 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...

Unigene BLAST: CBRC-GGAL-26-0008 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 9e-84 48% ... ...CBRC-GGAL-26-0008 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-10-0031 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-10-0031 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-32 28% ...

Unigene BLAST: CBRC-HSAP-23-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-23-0072 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 1e-80 43% ...

Unigene BLAST: CBRC-GGAL-03-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-27 32% ... ...CBRC-GGAL-03-0015 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-06-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 8e-21 24% ... ...CBRC-GGAL-06-0001 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...

Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-87 50% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-MMUS-17-0171 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-17-0171 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 2e-22 22% ...

Unigene BLAST: CBRC-GGAL-12-0011 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 1e-32 30% ... ...CBRC-GGAL-12-0011 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-GGAL-03-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 8e-29 26% ... ...CBRC-GGAL-03-0043 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 2e-34 27% ...

Unigene BLAST: CBRC-HSAP-04-0044 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-04-0044 gnl|UG|Hs#S1730883 Homo sapiens opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (OPN1SW), mRNA /cds=p(8,1054) /gb=NM_001708 /gi=4502386 /ug=Hs.656404 /len=1101 5e-23 25% ...

Unigene BLAST: CBRC-GGAL-03-0047 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 3e-24 24% ... ...CBRC-GGAL-03-0047 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Biodiversity in the city: key challenges for urban green space management

Science.gov (United States)

Myla F.J. Aronson; Christopher A. Lepczyk; Karl L. Evans; Mark A. Goddard; Susannah B. Lerman; J. Scott MacIvor; Charles H. Nilon; Timothy. Vargo

2017-01-01

Cities play important roles in the conservation of global biodiversity, particularly through the planning and management of urban green spaces (UGS). However, UGS management is subject to a complex assortment of interacting social, cultural, and economic factors, including governance, economics, social networks, multiple stakeholders, individual preferences, and social...

Validity and reliability of smartphone magnetometer-based goniometer evaluation of shoulder abduction--A pilot study.

Science.gov (United States)

Johnson, Linda B; Sumner, Sean; Duong, Tina; Yan, Posu; Bajcsy, Ruzena; Abresch, R Ted; de Bie, Evan; Han, Jay J

2015-12-01

Goniometers are commonly used by physical therapists to measure range-of-motion (ROM) in the musculoskeletal system. These measurements are used to assist in diagnosis and to help monitor treatment efficacy. With newly emerging technologies, smartphone-based applications are being explored for measuring joint angles and movement. This pilot study investigates the intra- and inter-rater reliability as well as concurrent validity of a newly-developed smartphone magnetometer-based goniometer (MG) application for measuring passive shoulder abduction in both sitting and supine positions, and compare against the traditional universal goniometer (UG). This is a comparative study with repeated measurement design. Three physical therapists utilized both the smartphone MG and a traditional UG to measure various angles of passive shoulder abduction in a healthy subject, whose shoulder was positioned in eight different positions with pre-determined degree of abduction while seated or supine. Each therapist was blinded to the measured angles. Concordance correlation coefficients (CCCs), Bland-Altman plotting methods, and Analysis of Variance (ANOVA) were used for statistical analyses. Both traditional UG and smartphone MG were reliable in repeated measures of standardized joint angle positions (average CCC > 0.997) with similar variability in both measurement tools (standard deviation (SD) ± 4°). Agreement between the UG and MG measurements was greater than 0.99 in all positions. Our results show that the smartphone MG has equivalent reliability compared to the traditional UG when measuring passive shoulder abduction ROM. With concordant measures and comparable reliability to the UG, the newly developed MG application shows potential as a useful tool to assess joint angles. Published by Elsevier Ltd.

Does reduced movement restrictions and use of assistive devices affect rehabilitation outcome after total hip replacement? A non-randomized, controlled study in 365 patients with six week follow up

DEFF Research Database (Denmark)

Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Søballe, Kjeld

(primary outcome, HOOS), anxiety (HADS), working status and patient satisfaction were administered before THR, 3 and 6 weeks after. Findings / Results HOOS function score at the 3 measurement times were (mean ± SD); UG: 46±17 - 76±9 - 83±14 compared to RG: 43±16 – 81±14 - 83±13, (difference between groups...... over time, p=0.004). For return to work 6 weeks post THR, UG compared to RG: 53% versus 32% (p=0.045). No significant differences between groups in anxiety, hip dislocations and patient satisfaction. Conclusions No clinically relevant difference between UG and RG on patient evaluated function was found...

Unigene BLAST: CBRC-TGUT-37-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available egment Chr 11 Brigham & Women's Genetics 0434 expressed variant 2-like mRNA, complete sequence /gb=DQ215253 /gi=76158658 /ug=Tgu.7189 /len=654 1.4 27% ... ...CBRC-TGUT-37-0238 gnl|UG|Tgu#S33942003 Taeniopygia guttata clone 0058P0013A02 DNA s

A low-noise MEMS accelerometer for unattended ground sensor applications

Science.gov (United States)

Speller, Kevin E.; Yu, Duli

2004-09-01

A low-noise micro-machined servo accelerometer has been developed for use in Unattended Ground Sensors (UGS). Compared to conventional coil-and-magnet based velocity transducers, this Micro-Electro-Mechanical System (MEMS) accelerometer offers several key benefits for battlefield monitoring. Many UGS require a compass to determine deployment orientation with respect to magnetic North. This orientation information is critical for determining the bearing of incoming signals. Conventional sensors with sensing technology based on a permanent magnet can cause interference with a compass when used in close proximity. This problem is solved with a MEMS accelerometer which does not require any magnetic materials. Frequency information below 10 Hz is valuable for identification of signal sources. Conventional seismometers used in UGS are typically limited in frequency response from 20 to 200 Hz. The MEMS accelerometer has a flat frequency response from DC to 5 kHz. The wider spectrum of signals received improves detection, classification and monitoring on the battlefield. The DC-coupled output of the MEMS accelerometer also has the added benefit of providing tilt orientation data for the deployed UGS. Other performance parameters of the MEMS accelerometer that are important to UGS such as size, weight, shock survivability, phase response, distortion, and cross-axis rejection will be discussed. Additionally, field test data from human footsteps recorded with the MEMS accelerometer will be presented.

Cooperative Behavior in the Ultimatum Game and Prisoner’s Dilemma Depends on Players’ Contributions

Directory of Open Access Journals (Sweden)

Amy R. Bland

2017-06-01

Full Text Available Economic games such as the Ultimatum Game (UG and Prisoner’s Dilemma (PD are widely used paradigms for studying fairness and cooperation. Monetary versions of these games involve two players splitting an arbitrary sum of money. In real life, however, people’s propensity to engage in cooperative behavior depends on their effort and contribution; factors that are well known to affect perceptions of fairness. We therefore sought to explore the impact of relative monetary contributions by players in the UG and PD. Adapted computerized UG and PD games, in which relative contributions from each player were manipulated, were administered to 200 participants aged 18–50 years old (50% female. We found that players’ contribution had large effects on cooperative behavior. Specifically, cooperation was greater amongst participants when their opponent had contributed more to joint earnings. This was manifested as higher acceptance rates and higher offers in the UG; and fewer defects in the PD compared to when the participant contributed more. Interestingly, equal contributions elicited the greatest sensitivity to fairness in the UG, and least frequent defection in the PD. Acceptance rates correlated positively with anxiety and sex differences were found in defection behavior. This study highlights the feasibility of computerized games to assess cooperative behavior and the importance of considering cooperation within the context of effortful contribution.

Uniform Gauss-Weight Quadratures for Discrete Ordinate Transport Calculations

International Nuclear Information System (INIS)

Carew, John F.; Hu, Kai; Zamonsky, Gabriel

2000-01-01

Recently, a uniform equal-weight quadrature set, UE n , and a uniform Gauss-weight quadrature set, UG n , have been derived. These quadratures have the advantage over the standard level-symmetric LQ n quadrature sets in that the weights are positive for all orders,and the transport solution may be systematically converged by increasing the order of the quadrature set. As the order of the quadrature is increased,the points approach a uniform continuous distribution on the unit sphere,and the quadrature is invariant with respect to spatial rotations. The numerical integrals converge for continuous functions as the order of the quadrature is increased.The numerical characteristics of the UE n quadrature set have been investigated previously. In this paper, numerical calculations are performed to evaluate the application of the UG n quadrature set in typical transport analyses. A series of DORT transport calculations of the >1-MeV neutron flux have been performed for a set of pressure-vessel fluence benchmark problems. These calculations employed the UG n (n = 8, 12, 16, 24, and 32) quadratures and indicate that the UG n solutions have converged to within ∼0.25%. The converged UG n solutions are found to be comparable to the UE n results and are more accurate than the level-symmetric S 16 predictions

Biochemical Effects of six Ti02 and four Ce02 Nanomaterials ...

Science.gov (United States)

Abstract The potential mammalian hepatotoxicity of nanomaterials were explored in dose-response and structure-activity studies with human hepatic HepG2 cells exposed to between 10 and 1000 ug/ml of six different TiO2 and four CeO2 nanomaterials for 3 days. Various biochemical parameters were then evaluated to study cytotoxicity, cell growth, hepatic function and oxidative stress. Few indications of cytotoxicity were observed between 10 and 100 ug/ml. In the 300 to 1000 ug/ml exposure range a moderate to substantial degree of cytotoxicity was observed. The percent of lactic dehydrogenase released from cells was the most sensitive cytotoxicity parameter. There were four major biochemical effects observed. By far decreased activities of glucose 6-phosphate dehydrogenase was the major finding of this enzymatic study with some significant decreases observed at 10 ug/ml. In the range of 100 to 1000 ug/ml, the activities of superoxide dismutase, glutathione reductase and glutathione peroxidase were decreased by many nanomaterials. There are six factors that contribute to substantial oxidative stress in cultured hepatocytes (decreased GSH content, and reduced G6PDH, GRD, GPX, SOD and altered catalase activities). Cytotoxicity per se did not seem to fully explain the patterns of biological responses observed. With respect to structure-activity, nanomaterials of CeO2 were more effective than TiO2 in reducing glutathione reductase and SOD activ

On the relationship between emotional state and abnormal unfairness sensitivity in alcohol dependence.

Science.gov (United States)

Brevers, Damien; Noël, Xavier; Hanak, Catherine; Verbanck, Paul; Kornreich, Charles

2015-01-01

Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent (AD) individuals and 32 controls performed an ultimatum game (UG), in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR). Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed in order to examine whether-emotional and behavioral-reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.

Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...

Kõikide mugavustega õnn massidele / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2004-01-01

Kunstiteaduse Instituudi rahvusvaheline konverents "Võistlevad õnned. Elukeskkond külma sõja perioodil". Esines Adrian Forty, Hilde Heynen Hollandist, Julian Holder Shotimaalt, Kirsi Saarikangas Soomest

Evidence for the Fundamental Difference Hypothesis or Not?: Island Constraints Revisited

Science.gov (United States)

Belikova, Alyona; White, Lydia

2009-01-01

This article examines how changes in linguistic theory affect the debate between the fundamental difference hypothesis and the access-to-Universal Grammar (UG) approach to SLA. With a focus on subjacency (Chomsky, 1973), a principle of UG that places constraints on "wh"-movement and that has frequently been taken as a test case for verifying…

Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...

Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...

Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...

Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...

A new multiplicity formula for the Weyl modules of type A

International Nuclear Information System (INIS)

Ye Jiachen; Zhou Zhongguo

2003-08-01

A monomial basis and a filtration of subalgebras for the universal enveloping algebra U(g) of a complex simple Lie algebra g l of type A I is given in this note. In particular, a new multiplicity formula for the Weyl module V(λ) of U(g l ) is obtained in this note. (author)

A novel preconcentration technique for the PIXE analysis of water

International Nuclear Information System (INIS)

Savage, J.M.; Robertson, J.D.; Majidi, V.

1994-01-01

The potential of using dried algae as a novel preconcentration technique for the analysis of water samples by PIXE was examined. 5 mg of dried algae powder were mixed with 5 mL of single- and multi-metal solutions. The algae cells were then collected by filtration on 0.6 um polycarbonate membranes and analyzed by PIXE using a dual energy irradiation. When C. vulgatis was used on mixed metal solutions, linear responses were observed for Ag + , Ba 2+ , and Cd 2+ in the concentration range from 10 ng/g to 1 ug/g; for Cu 2+ and Pb 2+ from 10 ng/g to 5 ug/g; and for Hg 2+ from 10 ng/g to 10 ug/g. When S. bacillaris was used, linear responses were observed from 10 ng/g up to 10 ug/g for all of the metal cations investigated. The PIXE results demonstrated that metal binding at low concentrations involves replacement of sodium on the cell wall and that at high concentrations magnesium is also replaced

Trustworthiness and Negative Affect Predict Economic Decision-Making.

Science.gov (United States)

Nguyen, Christopher M; Koenigs, Michael; Yamada, Torricia H; Teo, Shu Hao; Cavanaugh, Joseph E; Tranel, Daniel; Denburg, Natalie L

2011-09-01

The Ultimatum Game (UG) is a widely used and well-studied laboratory model of economic decision-making. Here, we studied 129 healthy adults and compared demographic (i.e., age, gender, education), cognitive (i.e., intelligence, attention/working memory, speed, language, visuospatial, memory, executive functions), and personality (i.e., "Big Five", positive affect, negative affect) variables between those with a "rational" versus an "irrational" response pattern on the UG. Our data indicated that participants with "rational" UG performance (accepting any offer, no matter the fairness) endorsed higher levels of trust, or the belief in the sincerity and good intentions of others, while participants with "irrational" UG performance (rejecting unfair offers) endorsed higher levels of negative affect, such as anger and contempt. These personality variables were the only ones that differentiated the two response patterns-demographic and cognitive factors did not differ between rational and irrational players. The results indicate that the examination of personality and affect is crucial to our understanding of the individual differences that underlie decision-making.

Fodder radish cake (Raphanus sativus L. as an alternative biomass for the production of cellulases and xylanases in solid-state cultivation

Directory of Open Access Journals (Sweden)

L. Zukovski

Full Text Available Abstract Fodder radish (FR is an oilseed crop with a high potential for biodiesel production due to its high productivity and the quality of its seed oil. FR oil extraction results in a residue that is rich in protein and fiber. In this study, FR cake (FRC was evaluated as carbon and nitrogen source for the production of cellulases and xylanases using Penicillium echinulatum S1M29 during solid-state cultivation. It was determined that it is possible to partially replace wheat bran (WB by FRC, resulting in 24.22 ± 0.25U/g Filter Paper Activity (144 hours, 210.5 ± 5.8U/g endoglucanase activity (144 hours, 22.62 ± 0.01U/g (-glucosidase activity (96 hours and 784.7 ± 70.19U/g xylanase activity (120 hours. These values are equal or higher than the enzymatic activity obtained using WB. These results may contribute to the reduction of the cost of enzymes used in the production of cellulosic ethanol or other biotechnological applications.

Parsley: a Command-Line Parser for Astronomical Applications

Science.gov (United States)

Deich, William

Parsley is a sophisticated keyword + value parser, packaged as a library of routines that offers an easy method for providing command-line arguments to programs. It makes it easy for the user to enter values, and it makes it easy for the programmer to collect and validate the user's entries. Parsley is tuned for astronomical applications: for example, dates entered in Julian, Modified Julian, calendar, or several other formats are all recognized without special effort by the user or by the programmer; angles can be entered using decimal degrees or dd:mm:ss; time-like intervals as decimal hours, hh:mm:ss, or a variety of other units. Vectors of data are accepted as readily as scalars.

Determination of the uranium concentration in samples of raw, retorted and spent shale from Irati, Parana-Brazil, by the fission track registration technique

International Nuclear Information System (INIS)

Cabral, R.G.

1981-02-01

The feasibility of the determination of uranium in oil shale, by the fission track registration technique is studied. The wet and dry methods were employed, using a Bayer policarbonate, Makrofol KG, as detector. It was created a new variant of the dry method. The fission track registration technique was used in samples of raw, retorted and spent shale from Irati, Parana in Brazil, 16 μg U/g, 20 μg U/g and 20μg U/g were found, respectively, with a total error ranging from 19% to 20%. Some experimental results were included for illustration and comparison. The feasibility of the determination of uranium in oil shale from Irati was verified. (Author) [pt

Neid filme mine lähipäevil Pöffile vaatama / Rain Kooli

Index Scriptorium Estoniae

Kooli, Rain

2007-01-01

11. Pimedate Ööde filmifestivali filme - Gus Van Sant'i "Paranoid Park" (USA, Prantsusmaa), Sergei Bodrovi "Mongol" (Venemaa, Kasahstan), Julian Schnabeli "Tuukrikell ja liblikas" (Prantsusmaa, USA)

Biochemistry and Chemotherapy of Malaria and Leishmaniasis

Science.gov (United States)

1993-12-06

ethanol plant extracts including; nutmeg (Myristicaceae sp.), ginger ( Zingiber officinale ), goldenseal root (Hydrastis canadensis), garlic (Allium...scorodoprasum (elephant garlic), Ailium sativum (garlic), Zingiber officinale ,ginger), Myristicaceae sp. (nutmeg), Hydrastis canadensis (goldenseal...They were Glycyrrhiza glabra (IC25: 6 ug protein/ml)(Fig.7), Zingiber officinale (IC25: 14 ug protein/ ml), and ethanol extracts of Myristacea sp

Unigene BLAST: CBRC-DRER-15-0112 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0112 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-49 71% ...

Unigene BLAST: CBRC-DRER-15-0109 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0109 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-51 71% ...

Unigene BLAST: CBRC-DRER-15-0107 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0107 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-59 84% ...

Unigene BLAST: CBRC-DRER-15-0115 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0115 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-41 67% ...

Unigene BLAST: CBRC-DRER-15-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0111 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 4e-48 73% ...

Unigene BLAST: CBRC-DRER-15-0105 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0105 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 9e-35 69% ...

Unigene BLAST: CBRC-DRER-15-0102 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0102 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-30 54% ...

Unigene BLAST: CBRC-DRER-15-0103 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0103 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 6e-32 56% ...

Unigene BLAST: CBRC-DRER-15-0101 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0101 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-47 77% ...

Unigene BLAST: CBRC-DRER-15-0113 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0113 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 73% ...

Unigene BLAST: CBRC-DRER-15-0114 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0114 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 1e-38 62% ...

Unigene BLAST: CBRC-DRER-15-0108 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0108 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 7e-53 74% ...

Unigene BLAST: CBRC-DRER-15-0100 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0100 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 3e-52 75% ...

Unigene BLAST: CBRC-DRER-15-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0106 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-51 75% ...

Unigene BLAST: CBRC-DRER-15-0110 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0110 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 2e-71 99% ...

Unigene BLAST: CBRC-DRER-15-0104 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-15-0104 gnl|UG|Dr#S24600640 nao61h10.y1 Zebrafish Posterior segment. Unno...rmalized (nao) Danio rerio cDNA clone nao61h10 5', mRNA sequence /clone=nao61h10 /clone_end=5' /gb=DN895013 /gi=62879776 /ug=Dr.126440 /len=809 5e-58 79% ...

Methods of Analysis by the U.S. Geological Survey Organic Geochemistry Research Group-Determination of Dissolved Isoxaflutole and Its Sequential Degradation Products, Diketonitrile and Benzoic Acid, in Water Using Solid-Phase Extraction and Liquid Chromatography/Tandem Mass Spectrometry

Science.gov (United States)

Meyer, Michael T.; Lee, Edward A.; Scribner, Elisabeth A.

2007-01-01

An analytical method for the determination of isoxaflutole and its sequential degradation products, diketonitrile and a benzoic acid analogue, in filtered water with varying matrices was developed by the U.S. Geological Survey Organic Geochemistry Research Group in Lawrence, Kansas. Four different water-sample matrices fortified at 0.02 and 0.10 ug/L (micrograms per liter) are extracted by vacuum manifold solid-phase extraction and analyzed by liquid chromatography/tandem mass spectrometry using electrospray ionization in negative-ion mode with multiple-reaction monitoring (MRM). Analytical conditions for mass spectrometry detection are optimized, and quantitation is carried out using the following MRM molecular-hydrogen (precursor) ion and product (p) ion transition pairs: 357.9 (precursor), 78.9 (p), and 277.6 (p) for isoxaflutole and diketonitrile, and 267.0 (precursor), 159.0 (p), and 223.1 (p) for benzoic acid. 2,4-dichlorophenoxyacetic acid-d3 is used as the internal standard, and alachlor ethanesulfonic acid-d5 is used as the surrogate standard. Compound detection limits and reporting levels are calculated using U.S. Environmental Protection Agency procedures. The mean solid-phase extraction recovery values ranged from 104 to 108 percent with relative standard deviation percentages ranging from 4.0 to 10.6 percent. The combined mean percentage concentration normalized to the theoretical spiked concentration of four water matrices analyzed eight times at 0.02 and 0.10 ug/L (seven times for the reagent-water matrix at 0.02 ug/L) ranged from approximately 75 to 101 percent with relative standard deviation percentages ranging from approximately 3 to 26 percent for isoxaflutole, diketonitrile, and benzoic acid. The method detection limit (MDL) for isoxaflutole and diketonitrile is 0.003 ug/L and 0.004 ug/L for benzoic acid. Method reporting levels (MRLs) are 0.011, 0.010, and 0.012 ug/L for isoxaflutole, diketonitrile, and benzoic acid, respectively. On the basis

Criterion-Referenced Values of Grip Strength and Usual Gait Speed Using Instrumental Activities of Daily Living Disability as the Criterion.

Science.gov (United States)

Lee, Meng-Chih; Hsu, Chih-Cheng; Tsai, Yi-Fen; Chen, Ching-Yu; Lin, Cheng-Chieh; Wang, Ching-Yi

Current evidence suggests that grip strength and usual gait speed (UGS) are important predictors of instrumental activities of daily living (IADL) disability. Knowing the optimum cut points of these tests for discriminating people with and without IADL disability could help clinicians or researchers to better interpret the test results and make medical decisions. The purpose of this study was to determine the cutoff values of grip strength and UGS for best discriminating community-dwelling older adults with and without IADL disability, separately for men and women, and to investigate their association with IADL disability. We conducted secondary data analysis on a national dataset collected in the Sarcopenia and Translational Aging Research in Taiwan (START). The data used in this study consisted of health data of 2420 community-dwelling older adults 65 years and older with no history of stroke and with complete data. IADL disability was defined as at least 1 IADL item scored as "need help" or "unable to perform." Receiver operating characteristics analysis was used to estimate the optimum grip strength and UGS cut points for best discriminating older adults with/without IADL disability. The association between each physical performance (grip strength and UGS) and IADL disability was assessed with odds ratios (ORs). With IADL disability as the criterion, the optimal cutoff values of grip strength were 28.7 kg for men and 16.0 kg for women, and those for UGS were 0.76 m/s for men and 0.66 m/s for women. The grip strength test showed satisfactory discriminant validity (area under the curve > 0.7) in men and a strong association with IADL disability (OR > 4). Our cut points using IADL disability as the criterion were close to those indicating frailty or sarcopenia. Our reported cutoffs can serve as criterion-referenced values, along with those previously determined using different indicators, and provide important landmarks on the performance continua of older adults

[Frequency and in vitro susceptibility antiparasitic of Blastocystis hominis from patients admitted to the Hospital Regional Lambayeque, Peru].

Science.gov (United States)

Silva-Díaz, Heber; Flores-Esqueche, Lorena; Llatas-Cancino, Dunalia; Guevara Vásquez, Génesis; Silva-García, Teresa

2016-01-01

To describe the frequency and antiparasitic in vitro susceptibility of Blastocystis hominis in patients admitted to theHospital Regional Lambayeque, Peru. A cross-sectional study was conducted from January to August 2015 at 313 patients of all ages. B. hominis detection was performed on serial fecal samples by direct microscopic examination and microculture in modified Locke solution. The in vitro susceptibility testing against the drug metronidazole, nitazoxanide, trimethoprim-sulfamethoxazole and erythromycin was performed in 24 strains of B. hominis, which grew up (microculture method) in 10 double concentrations of each antimicrobial (from 256 ug/ml to 0.5 ug/mL) plus a control. 46.3% (145/313) of the sample had B. hominis, also the age between 12 to 17 years and 60 years was associated with higher frequency of parasites (OR: 2.93 and 2.62). The minimum inhibitory concentration (MIC) 90 of metronidazole and nitazoxanide was 3.19 ug/mL and 11.19 ug/ml, respectively, whereas the MIC 90 of trimethoprim-sulfamethoxazole and erythromycin were above 256 ug/mL. B. hominis occurs in high frequency in patients admitted to the Hospital Regional in Lambayeque, proving to be an important problem of public health in the region. Also B. hominis isolated from these patients were shown to be susceptible in vitro to low concentrations of metronidazole and nitazoxanide so they could be chosen for treatment of this parasite.

On the relationship between emotional state and abnormal unfairness sensitivity in alcohol dependence

Directory of Open Access Journals (Sweden)

Damien eBrevers

2015-07-01

Full Text Available Recent empirical findings suggest that alcohol dependence is characterized by heightened sensitivity to unfairness during social transactions. The present study went a step further and aimed to ascertain whether this abnormal level of sensitivity to unfairness is underlined by an increased emotional reactivity. Twenty-six recently abstinent alcohol-dependent individuals (AD and 32 controls performed an Ultimatum Game (UG, in which participants had to respond to take-it-or-leave-it offers, ranging from fair to unfair and made by a fictive proposer. Emotional state was recorded during UG offers presentation and was indexed by the amplitude of skin conductance response (SCR. Results showed that AD decided to reject unfair offers more frequently than their controls, confirming previous data. The proportion of rejected unfair UG offers was correlated with SCR, in the AD but not in the control group. This finding suggests that deciding to accept or reject unfair UG offers is influenced by arousal-affective activity in AD, but not in controls. Heightened emotional reactivity may have driven AD to punish the proposer rather than acting as a rational economic agent. An implication of present findings is that AD might have difficult to cope with unfair situations triggered by social interactions. Future studies are needed are needed in order to examine whether - emotional and behavioral - reactivity to unfairness during the UG could impact alcohol consumption and relapse in AD.

U.S. Natural Gas Storage Risk-Based Ranking Methodology and Results

Energy Technology Data Exchange (ETDEWEB)

Folga, Steve [Argonne National Lab. (ANL), Argonne, IL (United States); Portante, Edgar [Argonne National Lab. (ANL), Argonne, IL (United States); Shamsuddin, Shabbir [Argonne National Lab. (ANL), Argonne, IL (United States); Tompkins, Angeli [Argonne National Lab. (ANL), Argonne, IL (United States); Talaber, Leah [Argonne National Lab. (ANL), Argonne, IL (United States); McLamore, Mike [Argonne National Lab. (ANL), Argonne, IL (United States); Kavicky, Jim [Argonne National Lab. (ANL), Argonne, IL (United States); Conzelmann, Guenter [Argonne National Lab. (ANL), Argonne, IL (United States); Levin, Todd [Argonne National Lab. (ANL), Argonne, IL (United States)

2016-10-01

This report summarizes the methodology and models developed to assess the risk to energy delivery from the potential loss of underground gas storage (UGS) facilities located within the United States. The U.S. has a total of 418 existing storage fields, of which 390 are currently active. The models estimate the impacts of a disruption of each of the active UGS facilities on their owners/operators, including (1) local distribution companies (LDCs), (2) directly connected transporting pipelines and thus on the customers in downstream States, and (3) third-party entities and thus on contracted customers expecting the gas shipment. Impacts are measured across all natural gas customer classes. For the electric sector, impacts are quantified in terms of natural gas-fired electric generation capacity potentially affected from the loss of a UGS facility. For the purpose of calculating the overall supply risk, the overall consequence of the disruption of an UGS facility across all customer classes is expressed in terms of the number of expected equivalent residential customer outages per year, which combines the unit business interruption cost per customer class and the estimated number of affected natural gas customers with estimated probabilities of UGS disruptions. All models and analyses are based on publicly available data. The report presents a set of findings and recommendations in terms of data, further analyses, regulatory requirements and standards, and needs to improve gas/electric industry coordination for electric reliability.

Rates of BTEX Biodegradation under Nitrate Reducing Conditions in Wetland Sediments Impacted by Contaminated Groundwater

Science.gov (United States)

Olson, L. K.; McGuire, J. T.; Cozzarelli, I.; Smith, E. W.; Kneeshaw, T.

2010-12-01

Biodegradation rates are often controlled by dynamic interactions that occur at mixing interfaces between water masses of differing redox state. This study seeks to understand the controls on rates of BTEX (benzene, toluene, ethylbenzene and m,p,o-xylenes) degradation at a mixing interface by using in-situ experiments to simulate contaminated aquifer water containing nitrate discharging to a methanogenic wetland. BTEX biodegradation was evaluated during “dry” conditions (2009) and “wet” conditions (2010) in a shallow wetland near Bemidji, MN using innovative in-situ microcosms (ISMs) to measure rates of change over 8 weeks (2009) and 9 weeks (2010). ISM samplers contained an inner chamber filled with wetland sediments that were allowed to incubate for 2 weeks. This chamber was then closed to the surrounding environment and amended with test solution composed of contaminated groundwater augmented with tracer (bromide), nitrate and BTEX spike. Analysis of ISM sediments suggests that nitrate reduction and biodegradation rates are a function of both mineralogical and microbiological controls. Loss of nitrate, interpreted as nitrate reduction, was observed in both the dry and wet years with reduction slightly faster in the dry year (2.21mg/L/day versus 1.59 mg/L/day). Nitrate reduction was likely coupled to oxidation of various electron donors present in the system, including not only BTEX but also naturally occurring labile organic matter (ex. acetate) and inorganic electron donors (ex. Fe2+). BTEX degradation rates were considerably higher during the “wet” year than the “dry” year, with the fastest rates occurring immediately following test solution additions. For example, in the first 2 days of the “wet” ISM experiments degradation rates were 57.97ug/L/day for Benzene, 73.24ug/L/day for Toluene, 12.37ug/L/day for Ethyl Benzene and 85.61ug/L/day for Xylene compared to an ISM from the dry year which had slower degradation rates of 2.83ug/L/day for

Prueba de susceptibilidad antiparasitaria in vitro para Blastocystis hominis, Entamoeba histolytica-E. dispar, Balantidium coli

Directory of Open Access Journals (Sweden)

Rito Zerpa Larrauri

2012-01-01

Full Text Available Antecedentes: Pruebas de susceptibilidad antiparasitaria in vitro para Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli, así como el cultivo para protozoarios intestinales, han sido publicados escasamente en la literatura médica. En nuestro medio aún no se ha comunicado pruebas de susceptibilidad in vitro para los parásitos mencionados. Objetivos: Plantear una alternativa de prueba de susceptibilidad antiparasitaria in vitro y conocer su resistencia frente a los antimicrobianos. Diseño: Estudio prospectivo, descriptivo. Instituciones: Instituto de Medicina Tropical "Daniel Alcides Carrión", Universidad Nacional Mayor de San Marcos, e Instituto Especializado de Salud del Niño, Lima, Perú. Material biológico: Cultivos de Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli frente a cinco antimicrobianos. Métodos: Se trabajó con 64 cultivos de Blastocystis hominis, 16 de Entamoeba histolytica-dispar y 16 de Balantidium coli, frente a cinco antimicrobianos: metronidazol, cotrimoxazol, tetraciclina, furazolidona y ciprofloxacina. Las cepas de B. hominis, E. histolytica-E. dispar fueron cultivadas en el medio de Pavlova modificado, de 500 muestras de heces de niños con diagnóstico de parasitosis intestinal y las de B. coli de heces de cerdo. Las pruebas de susceptibilidad in vitro se realizaron con el método de microcultivos en el medio de Pavlova modificado, en pocitos con 200 uL del medio sin antiparasitarios (control y con antiparasitarios en 10 concentraciones, desde 128 ug/mL hasta 0,25 ug/mL; luego de incubación a 36º C por 48 horas, la lectura por examen microscópico directo comparó el desarrollo en el medio control con el desarrollo en los pocitos conteniendo los antimicrobianos. Principales medidas de resultados: Concentración inhibitoria mínima (CIM. Resultados: Se encontró para B. hominis, con metronidazol CIM 90: 64 ug/mL y CIM 50: 2 ug/mL; para E. histolytica-E. dispar con

Pop / Koit Raudsepp

Index Scriptorium Estoniae

Raudsepp, Koit

2004-01-01

Heliplaatidest: Razorlight "Up All Night", Julian Fane "Special Forces", Mark Laneqan Band "Bubblequm", Loits "Vere Kutse Kohustab", Ray Charles "Genius Loves Company", Carly Simon "Reflections: Carly Simon's Greatest Hits"

Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...

Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...

Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...

Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...

Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...

Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...

Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...

Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...

Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...

Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...

Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...

Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...

Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...

Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...

Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...

Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...

Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...

Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...

Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...

Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...

Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...

Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...

Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...

Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...

Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...

Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...

Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...

Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...

Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...

Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...

Nos dlja shpiona odolzhili u majora militsii / Aleksandra Ovikova

Index Scriptorium Estoniae

Ovikova, Aleksandra

2004-01-01

Kuidas sündis vene nõukogude populaarne spiooniseriaal "TASS on volitatud teatama..." ("TASS upolnomotshen zajavit...") : stsenarist Julian Semjonov : režissöör Vladimir Fokin : Nõukogude Liit 1984

Study on underground gas storage in Europe and Central Asia; Etude sur le stockage souterrain du gaz en Europe et en Asie Centrale

Energy Technology Data Exchange (ETDEWEB)

Sedlacek, R. [NlfB, Germany (Germany); Rott, W. [Wintershall AG, Celle (Germany); Rokosz, W. [POGC, Poland (PL)] (and others)

2000-07-01

The Working Party on Gas of the United Nations Economic Commission for Europe (UN/ECE), at its sixth session in 1996, decided to undertake a study on 'Underground gas storage in Europe and Central Asia'. The study was launched by the Working Party on Gas in the recognition of the role of underground gas storage (UGS) in the creation of unified European gas market, its liberalization, security of gas supply and cooperation among gas enterprises. The data analysed by the study was collected through the comprehensive questionnaire, circulated among gas companies/organizations of the ECE member-countries. To carry out the study, a special Ad Hoc Group of Experts, representing leading gas companies of the region, was set up. The study deals with a wide range of issues related to the underground storage of gas, such as current status of UGS in Europe and Central Asia, new and emerging technologies, new and existing UGS projects, regulatory framework, cost of storage in USA and in Europe, future gas markets development. An attempt was also made to identify the UGS facilities that play (and could provide in the future) the international contract border services. (authors)

Stworzenie świata według Leibniza

Directory of Open Access Journals (Sweden)

Michał Heller

2008-06-01

Full Text Available Leibniz's idea of creation is best epitomized by a note written by him on the margin of his work entitled 'Dialogus'. The note reads:'When God thinks things through and calculates, the world is made'. Simple calculations are almost mechanical. The true mathematical thinking begins when one is confronted with a problem that has to be solved, when starting from the known mathematical structure one has to construct a new structure, to comprehend its intricacies, the ways of its functioning, and its connections with other mathematical structures. And when one successfully applies the new mathematical structure to a physical theory, the new world is made. This was Leibniz's experience when he was discovering calculus and tried to apply it to mechanical problems. Leibniz's doctrine that our world is the best of all possible words is often ridiculed, but this attitude is the result of a very superficial reading of Leibniz's texts. In fact, God's calculations to choose the best possible world are similar to solving the variational problem in mathematics. Leibniz claims that in mathematical reasoning if there is neither 'maximum' nor 'minimum' nothing can happen. Similarly, if there were no world better that other possible worlds, God's wisdom would have not been able to create anything. Some consequences of this doctrine, concerning the nature of space, time and causality, are also considered.

Assessment of novel digital and smartphone goniometers for measurement of canine stifle joint angles.

Science.gov (United States)

Freund, Kristin A; Kieves, Nina R; Hart, Juliette L; Foster, Sasha A; Jeffery, Unity; Duerr, Felix M

2016-07-01

OBJECTIVE To evaluate accuracy and reliability of 3 novel goniometers for measurement of canine stifle joint angles and compare the results with those obtained with a universal goniometer (UG). SAMPLE 8 pelvic limbs from 4 canine cadavers. PROCEDURES Each limb was secured to a wooden platform at 3 arbitrarily selected fixed stifle joint angles. Goniometry was performed with 2 smartphone-based applications (novel goniometers A and B), a digital goniometer (novel goniometer C), and a UG; 3 evaluators performed measurements in triplicate for each angle with each device. Results were compared with stifle joint angle measurements on radiographs (used as a gold standard). Accuracy was determined by calculation of bias and total error, coefficients of variation were calculated to estimate reliability, and strength of linear association between radiographic and goniometer measurements was assessed by calculation of correlation coefficients. RESULTS Mean coefficient of variation was lowest for the UG (4.88%), followed by novel goniometers B (7.37%), A (7.57%), and C (12.71%). Correlation with radiographic measurements was highest for the UG (r = 0.97), followed by novel goniometers B (0.93), A (0.90), and C (0.78). Constant bias was present for all devices except novel goniometer B. The UG and novel goniometer A had positive constant bias; novel goniometer C had negative constant bias. Total error at 50° and 100° angles was > 5% for all devices. CONCLUSIONS AND CLINICAL RELEVANCE None of the devices accurately represented radiographically measured stifle joint angles. Additional veterinary studies are indicated prior to the use of novel goniometers in dogs.

Wastewater/Storm Water Characterization and Toxicity Identification Evaluation, Sheppard Air Force Base, Texas

Science.gov (United States)

1991-12-01

support the NPDES permit renewal appl ication. the studies should collect sufficient data to characterize waste streams, including wastewater and WINTP...26Apr 1 30Apr I 1May I 2May Arsenic I uiI ᝺ ᝺i ᝺  ᝺! ᝺ Barium I ug l I i  . 4001 SWot 1000 " 2600 Beryllium J ug 1 ᝺ <o 0 <o

Unattended Ground Sensors for Expeditionary Force 21 Intelligence Collections

Science.gov (United States)

2015-06-01

little impact on modern intelligence collections. This thesis analyzes and compares the units and individual Marine skillsets that employ UGS, and the...the sensor employment planning cycle, and the socialization of this plan through the proper chain-of-command [4]. Figure 8 depicts the Sensor...the use of newly developed cellphone based technologies and emerging UGS capabilities to assist in Listening Post/ Observation Post (LP/OP

Biosorption of U(VI) by the green algae Chlorella vulgaris in dependence of pH value and cell activity

Energy Technology Data Exchange (ETDEWEB)

Vogel, M., E-mail: M.Vogel@fzd.de; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.

2010-12-15

Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 {mu}M to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 {+-} 5.5 mg U/g dry biomass and dead cells 28.3 {+-} 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 {+-} 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 {+-} 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 {mu}M, living cells firstly bind with 1.3 {+-} 0.2 mg U/g dry biomass to 1.4 {+-} 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.

Biosorption of U(VI) by the green algae Chlorella vulgaris in dependence of pH value and cell activity

International Nuclear Information System (INIS)

Vogel, M.; Guenther, A.; Rossberg, A.; Li, B.; Bernhard, G.; Raff, J.

2010-01-01

Biosorption of uranium(VI) by the green alga Chlorella vulgaris was studied at varying uranium concentrations from 5 μM to 1 mM, and in the environmentally relevant pH range of 4.4 to 7.0. Living cells bind in a 0.1 mM uranium solution at pH 4.4 within 5 min 14.3 ± 5.5 mg U/g dry biomass and dead cells 28.3 ± 0.6 mg U/g dry biomass which corresponds to 45% and 90% of total uranium in solution, respectively. During 96 h of incubation with uranium initially living cells died off and with 26.6 ± 2.1 mg U/g dry biomass bound similar amounts of uranium compared to dead cells, binding 27.0 ± 0.7 mg U/g dry biomass. In both cases, these amounts correspond to around 85% of the initially applied uranium. Interestingly, at a lower and more environmentally relevant uranium concentration of 5 μM, living cells firstly bind with 1.3 ± 0.2 mg U/g dry biomass to 1.4 ± 0.1 mg U/g dry biomass almost all uranium within the first 5 min of incubation. But then algal cells again mobilize up to 80% of the bound uranium during ongoing incubation in the time from 48 h to 96 h. The release of metabolism related substances is suggested to cause this mobilization of uranium. As potential leachates for algal-bound uranium oxalate, citrate and ATP were tested and found to be able to mobilize more than 50% of the algal-bound uranium within 24 h. Differences in complexation of uranium by active and inactive algae cells were investigated with a combination of time-resolved laser-induced fluorescence spectroscopy (TRLFS), extended X-ray absorption fine structure (EXAFS) spectroscopy and attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy. Obtained results demonstrated an involvement of carboxylic and organic/inorganic phosphate groups in the uranium complexation with varying contributions dependent on cell status, uranium concentration and pH.

3,7 miljonit võimalust üksinduseks / Kai Tamm

Index Scriptorium Estoniae

Kutman, Kai, 1972-

2011-01-01

21. aprillil Berliinis Kulturbrauerei Kesselhausis esietendunud Age Veeroosi ooperist "Grid", libreto autor ja lavastaja Korneel Hamers, dirigent Taavi Kull, videokunstnik Julian bergheim, lavakujunduse autor Julia Rommel. Lk. 17 lühiintervjuu heliloojaga

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... MD, professor of ophthalmology at Case Western Reserve University in Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In ...

BYSTANDER EFFECTS GENOMIC INSTABILITY, ADAPTIVE RESPONSE AND CANCER RISK ASSESSMENT FOR RADIAION AND CHEMICAL EXPOSURES

Science.gov (United States)

BYSTANDER EFFECTS, GENOMIC INSTABILITY, ADAPTIVE RESPONSE AND CANCER RISK ASSESSMENT FOR RADIATION AND CHEMICAL EXPOSURESR. Julian PrestonEnvironmental Carcinogenesis Division, U.S. Environmental Protection Agency, Research Triangle Park, N.C. 27711, USAThere ...

The role of cognitive and emotional perspective taking in economic decision making in the ultimatum game.

Science.gov (United States)

Takagishi, Haruto; Koizumi, Michiko; Fujii, Takayuki; Schug, Joanna; Kameshima, Shinya; Yamagishi, Toshio

2014-01-01

We conducted a simple resource allocation game known as the ultimatum game (UG) with preschoolers to examine the role of cognitive and emotional perspective-taking ability on allocation and rejection behavior. A total of 146 preschoolers played the UG and completed a false belief task and an emotional perspective-taking test. Results showed that cognitive perspective taking ability had a significant positive effect on the proposer's offer and a negative effect on the responder's rejection behavior, whereas emotional perspective taking ability did not impact either the proposer's or responder's behavior. These results imply that the ability to anticipate the responder's beliefs, but not their emotional state, plays an important role in the proposer's choice of a fair allocation in an UG, and that children who have not acquired theory of mind still reject unfair offers.

Active use of urban park facilities

DEFF Research Database (Denmark)

Lindberg, Michael; Schipperijn, Jasper

2015-01-01

groups of the facilities. Facilities that provide the opportunity for games and playing activities are more used for PA than facilities directed at individual training of strength and fitness. The opportunity for socializing and playing while being physically active seems important for many users...... was mentioned as a key factor when designing facilities. Our results provide important knowledge to architects, planners and policy makers when aiming at designing activity-promoting facilities in UGS. Future studies need to further investigate the use of facilities among specific target groups, particularly......Abstract Urban green spaces (UGS), and more specific a higher number of facilities in UGS, have been positively associated with physical activity (PA). However, more detailed studies of which facilities generate high levels of PA, for which type of users, are relevant as existing knowledge...

Wpływy polskie w jidysz według "History of the Yiddish Language" Maxa Weinreicha – przegląd i próby weryfikacji

Directory of Open Access Journals (Sweden)

Michał Gajek

2016-12-01

Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish.   Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa

Synthesis, characterization and catalytic application of Ni catalysts ...

Indian Academy of Sciences (India)

2017-11-11

Nov 11, 2017 ... 3Department of Industrial Engineering, Technological Institute of Leon, Industrial Julian de Obregon .... ethanol were mixed under an inert atmosphere of nitrogen, ..... lower selectivity towards hydrogen due to major production.

Characterization of land surface energy fluxes in a tropical lowland rice paddy

Science.gov (United States)

Chatterjee, Dibyendu; Tripathi, Rahul; Chatterjee, Sumanta; Debnath, Manish; Shahid, Mohammad; Bhattacharyya, Pratap; Swain, Chinmaya Kumar; Tripathy, Rojalin; Bhattacharya, Bimal K.; Nayak, Amaresh Kumar

2018-04-01

A field experiment was conducted in 2015 to study the land surface energy fluxes from tropical lowland rice paddy in eastern India with an objective to determine the mass, momentum, and energy exchange rates between rice paddies and the atmosphere. All the land surface energy fluxes were measured by eddy covariance (EC) system (make Campbell Scientific) in dry season (DS, 1-125 Julian days), dry fallow (DF, 126-181 Julian days), wet season (WS, 182-324 Julian days), and wet fallow (WF, 325-365 Julian days). The rice was cultivated in dry season (January-May) and wet season (July-November) in low wet lands and the ground is kept fallow during the remainder of the year. Results showed that albedo varied from 0.09 to 0.24 and showed positive value from morning 6:00 h until evening 18:00 h. Mean soil temperature (T g) was highest in DF, while the skin temperature (T s) was highest in WS. Average Bowen ratio (B) ranged from 0.21 to 0.64 and large variation in B was observed during the fallow periods as compared to the cropping seasons. The magnitude of aerodynamic, canopy, and climatological resistances increased with the progress of cropping season and their magnitudes decreased during the end of both cropping seasons and found minimum during the fallow periods. At a constant vapor pressure deficit (VPD) at 0.16, 0.18, 0.15, and 0.43 kPa, latent heat flux (LE) initially increased, but later it tended to level off with an increase in VPD. The actual evapotranspiration (ETa) during both the cropping seasons was higher than the fallow period. This study can be used as a source of default values for many land surface energy fluxes which are required in various meteorological or air-quality models for rice paddies. A larger imbalance of energy was observed during the wet season as the energy is stored and perhaps advected in the fresh water.

On star-critical and upper size Ramsey numbers

NARCIS (Netherlands)

Zhang, Yanbo; Broersma, Haitze J.; Chen, Yaojun

2016-01-01

In this paper, we study the upper size Ramsey number u(G1,G2)u(G1,G2), defined by Erdős and Faudree, as well as the star-critical Ramsey number r∗(G1,G2)r∗(G1,G2), defined by Hook and Isaak. We define Ramsey-full graphs and size Ramsey good graphs, and perform a detailed study on these graphs. We

Prizjorov kinofestivalei ne dopustili k borbje za "Oskar"

Index Scriptorium Estoniae

2007-01-01

Ameerika kinoakadeemia võõrkeelse filmi "Oscari" auhinnale ei pääsenud kandideerima Ang Lee Veneetsias Kuldlõvi saanud film "Ettevaatust, iha" ning Julian Schnabeli Cannes'is režiiauhinna saanud "Skafander ja liblikas"

76 FR 2383 - Ocean Transportation Intermediary License Reissuance

Science.gov (United States)

2011-01-13

.... 021694N Wheelsky Logistics, Inc., November 19, 2010. 14515 East Don Julian Road, City of Industry, CA... City, CA 91780. 018525N Valu Freight Consolidators, November 19, 2010. Inc., 1325 NW 21th Street, Miami...

EPRA avas 20. tegevushooaja

Index Scriptorium Estoniae

2015-01-01

15. septembril oli EPRA-l külas kogenud briti suhtekorraldaja ja ajalehe The Sun endine toimetaja Stuart Higgins ning Eestis veel katmata ala, õigusala meediaekspert Julian Pike. Selle kohtumisega avas EPRA oma 20. tegevushooaja

Gelatin methacrylamide as coating material in cell culture.

Science.gov (United States)

Egger, Michael; Tovar, Günter E M; Hoch, Eva; Southan, Alexander

2016-06-13

Unmodified gelatin (uG) is widely used as a coating material in cell culture for improving surface properties. In this study, the authors investigated if gelatin methacrylamide (GM) with a medium degree of methacrylamide modification (GM1.5) and a high degree of methacrylamide modification (GM4) are equally suitable for this purpose. Therefore, gold surfaces were coated with uG, GM1.5, and GM4 by adsorption of the polymers on the surfaces. Coating success was confirmed by spectroscopic ellipsometry, contact angle measurements, surface plasmon resonance spectroscopy (SPRS), and atomic force microscopy (AFM). The authors found that upon adsorption of uG, GM1.5, a nd GM4 on gold, thin films with thicknesses of 2.95 nm, 2.50 nm, and 2.26 nm were formed. The coated surfaces showed advancing contact angles of 46° (uG and GM1.5) and 52° (GM4) without alteration of the surface roughness determined by AFM. Protein adsorption taking place on the coated surfaces was measured during contact of the surfaces with fetal calf serum by SPRS. Protein adsorption on the coated surfaces was reduced by the factor of 6.4 (uG), 5.4 (GM1.5), and 4.6 (GM4) compared to gold surfaces. Human fibroblasts cultured on the surfaces showed excellent viability shown by water soluble tetrazolium salt assay as well as live/dead staining with propidium iodide and fluorescein diacetate. No cytotoxic effects of the GM coated surfaces were observed, giving rise to the conclusion that GMs are suitable materials as coatings in cell culture.

Impact of the rural pipeline in medical education: practice locations of recently graduated family physicians in Ontario.

Science.gov (United States)

Wenghofer, Elizabeth F; Hogenbirk, John C; Timony, Patrick E

2017-02-20

The "rural pipeline" suggests that students educated in rural, or other underserviced areas, are more likely to establish practices in such locations. It is upon this concept that the Northern Ontario School of Medicine (NOSM) was founded. Our analysis answers the following question: Are physicians who were educated at NOSM more likely to practice in rural and northern Ontario compared with physicians who were educated at other Canadian medical schools? We used data from the College of Physicians and Surgeons of Ontario. We compared practice locations of certified Ontario family physicians who had graduated from NOSM vs. other Canadian medical schools in 2009 or later. We categorized the physicians according to where they completed their undergraduate (UG) and postgraduate (PG) training, either at NOSM or elsewhere. We used logistic regression models to determine if the location of UG and PG training was associated with rural or northern Ontario practice location. Of the 535 physicians examined, 67 had completed UG and/or PG medical education at NOSM. Over two thirds of physicians with any NOSM education were practicing in northern areas and 25.4% were practicing in rural areas of Ontario compared with those having no NOSM education, with 4.3 and 10.3% in northern and rural areas, respectively. Physicians who graduated from NOSM-UG were more likely to have practices located in rural Ontario (OR = 2.57; p = 0.014) whereas NOSM-PG physicians were more likely to have practices in northern Ontario (OR = 57.88; p education was associated with an increased likelihood of practicing in rural (NOSM-UG) and northern (NOSM-PG) Ontario.

Locating Ground-Water Discharge in the Hanford Reach of the Columbia River

International Nuclear Information System (INIS)

Lee, D.R.; Geist, D.R.; Saldi, K.; Hartwig, D.; Cooper, T.

1997-01-01

A bottom-contacting probe for measuring electrical conductivity at the sediment-water interface was used to scan the bed of the Columbia River adjacent to the Hanford Site in southeast Washington State during a 10-day investigation. Four river-sections, each about a kilometer in length, were scanned for variations in electrical conductivity. The probe was towed along the riverbed at a speed of 1 m/s and is position was recorded using a Global Positioning System. The bottom tows revealed several areas of elevated electrical conductivity. Where these anomalies were relatively easy to access, piezometers were driven into the riverbed and porewater electrical conductivity ranged from 111 to 150 uS/cm. The piezometers, placed in electrical conductivity ''hotspots'' yielded chemical or isotopic data consistent with previous analyses of water taken from monitoring wells and visible shoreline seeps. Tritium, nitrate, and chromium exceeded water quality standards in some porewaters. The highest tritium and nitrate levels were found near the Old Hanford Townsite at 120,000 pCi/L (+ 5,880 pCi/L total propagated analytical uncertainty) and ug/L (+ 5,880 ug/L), respectively. The maximum chromium (total and hexavalent) levels were found near 100-H reactor area where unfiltered porewater total chromium was 1,900 ug/L (+ 798 ug/L) and hexavalent chromium was 20 ug/L. The electrical conductivity probe provided rapid, cost-effective reconnaissance for ground-water discharge areas when used in combination with conventional piezometers. It may be possible to obtain quantitative estimates of both natural and contaminated ground-water discharge in the Hanford Reach with more extensive surveys of river bottom

Equal status in Ultimatum Games promotes rational sharing.

Science.gov (United States)

Han, Xiao; Cao, Shinan; Bao, Jian-Zhang; Wang, Wen-Xu; Zhang, Boyu; Gao, Zi-You; Sánchez, Angel

2018-01-19

Experiments on the Ultimatum Game (UG) repeatedly show that people's behaviour is far from rational. In UG experiments, a subject proposes how to divide a pot and the other can accept or reject the proposal, in which case both lose everything. While rational people would offer and accept the minimum possible amount, in experiments low offers are often rejected and offers are typically larger than the minimum, and even fair. Several theoretical works have proposed that these results may arise evolutionarily when subjects act in both roles and there is a fixed interaction structure in the population specifying who plays with whom. We report the first experiments on structured UG with subjects playing simultaneously both roles. We observe that acceptance levels of responders approach rationality and proposers accommodate their offers to their environment. More precisely, subjects keep low acceptance levels all the time, but as proposers they follow a best-response-like approach to choose their offers. We thus find that status equality promotes rational sharing while the influence of structure leads to fairer offers compared to well-mixed populations. Our results are far from what is observed in single-role UG experiments and largely different from available predictions based on evolutionary game theory.

THE DETERMINATION OF BUPROPION HYDROCHLORIDE IN PHARMACEUTICAL DOSAGE FORMS BY ORIGINAL UV- AND SECOND DERIVATIVE UV SPECTROPHOTOMETRY, POTENTIOMETRIC AND CONDUCTOMETRIC METHODS

Directory of Open Access Journals (Sweden)

Duygu YENİCELİ

2010-08-01

Full Text Available Spectrophotometric, potentiometric and conductometric methods are developed for the determination of bupropion hydrochloride (BLIP in pharmaceutical tablets. For the first method, original UV-spectrophotometry, 252 nm was determined as the optimum wavelength and used for the determinations. For the other method, second derivative UV spectrophotometry, the absorbances were measured at 217.4 and 221.8 nm and the distance between these extremum values was determined according to peak to peak method. Two spectrophotometric methods were validated over the concentration range of 5.72 - 20.03 ug/mL. The limit of detection and limit of quantitation values of original UV-spectrophotometry were 0.75 ug/mL and 2.28 jug/mL. Also, these parameters were determined as 0.23 ug/mL and 0.68 ug/mL respectively, for the second derivative UV spectrophotometry. Developed methods were fully validated and the applicability of the methods for the determination of BUP in pharmaceuticals were demonstrated. Also, simple potentiometric and conductometric methods were developed and the applicability of these methods were demonstrated. The results of four analytical methods were compared with ANOVA test and no significant difference was found statistically. As a result, the developed methods could be proposed to the rutin content analysis to be simple, cheap, accurate, and precise

Differential response of oyster shell powder on enzyme profile and nutritional value of oyster mushroom Pleurotus florida PF05.

Science.gov (United States)

Naraian, Ram; Narayan, Om Prakash; Srivastava, Jatin

2014-01-01

Oyster mushroom Pleurotus florida was cultivated on different combinations of wheat straw (WS) as basal substrate and oyster shell powder (OSP) supplement. The OSP supplementation considerably responded to different cultivation phases. The mycelium grew fast and showed rapid growth rate (8.91 mmd(-1)) in WS + OSP (97 + 3) combination while WS + OSP (92 + 8) showed maximum laccase (3.133 U/g) and Mn peroxidase (MnP) activities (0.091 U/g). The climax level of laccase (5.433 U/g) and MnP (0.097 U/g) was recorded during fruit body initiation in WS + OSP (97 + 3) and WS + OSP (98 + 2) combinations, respectively. The WS + OSP (97 + 3) combination represented the best condition for mushroom cultivation and produced the highest biological efficiency (147%). In addition, protein and lipid contents in fruit bodies were slightly improved in response to OSP. The carbohydrate was significantly increased by raising concentration of OSP. The highest values of protein, carbohydrate, and lipid noted were 31.3 μg/g, 0.0639 (g/g), and 0.373 (g/g) correspondingly. Conclusively it was evident that lower concentrations of OSP acted positively and relatively to higher concentrations and improved nutritional content which may suitably be used to enhance both yield and nutritional values of mushroom.

Evaluating detection and estimation capabilities of magnetometer-based vehicle sensors

Science.gov (United States)

Slater, David M.; Jacyna, Garry M.

2013-05-01

In an effort to secure the northern and southern United States borders, MITRE has been tasked with developing Modeling and Simulation (M&S) tools that accurately capture the mapping between algorithm-level Measures of Performance (MOP) and system-level Measures of Effectiveness (MOE) for current/future surveillance systems deployed by the the Customs and Border Protection Office of Technology Innovations and Acquisitions (OTIA). This analysis is part of a larger M&S undertaking. The focus is on two MOPs for magnetometer-based Unattended Ground Sensors (UGS). UGS are placed near roads to detect passing vehicles and estimate properties of the vehicle's trajectory such as bearing and speed. The first MOP considered is the probability of detection. We derive probabilities of detection for a network of sensors over an arbitrary number of observation periods and explore how the probability of detection changes when multiple sensors are employed. The performance of UGS is also evaluated based on the level of variance in the estimation of trajectory parameters. We derive the Cramer-Rao bounds for the variances of the estimated parameters in two cases: when no a priori information is known and when the parameters are assumed to be Gaussian with known variances. Sample results show that UGS perform significantly better in the latter case.

Serum levels of zinc and copper in epileptic children during long-term therapy with anticonvulsants.

Science.gov (United States)

Talat, Mohamed A; Ahmed, Anwar; Mohammed, Lamia

2015-10-01

To evaluate the serum levels of zinc and copper in epileptic children during the long-term treatment of anticonvulsant drugs and correlate this with healthy subjects. A hospital-based group matched case-control study was conducted in the Department of Pediatrics, Faculty of Medicine, Zagazig University, Zagazig, Egypt between November 2013 and October 2014. Ninety patients aged 7.1 ± 3.6 years were diagnosed with epilepsy by a neurologist. The control group was selected from healthy individuals and matched to the case group. Serum zinc and copper were measured by the calorimetric method using a colorimetric method kit. The mean zinc level was 60.1 ± 22.6 ug/dl in the cases, and 102.1 ± 18 ug/dl in the controls (p<0.001). The mean copper level was 180.1 ± 32.4 ug/dl in cases compared with 114.5 ± 18.5 ug/dl in controls (p<0.001). Serum zinc levels in epileptic children under drug treatment are lower compared with healthy children. Also, serum copper levels in these patients are significantly higher than in healthy people. No significant difference in the levels of serum copper and zinc was observed in using one drug or multiple drugs in the treatment of epileptic patients.

High Burden of Subclinical Lead Toxicity after Phase Out of Lead from Petroleum in Pakistan.

Science.gov (United States)

Majid, Hafsa; Khan, Aysha Habib; Khan, Nadeem Ullah; Siddiqui, Imran; Ghani, Farooq; Jafri, Lena

2017-12-01

To evaluate the frequency of subclinical lead toxicity. Cross-sectional study. Department of Pathology and Laboratory Medicine, The Aga Khan University Hospital, Karachi, from January 2011 to December 2014. Analysis of laboratory data for blood lead levels (BLL) was performed. Lead was tested by atomic absorption spectrometer. For all subjects, only initial test results were included while the results of repeated testing were excluded. Exemption was sought from institutional ethical review committee. BLL of 2-10 ug/dl and 10-70 ug/dl in children and adults, respectively were taken as subclinical lead toxicity. Amongst the total number of subjects tested (n=524), 26.5% (n=139) were children (lead level 16.9 ug/dl (36.1-4)] and lower level [4.2 ug/dl (6.8-2.6)] in children with lead levels while most had either subclinical (76%, n=106) or toxic lead levels (8%, n=11). In adults, (55%, n=212) subjects had desired lead levels, and 40% (n=154) and 4.99% (n=19) had subclinical and toxic lead levels. Presence of subclinical lead poisoning even after phasing out of lead petroleum in Pakistanis is alarming, especially in children. A national population-based study to determine the lead status and targeted intervention to identify potential sources is need of the time.

Pectinase production by Penicillium viridicatum RFC3 by solid state fermentation using agricultural wastes and agro-industrial by-products

Directory of Open Access Journals (Sweden)

Silva Dênis

2002-01-01

Full Text Available Pectin lyase and polygalacturonase production by newly isolated Penicillium viridicatum strain Rfc3 was carried out by means of solid state fermentation using orange bagasse, corn tegument, wheat bran and mango and banana peels as carbon sources. The maximal activity value of polygalacturonase (Pg (30U.g-1 was obtained using wheat bran as carbon source while maximal pectin lyase (Pl (2000 U.g-1 activity value was obtained in medium composed of orange bagasse. Mixtures of banana or mango peels with sugar cane bagasse resulted in increased Pg and Pl production compared to fermentations in which this residue was not used. The mixture of orange bagasse and wheat bran (50% increased the production of Pg and Pl to 55 U.g-1 and 3540 U.g -1 respectively. Fractions of Pg and Pl, isolated by gel filtration in Sephadex G50, presented optimum activity at pH 5.0 and 10.5 respectively. Maximal activity of Pg and Pl fractions was determined at 55ºC and 50ºC respectively. Pg was stable in neutral pH range and at 40ºC whereas Pl was stable in acidic pH and at 35ºC, for 1 h.

The role of cognitive and emotional perspective taking in economic decision making in the ultimatum game.

Directory of Open Access Journals (Sweden)

Haruto Takagishi

Full Text Available We conducted a simple resource allocation game known as the ultimatum game (UG with preschoolers to examine the role of cognitive and emotional perspective-taking ability on allocation and rejection behavior. A total of 146 preschoolers played the UG and completed a false belief task and an emotional perspective-taking test. Results showed that cognitive perspective taking ability had a significant positive effect on the proposer's offer and a negative effect on the responder's rejection behavior, whereas emotional perspective taking ability did not impact either the proposer's or responder's behavior. These results imply that the ability to anticipate the responder's beliefs, but not their emotional state, plays an important role in the proposer's choice of a fair allocation in an UG, and that children who have not acquired theory of mind still reject unfair offers.

Precipitation in Santa Barbara, CA on varying timescales and the relationships with the El Niño Southern Oscillation, the Madden-Julian Oscillation, and atmospheric rivers

Science.gov (United States)

Harris, S. M.; Carvalho, L. V.; Jones, C.

2013-12-01

This study aimed to understand the patterns and variations of extreme precipitation events that occur in Santa Barbara County and determine the relationships with various phenomena that affect the region. Santa Barbara, CA is an area with complex topography that is disposed to numerous hazard events including landslides and flooding, particularly during the region's rainy season (Nov.-Apr.). These incidents are especially frequent in the seasons after fire-events, another hazard common to the region. In addition, Santa Barbara is affected by several tropical phenomena that influence precipitation on varying timescales including the El Niño Southern Oscillation (ENSO), the Madden-Julian Oscillation (MJO), and atmospheric rivers (ARs). It is well known that ENSO and the MJO influence storms that occur in southern California through processes such as the modulation of the upper level jet and the low level moisture flux. ARs have been revealed to be responsible for the movement of large quantities of water vapor from tropical areas to the midlatitudes and have been linked to high-intensity storms throughout the western coast of North America. We examined rainy season (Nov.-Apr.) precipitation within Santa Barbara County using hourly rainfall data spanning approximately forty years (~1971-2010) from seven, local, rain gauge stations. The distributions as well as totals of precipitation on varying timescales (hourly, daily, seasonal, and yearly) were defined for specified intensities of rainfall based upon the 75th, 90th, 95th, and 99th percentiles. Persistence, expressed as the number of consecutive hours (or days) including intense precipitation defined according to the percentiles, was investigated on the hourly and daily timescales. In addition, specified storm episodes identified in this study were examined with data from the Tropical Rainfall Measurement Mission in order to assess the spatial features of high-intensity storms. Results from this analysis will be

Colored Contact Lens Dangers

Science.gov (United States)

... Hazard: The Hidden Dangers of Buying Decorative Contact Lenses Without a Prescription Leer en Español: Peligros asociados ... truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In One Eye By Non- ...

Glucosamine and Chondroitin for Osteoarthritis

Science.gov (United States)

... implications for human efficacy and toxicity. Archives of Biochemistry and Biophysics. 2011;510(1):11–18. Cahlin ... M.P.H., University of Maryland; Julian Leakey, Ph.D., U.S. Food and Drug Administration; Allen Sawitzke, ...

Unigene BLAST: CBRC-RNOR-20-0133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-20-0133 gnl|UG|Rn#S14181288 UI-R-DO1-cms-c-10-0-UI.s1 UI-R-DO1 Rattus nor...vegicus cDNA clone UI-R-DO1-cms-c-10-0-UI 3', mRNA sequence /clone=UI-R-DO1-cms-c-10-0-UI /clone_end=3' /gb=BQ202827 /gi=20419292 /ti=154455115 /ug=Rn.83937 /len=645 0.001 44% ...

Trustworthiness and Negative Affect Predict Economic Decision-Making

OpenAIRE

Nguyen, Christopher M.; Koenigs, Michael; Yamada, Torricia H.; Teo, Shu Hao; Cavanaugh, Joseph E.; Tranel, Daniel; Denburg, Natalie L.

2011-01-01

The Ultimatum Game (UG) is a widely used and well-studied laboratory model of economic decision-making. Here, we studied 129 healthy adults and compared demographic (i.e., age, gender, education), cognitive (i.e., intelligence, attention/working memory, speed, language, visuospatial, memory, executive functions), and personality (i.e., “Big Five”, positive affect, negative affect) variables between those with a “rational” versus an “irrational” response pattern on the UG. Our data indicated t...

Planar algebra of the subgroup-subfactor

Indian Academy of Sciences (India)

We think of R α G as the II1-factor (R ∪{ug: g ∈ G}) ⊂ L(L2(R)), where ug(ˆx) ..... define a global trace on P, where for 0± the trace for P0± ∼= C is the obvious identity .... function for strings is either a local maximum or a local minimum. ..... In order to understand how the inclusion tangles act on the subgroup-subfactor planar.

Gene : CBRC-HSAP-06-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-06-0003 Novel 6 D UNKNOWN CN165_HUMAN 2e-21 63% dbj|BAC85887.1| unnamed protein product [Homo sapi...ens] 7e-35 68% gnl|UG|Hs#S28297950 DA109160 BRACE3 Homo sapiens cDNA clone BRACE302...5623 5', mRNA sequence /clone=BRACE3025623 /clone_end=5' /gb=DA109160 /gi=80475782 /ug=Hs.690917 /len=598 1e-39 69% MAPI...YRHMPPYPTNFCIFSRDRLSLCWPGWSPFLISGDPAALVSQSAGITGVSHGTWPFDCFSSFELGLFLPPHSPIAILEILGYQILPGQVSAPIDAYSNAVPFSHGF ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager ... about the members of the eye-care team . Consumer warning about the improper use of colored contact ...

effect of tenure security on livelihood activities of women farmers in ...

African Journals Online (AJOL)

KANETH

1989-05-03

May 3, 1989 ... Keywords: tenure security, livelihood activities and rural women. INTRODUCTION .... sale to buy farming inputs or other things they cannot produce. Also about 20% of the .... Internet Insiders, USA: McGraw Hill. Quan Julian ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... Cleveland. "This is far from the truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager ... the lenses. Never share contact lenses with another person. Get follow up exams with your eye care ...

CARCINOGENIC EFFECTS OF LOW DOSES OF IONIZING RADIATION

Science.gov (United States)

Carcinogenic Effects of Low Doses of Ionizing RadiationR Julian Preston, Environmental Carcinogenesis Division, NHEERL, U.S. Environmental Protection Agency, Research Triangle Park, NC 27711The form of the dose-response curve for radiation-induced cancers, particu...

Uso del escobajo como sustrato para el crecimiento de hongos de la pudrición blanca, la producción de enzimas ligninolíticas y la decoloración de tinturas Grape stalks as substrate for white rot fungi, lignocellulolytic enzyme production and dye decolorization

Directory of Open Access Journals (Sweden)

Laura Levin

2012-06-01

Full Text Available El objetivo de este trabajo fue evaluar el potencial del escobajo, un residuo agroindustrial, como sustrato para el crecimiento y la producción de enzimas lignocelulósicas de tres hongos causantes de pudrición blanca en la madera: Trametes trogii, Stereum hirsutum y Coriolus antarcticus. Para ello se utilizaron técnicas de fermentación en estado sólido. También se ensayó la decoloración de colorantes industriales sobre estos cultivos. La pérdida de peso seco del sustrato fue similar después del día 60 (33-43 %. C. antarcticus produjo las mayores actividades de lacasa y Mn-peroxidasa (33,0 y 1,6 U/g peso seco. La mayor actividad endoglucanasa fue medida en cultivos de S. hirsutum (10,4 U/g, y la mayor actividad endoxilanasa en T. trogii (14,6 U/g. El sistema C. antarcticus/escobap mostró un importante potencial para su aplicación en la biorremediación de efluentes textiles, con porcentajes de decoloración de 93, 86, 82, 82, 77 y 58 % para índigo carmín, verde de malaquita, azure B, azul R brillante de remazol, cristal violeta y xilidina, respectivamente, en 5 h.The aim of this work was to evaluate the potential of grape stalks, an agroindustrial waste, for growth and lignocellulolytic enzyme production via solid-state fermentation, using the following three white rot fungi: Trametes trogii, Stereum hirsutum and Coriolus antarcticus. The decolorization of several dyes by the above mentioned cultures was also investigated. Similar values of dry weight loss of the substrate were measured after 60 days (33-43 %. C. antarcticus produced the highest laccase and Mn-peroxldase activities (33.0 and 1.6 U/g dry solid. The maximum endoglucanase production was measured in S. hirsutum cultures (10.4 U/g, while the endoxylanase peak corresponded to T. trogii (14.6 U/g. The C. antarcticus/grape stalk system seems potentially competitive in bioremediation of textile processing effluents, attaining percentages of decolorization of 93, 86, 82, 82

Error-free versus mutagenic processing of genomic uracil--relevance to cancer.

Science.gov (United States)

Krokan, Hans E; Sætrom, Pål; Aas, Per Arne; Pettersen, Henrik Sahlin; Kavli, Bodil; Slupphaug, Geir

2014-07-01

Genomic uracil is normally processed essentially error-free by base excision repair (BER), with mismatch repair (MMR) as an apparent backup for U:G mismatches. Nuclear uracil-DNA glycosylase UNG2 is the major enzyme initiating BER of uracil of U:A pairs as well as U:G mismatches. Deficiency in UNG2 results in several-fold increases in genomic uracil in mammalian cells. Thus, the alternative uracil-removing glycosylases, SMUG1, TDG and MBD4 cannot efficiently complement UNG2-deficiency. A major function of SMUG1 is probably to remove 5-hydroxymethyluracil from DNA with general back-up for UNG2 as a minor function. TDG and MBD4 remove deamination products U or T mismatched to G in CpG/mCpG contexts, but may have equally or more important functions in development, epigenetics and gene regulation. Genomic uracil was previously thought to arise only from spontaneous cytosine deamination and incorporation of dUMP, generating U:G mismatches and U:A pairs, respectively. However, the identification of activation-induced cytidine deaminase (AID) and other APOBEC family members as DNA-cytosine deaminases has spurred renewed interest in the processing of genomic uracil. Importantly, AID triggers the adaptive immune response involving error-prone processing of U:G mismatches, but also contributes to B-cell lymphomagenesis. Furthermore, mutational signatures in a substantial fraction of other human cancers are consistent with APOBEC-induced mutagenesis, with U:G mismatches as prime suspects. Mutations can be caused by replicative polymerases copying uracil in U:G mismatches, or by translesion polymerases that insert incorrect bases opposite abasic sites after uracil-removal. In addition, kataegis, localized hypermutations in one strand in the vicinity of genomic rearrangements, requires APOBEC protein, UNG2 and translesion polymerase REV1. What mechanisms govern error-free versus error prone processing of uracil in DNA remains unclear. In conclusion, genomic uracil is an

ANTIGENIC RELATEDNESS OF SELECTED FLAVIVIRUSES: STUDY WITH HOMOLOGOUS AND HETEROLOGOUS IMMUNE MOUSE ASCITIC FLUIDS

Directory of Open Access Journals (Sweden)

S.S. BABA

1998-11-01

Full Text Available The antigenic relationship of 9 flaviviruses, Yellow fever (YF , Wesselsbron (WSL , Uganda S (UGS , Potiskum (POT, West Nile (WN , Banzi (BAN , Zika (ZK , Dengue type 1 (DEN-1 and Dengue type 2 (DEN-2, was assessed by cross-haemagglutination-inhibition (Cross-HI and cross-complement fixation (Cross-CF reactions between each of the viruses and their homologous immune mouse ascitic fluids. Titre ratios were calculated using the heterologous and homologous titres. Cross-CF reactions revealed wider antigenic variations among viruses than Cross-HI reactions. There was no significant antigenic variation between WSL, POT and YF viruses using either of those methods. However, definite differences in antigenicity were observed between them and UGS, BAN and ZK viruses. There were no significant differences between UGS, BAN and ZK or between DEN-1 and DEN-2. The serological relationship among flaviviruses is important in establishing diagnosis and epidemiology of these infections in Africa.A relação antigênica de 9 Flavivirus, Febre amarela (YF, Wesselsbron (WSL, Uganda S (UGS, Potiskum (POT, West Nile (WN, Banzi (BAN, Zika (ZK, Dengue tipo 1 (DEN-1 e Dengue tipo2 (DEN-2, foi avaliada por reação de inibição da hemaglutinação cruzada (cross-HI e reação de fixação do complemento cruzada (Cross-CF entre cada um dos virus e seu fluido ascítico homólogo em camundongos. Médias de títulos foram calculadas usando os títulos heterólogos e homólogos. Reações cruzadas CF revelaram maiores variações antigênicas entre virus do que reações cruzadas HI. Não houve variação antigênica significativa entre virus WSL, POT e YF usando cada um dos métodos. Todavia, diferenças definidas da antigenicidade foram observadas entre eles e os vírus UGS, BAN e ZK. Não existiram diferenças significativas entre UGS, BAN e ZK ou entre DEN-1 e DEN-2. A relação sorológica entre Flavivirus é importante para se estabelecer o diagnóstico e a

Effects of TBT (Tributyltin) on Marine Organisms: Field Assessment of a New Site-Specific Bioassay System.

Science.gov (United States)

1987-12-01

evaluated in San Diego Bay over a 7-month period using tributyltin ( TBT ) antifouling leachates. Three TBT concentrations (k = 0.065, 0.077 and 0.193 ug...tional value and epifaunal organisms and 2) test using tributyltin (TT) antifouling leachates. the efficacy of the PETS. The results of the TBT Three...Conoentrations of 0.200, study the effects of tributyltin (TBI), the primary 0.050 and 0.020 ug/l, respectively. Unfiltered toxic component of organotin AF

«Truman» (2015: About Friendship, of Life and Death

Directory of Open Access Journals (Sweden)

Nani GRANERO MOYA

2017-03-01

Full Text Available Truman deals with last stage of Julian´s life, an Argentinian actor who suffers from lung cancer and refuses to continue chemotherapy because his prognosis is gloomy. In the film, Julian meets his friend Tomás, and through the narration of the meeting we are revealed the protagonist´s concerns, fears, emotions and desires from his illness experience. We think this story may be useful to citizens because the death topic is treated with naturalness.  His analysis can also help healthcare professionals and Health Sciences professors to deliberate with patients, their families or students about coping with a terminal illness and it can bring them to reflect on personal relationships, life events and the values that really matter. This is a story that speaks, ultimately, about friendship, about life and death.

Ultrasound-Assisted Esterification of Valeric Acid to Alkyl Valerates Promoted by Biosilicified Lipases

Directory of Open Access Journals (Sweden)

Soledad Cebrián-García

2018-06-01

Full Text Available A novel, environmentally friendly, and sustainable ultrasound-assisted methodology in the valorization of valeric acid to alkyl valerate using a biosilicified lipase from Candida antarctica is reported. This one-pot room temperature methodology of enzyme biosilicification leads to biosilicified lipases with improved activity and reaction efficiency as compared to free enzymes. Yields in the ultrasound-promoted esterification of valeric acid was ca. 90% in 2 h with 15% m/v of biosilicified lipase (Bio-lipase; 616 U/g biocatalyst enzymatic activity and a molar ratio 1:2 (valeric acid:ethanol, slightly superior to that observed by the free enzyme (75% conversion, 583U/g biocatalyst enzymatic activity. The reuse of enzymes in these conditions was tested and the results show a relatively good reusability of these biosilicified enzymes under the investigated conditions, particularly preserving fairly stable specific activities (616 vs. 430 U/g biocatalyst after four reuses.

Gas Storage in Europe, recent developments and outlook to 2035

International Nuclear Information System (INIS)

Hureau, Geoffroy

2015-01-01

These slides present: the European gas storage market in 2014 (Review of 2014 trends, Current challenges, Role of storage); the Outlook to 2035 (Supply/Demand factors, Estimated Storage needs, Project backlog). In conclusion: an over capacity is expected until 2025.Supply and demand evolution, market liberalization and environmental constraints on coal will drive a new period of growth for UGS. Cedigaz estimates that European UGS capacity will increase by around 45 bcm by 2035. UGS projects represent 77 bcm Of which 22 bcm is under construction, there is a majority of salt-cavern projects (market liberalization), not so much new seasonal storage (security of supply?), not all planned storage will be built (Projects under competition for the same (regional) market, the situation is quite contrasted between NW Europe and South-Southeast Europe (and UK)). The challenges are the investment and the security of supply

Underrepresented minority high school and college students report STEM-pipeline sustaining gains after participating in the Loma Linda University Summer Health Disparities Research Program.

Directory of Open Access Journals (Sweden)

Lorena M Salto

Full Text Available An urgent need exists for graduate and professional schools to establish evidence-based STEM (science, technology, engineering, and math pipeline programs to increase the diversity of the biomedical workforce. An untapped yet promising pool of willing participants are capable high school students that have a strong STEM interest but may lack the skills and the guided mentoring needed to succeed in competitive STEM fields. This study evaluates and compares the impact of the Loma Linda University (LLU Summer Health Disparities Research Program on high school (HS and undergraduate (UG student participants. The primary focus of our summer research experience (SRE is to enhance the research self-efficacy of the participants by actively involving them in a research project and by providing the students with personalized mentoring and targeted career development activities, including education on health disparities. The results of our study show that our SRE influenced terminal degree intent and increased participant willingness to incorporate research into future careers for both the HS and the UG groups. The quantitative data shows that both the HS and the UG participants reported large, statistically significant gains in self-assessed research skills and research self-efficacy. Both participant groups identified the hands-on research and the mentor experience as the most valuable aspects of our SRE and reported increased science skills, increased confidence in science ability and increased motivation and affirmation to pursue a science career. The follow-up data indicates that 67% of the HS participants and 90% of the UG participants graduated from college with a STEM degree; for those who enrolled in graduate education, 61% and 43% enrolled in LLU, respectively. We conclude that structured SREs can be highly effective STEM strengthening interventions for both UG and HS students and may be a way to measurably increase institutional and biomedical

Primary pollutants and potential photochemical smog formation in Makkah, Saudi Arabia

International Nuclear Information System (INIS)

Nasralla, M.M.; Seroji, A.R.

2007-01-01

This study was conducted in Mina Valley and the central district of the holy city, Makkah, during the pilgrimage (Hajj) season of 1424 Hijri (2004). During this season, more than 2.5 million people gathered in Makkah to perform the Hajj rituals. Two mobile air pollution laboratories were used to monitor NO, NO2, NOx, non-methane hydrocarbons and ozone (O3) in the atmosphere in Mina and Makkah. Instruments were calibrated periodically against standard gases. The present investigation showed clearly an ideal diurnal cycle of local ozone formation. Although the intensity of the incoming UV radiation was the lowest compared with other months of the year, recorded ozone levels approached the maximum allowable levels of 150 ug/m3 in Mina, and exceeded 160 ug/m3 in Makkah during the pilgrimage period. The problem was intensified by the high record levels NOx, sometimes reaching more than 800 ug/m3, 1h average, coupled with 1h average concentration of about 3 ppm non-methane hydrocarbons. Furthermore, the average maximum hourly ozone concentrations increased gradually from less than 60 ug/m3 during February to reach more than 200 ug/m3 (as an indication of smog formation) during some days of May. This coincides with the increase in the intensity of the incoming UV radiation reaching its maximum level in May. Consequently, it can be concluded that Makkah may face severe air pollution episodes when the pilgrimage season shifts to the summer months in the next few years. This may pose acute health problems for the elderly people and those with respiratory health problems. Good air quality and transportation management as well as the use of alternative clean fuel are highly recommended. (author)

Veneetsia Kuldlõvi iraanlasele

Index Scriptorium Estoniae

2000-01-01

Kuldlõvi sai Jafar Panahi mängufilm "Ring" ("Dayereh"), žürii suure preemia USA režissööri Julian Schnabeli "Enne kui öö saabub" ("Before Night Falls"), parima meesnäitleja preemia Javier Bardem

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... Hazard: The Hidden Dangers of Buying Decorative Contact Lenses Without a Prescription Leer en Español: Peligros asociados ... truth." Real People, Real Problems with Colored Contact Lenses Julian: Teenager Blinded In One Eye By Non- ...

Veneetsia biennaal - Tintoretto põhiekspositsioonis, Schnabel satelliitnäitusel? / Jaan Elken

Index Scriptorium Estoniae

Elken, Jaan, 1954-

2011-01-01

Venezia Correri muuseumis 27. nov.-ni avatud Julian Schnabeli retrospektiivist "Pidev muutumine ja nägemise arhitektuur" ("Permanently becoming and the Architecture of Seeing"). Lühidalt Tintoretto maalidega algavast Bice Curigeri kuraatoriprojektist "ILLUMInatsioonid", paviljonidest (Itaalia, Saksamaa, Suurbritannia, Eesti jt.)

Rituaalid Ando Keskküla moodi

Index Scriptorium Estoniae

2000-01-01

Tallinna Kunstihoones näitus "Rituaalide mehaanika", millega Ando Keskküla tähistab oma 50. sünnipäeva. Näituse külalised Marko Laimre, Zoe Beloff, Bea de Visser, Fiddian Warman ja Julian Saunderson.

Southern annular mode: tropical-extratropical interactions and impacts

CSIR Research Space (South Africa)

Fauchereau, N

2009-09-01

Full Text Available In this study the authors investigate in particular its links with the Madden Julian Oscillation and ENSO, the dominant modes of tropical atmospheric variability at the intraseasonal and interannual timescales, respectively. It is showed here that...

Constraints on the Grueneisen Theory

Science.gov (United States)

2007-02-01

TOMSK 634024 RUSSIA 5 DEPARTMENTO DE QUIMICA FISICA I FACULTAD DE CIENCIAS QUIMICAS UNIVERSIDAD COMPLUTENSE DE MADRID V G BAONZA...OVIEDO FACULTAD DE QUIMICA DEPARTMENTO DE QUIMICA FISICA Y ANALITICA E FRANCISCO AVENIDA JULIAN CLAVERIA S/N 33006 - OVIEDO

Voorus-porno / Margit Tõnson

Index Scriptorium Estoniae

Tõnson, Margit, 1978-

2009-01-01

Stephenie Meyeri "Videviku" romaanide sari (Videvik, Noorkuu, Päikesevarjutus, Koidukuma) ja kahe esimese loo ekraniseeringud on fenomenaalselt populaarsed. PÖFFi filmikoolis arutleti teemat kirjandusagent Julian Friedmani juhtimisel. Lisaks kirjastuse Pegasus toimetaja Rene Tendermanni, kirjanik-kirjandusteoreetik Peeter Helme jt. arvamusi

Contamination of Omnivorous Freshwater Fish Species and Sediments by Chlorinated Hydrocarbons in Poland

Directory of Open Access Journals (Sweden)

Niewiadowska Alicja

2014-10-01

Full Text Available The occurrence and concentrations of organochlorine pesticides and polychlorinated biphenyls (PCBs were determined in 158 muscle samples of bream (Abramis brama and roach (Rutilus rutilus, and 84 samples of sediments collected from 10 river and lake sampling sites in 2011 and 2012. The concentrations of DDTs (p,p’-DDT, o,p’-DDT, p,p’-DDE, and p,p’-DDD, HCH isomers (a-, ß-, and y-HCH, HCB, and PCBs (six indicator PCB congeners 28, 52, 101, 138, 153 and 180 were determined using the capillary gas chromatography. The mean concentrations of DDTs in bream and roach were in the range of 11.2-654 and 4.5-121 ug/kg wet weight respectively, and PCBs were in the range of 1.3-75.9 and 1.1-112 ug/kg wet weight, respectively. Mean concentrations of DDTs and PCBs in sediments were 0.5-270 ug/kg dry weight and ⋋0.1-2.2 ug/kg dry weight respectively. The study showed clear spatial differences in the levels of organochlorine pesticides and PCBs in fish and sediments from different aquatic ecosystems. The highest levels of contaminants were detected in fish and sediments from the Vistula River in vicinity of Cracow. The possible risk to the fish meat consumers and ecological risk were evaluated.

Pesticides in surface waters in areas influenced by banana production in Costa Rica

International Nuclear Information System (INIS)

Castillo, L.E.; Ruepert, C.; Solis, E.

1999-01-01

Banana production in Costa Rica is highly dependent on pesticide use. However, only a few studies have been undertaken regarding the presence and environmental impact of the agrochemical substances used in the banana culture on the aquatic ecosystem of the Atlantic Region of Costa Rica. This study was, therefore, undertaken in Rio Suerte Basin that drains into the 'Nature Conservation Area' of Tortuguero in the Atlantic lowlands of the country from June 1993 to December 1994. In order to investigate further the occurrence of pesticides in the water bodies located near the possible sources especially during worst-case situations, water samples were analysed following pesticide applications during 1995-1997. Pesticide residues were determined by GC equipped with an electron capture detector (ECD) and a nitrogen phosphorous detector (NPD). The study targeted 11 of the 21 pesticides used in banana production, the others were not analyzed. The most frequently found compounds during the 1993-94 survey were the fungicide propiconazole and the nematocide cadusafos. Maximum concentrations measured after the pesticide applications were found in the main drainage canal and these were 2.1 ug/L carbofuran, 1.2 ug/L terbufos and 0.48 ug/L cadusafos. The peak concentration found shortly after the aerial application of the fungicide propiconazole was 13 ug/L in the creek leaving the banana plantation. (author)

Neural correlates of decision making after unfair treatment

Directory of Open Access Journals (Sweden)

Yan eWu

2015-03-01

Full Text Available Empirical evidence indicates that people are inequity averse. However, it is unclear whether and how suffering unfairness impacts subsequent behavior. We investigated the consequences of unfair treatment in subsequent interactions with new interaction partners and the associated neural mechanisms. Participants were experimentally manipulated to experience fair or unfair treatment in the ultimatum game (UG, and subsequently, they were given the opportunity to retaliate in the dictator game (DG in their interactions with players who had not played a role in the previous fair or unfair treatment. The results showed that participants dictated less money to unrelated partners after frequently receiving unfair offers in the previous UG (versus frequently receiving fair offers in the previous UG, but only when they were first exposed to unfair UG/DG. Stronger activation in the right dorsal anterior insula was found during receiving unfair offers and during the subsequent offer-considering phase. The regional homogeneity (ReHo, a measure of the local synchronization of neighboring voxels in resting-state brain activity, in the left ventral anterior insula and left superior temporal pole was positively correlated with the behavior change. These findings suggest that unfair treatment may encourage a spread of unfairness, and that the anterior insula may be not only engaged in signaling social norm violations, but also recruited in guiding subsequent adaptive behaviors.

Evidence for disruption of normal circadian cortisol rhythm in women with obesity.

Science.gov (United States)

Al-Safi, Zain A; Polotsky, Alex; Chosich, Justin; Roth, Lauren; Allshouse, Amanda A; Bradford, Andrew P; Santoro, Nanette

2018-04-01

Hyperactivity of the hypothalamic-pituitary-adrenal (HPA) axis may play a role in the pathogenesis of comorbidities encountered in obesity, including the relative hypogonadotropic hypogonadism that we and others have observed. We sought to examine serum cortisol profiles throughout the day and evening in a sample of normal weight women and women with obesity. In this cross-sectional study, regularly cycling obese (n = 12) and normal weight (n = 10) women were recruited. Mean serum cortisol was measured by frequent blood sampling for 16 h (8am-midnight) in the luteal phase of the menstrual cycle. Women with obesity had significantly higher overall cortisol levels when compared to normal weight women (6.2 [4.3, 6.6] vs. 4.7 [3.7, 5.5] ug/dl, p = .04). Over the two-hour postprandial period, obese women displayed an almost two-fold greater (7.2 [6.5, 8.6] ug/dl) rise in cortisol than normal weight controls (4.4 [3.7, 6.2] ug/dl, p obese women demonstrated a sustained evening cortisol elevation compared to normal weight women, who displayed the typical decline in cortisol (3.2 [2.3, 4] vs. 2 [1.5, 3.2] ug/dl, p obesity may be related to risks of obesity-associated metabolic comorbidities and reproductive dysfunction often seen in these women.

Dietary Management of Hyperthyroidism in a Dog.

Science.gov (United States)

Looney, Andrea; Wakshlag, Joseph

An 8 yr old female spayed golden retriever presented for a routine exam during which ventral cervical soft tissue masses were identified. History included weight loss, increased activity and appetite, gagging, and occasional diarrhea. Exam findings included a body condition score of 4/9 and palpable ventral cervical nodules. A serum thyroxine (T4) value was 8.0 ug/dL (normal = 0.8-3.5ug/dL). Doppler systolic blood pressure readings ranged from 200-210 mmHg (normal systolic blood pressure hyperthyroidism due to active thyroid masses. Due to financial constraints, the owner elected conservative management. Initial treatment with methimazole resulted in a decreased T4 value of 5.0 ug/dL at approximately 4 mo after initiation of treatment. A commercially available iodine-restricted feline diet was fed and this resulted in further reduction in serum T4 levels, improved sleeping cycles, reduced anxiety, and reduced systolic blood pressure. A temporary suspension of iodine-restricted feline diet for 2 mo resulted in increases in serum T4 concentrations, which, subsequently, decreased with re-introduction of the diet. Roughly 10 mo after initiation of the therapeutic diet and 16 mo after intial diagnosis, the dog remains relatively normal clinically despite active growing cervical masses with T4 concentration of 2.3 ug/dL.

The relationship between seminal plasma zinc levels and high molecular weight zinc binding protein and sperm motility in Iraqi infertile men

International Nuclear Information System (INIS)

AbdulRasheed, Omar F

2009-01-01

To evaluate the relationship between sperm motility and total seminal plasma zinc concentration and high molecular weight zinc bound protein values in infertile Iraqi men. A case-control study was conducted at the Chemistry and Biochemistry Department, College of Medicine, Al-Nahrain University, Baghdad, Iraq between March 2005 to February 2006. The subjects for the study included 60 infertile male patients who were recruited Al-Kadhimiya Teaching Hospital, and Institute of Embryo Research and Infertility Treatment, Baghdad, Iraq. They were categorized according to their seminal parameters to oligozoospermia (n=32), azoospermia (n=22), and asthenozoospermia (n=6). Thirty nine fertile men (age range 31.87 +/- 3.76 years) were selected as controls, whose partners had conceived within the last year before participation with this study, and having normal spermiogram parameters. Seminal plasma zinc concentration and high molecular weight zinc binding proteins (HMW-Zn) were assayed in the ejaculates of fertile and infertile men. The seminal plasma zinc levels were 181.92 +/- 23.40 ug/mL in the oligozoospermia group, 178.50 +/- 18.61 ug/mL in the azoospermia group, 195.33 +/- 13.00 ug/mL in the asthenozoospermia group, and 184.66 +/- 21.31 ug/mL in the control group. The HMW-Zn% is a good index of sperm function rather than the total seminal plasma zinc levels. (author)

Composition and color stability of anthocyanin-based extract from purple sweet potato

Directory of Open Access Journals (Sweden)

Xiu-li He

2015-09-01

Full Text Available AbstractPurple sweet potato (PSP can provide products with attractive color besides nutritious benefits in food processing. So, the compositions and color stability of an aqueous anthocyanin-based PSP extract were investigated in order to promote its wide use in food industry. PSP anthocyanins were extracted with water, and nine individual anthocyanins (48.72 ug mL–1 in total, 24.36 mg/100 g fresh PSP in yield were found by HPLC analysis. The PSP extract also contained 17.11 mg mL–1 of protein, 0.44 mg mL–1 of dietary fiber, 2.82 mg mL–1 of reducing sugars, 4.02 ug mL–1 of Se, 54.21 ug mL–1 of Ca and 60.83 ug mL–1 of Mg. Changes in color and stability of the PSP extract, as affected by pH, heat, light and extraction process, were further evaluated. Results indicated that PSP anthocyanins had good stability at pH 2.0-6.0, while the color of PSP extract kept stable during 30 days of storage at 20 °C in dark. Both UV and fluorescent exposure weakened the color stability of PSP extract and UV showed a more drastic effect in comparison. A steaming pretreatment of fresh PSP is beneficial to the color stability.

Toil and Trouble: On the Materiality of Time

Directory of Open Access Journals (Sweden)

Ross Chambers

2014-03-01

Full Text Available This article explores the nature of temporality, entropy and negentropy, drawing contemporary fiction by Graham Swift and Fiona McGregor as well as the autobiography of Wikileaks founder Julian Assange, to ask questions about history, time and life.

Mittepateetiline juubel Kunstihoones / Heie Treier

Index Scriptorium Estoniae

Treier, Heie, 1963-

2000-01-01

Kunstnik-kuraatori Ando Keskküla "Rituaalide mehaanika" Tallinna Kunstihoones. Marko Laimre installatsioonist "Sugar Free", Bea de Visseri tööst "Silmapilgutus", Fiddian Warmani ja Julian Saundersoni installatsioonist "Paheline loomus", Ando Keskküla videost "Hingus", installatsioonist "12 tooli".

Scientia Militaria: South African Journal of Military Studies - Vol 11 ...

African Journals Online (AJOL)

Warning and Response by Julian Critch. ley. Leo Cooper, 1978. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Calvin Smit, VC Muller, 60-60. http://dx.doi.org/10.5787/11-2-660 ...

The Boundary Element Method Applied to the Two Dimensional Stefan Moving Boundary Problem

Science.gov (United States)

1991-03-15

Unc), - ( UGt )t - (UG,,),,] - (UG), If we integrate this equation with respect to r from 0 to t - c and with respect to and ij on the region 11(r...and others. "Moving Boundary Problems in Phase Change Mod- els," SIGNUM Newsletter, 20: 8-12 (1985). 21. Stefan, J. "Ober einige Probleme der Theorie ...ier Wirmelcitung," S.-B. \\Vein. Akad. Mat. Natur., 98: 173-484 (1889). 22.-. "flber (lie Theorie der Eisbildung insbesondere fiber die lisbildung im

Study on heat transfer coefficients during cooling of PET bottles for food beverages

Science.gov (United States)

Liga, Antonio; Montesanto, Salvatore; Mannella, Gianluca A.; La Carrubba, Vincenzo; Brucato, Valerio; Cammalleri, Marco

2016-08-01

The heat transfer properties of different cooling systems dealing with Poly-Ethylene-Terephthalate (PET) bottles were investigated. The heat transfer coefficient (Ug) was measured in various fluid dynamic conditions. Cooling media were either air or water. It was shown that heat transfer coefficients are strongly affected by fluid dynamics conditions, and range from 10 W/m2 K to nearly 400 W/m2 K. PET bottle thickness effect on Ug was shown to become relevant under faster fluid dynamics regimes.

Is costly punishment altruistic? Exploring rejection of unfair offers in the Ultimatum Game in real-world altruists.

Science.gov (United States)

Brethel-Haurwitz, Kristin M; Stoycos, Sarah A; Cardinale, Elise M; Huebner, Bryce; Marsh, Abigail A

2016-01-07

In the Ultimatum Game (UG), incurring a cost to punish inequity is commonly termed altruistic punishment. This behaviour is thought to benefit others if the defector becomes more equitable in future interactions. However, clear connections between punishment in the UG and altruistic behaviours outside the laboratory are lacking. We tested the altruistic punishment hypothesis in a sample of extraordinarily altruistic adults, predicting that if punishing inequity is predictive of altruism more broadly, extraordinary altruists should punish more frequently. Results showed that punishment was not more prevalent in extraordinary altruists than controls. However, a self-reported altruism measure previously linked to peer evaluations but not behaviour, and on which extraordinary altruists and controls did not differ, did predict punishment. These findings support suggestions that altruistic punishment in the UG is better termed costly punishment and may be motivated by social, but not necessarily prosocial, concerns. Results also support prior suggestions that self-reported altruism may not reliably predict altruistic behaviour.

Evaluation of the use of transglutaminase in dairy drinks made from goat milk

Directory of Open Access Journals (Sweden)

Daniela Cristina Faria Vieira

2015-02-01

Full Text Available The aim of this study was to evaluate the use of transglutaminase in dairy drinks made from with goat milk with 45% of serum, and the physical, chemical, microbiological and sensory characteristics of these drinks within the expiration date of the product. In the first phase, five different levels of transglutaminase (0, 0.2, 0.3, 0.4, 0.5 U/g were evaluated. In the second phase, the drink that had the best sensory acceptability was evaluated for 30 days. It was observed that the dairy drink treated with 0.5 U/g transglutaminase showed higher sensory acceptability in relation to the 7.18 overall impression. The color values of the dairy drink treated with 0.5 U/g showed no significant difference (p<0.05. The values of lactic acid bacteria are established according to the legislation. Results show the feasibility of the use of transglutaminase in dairy drinks.

Tannase production by Penicillium purpurogenum PAF6 in solid state fermentation of tannin-rich plant residues following OVAT and RSM.

Science.gov (United States)

Jana, Arijit; Maity, Chiranjit; Halder, Suman Kumar; Mondal, Keshab Chandra; Pati, Bikash Ranjan; Mohapatra, Pradeep Kumar Das

2012-07-01

Tannase production by newly isolated Penicillium purpurogenum PAF6 was investigated by 'one variable at a time' (OVAT) approach followed by response surface methodology (RSM). Tannin-rich plant residues were used as supporting solid substrate and sole carbon source and, among them, tamarind seed was found to be the most favorable substrate than haritaki, pomegranate, tea leaf waste and arjun fruit. Physicochemical parameters were initially optimized using OVAT methodology and some important factors like incubation time, incubation temperature, substrate:moisture ratio as well as carbon, nitrogen and phosphate concentrations were verified with Box-Behken design of response surface methodology. Phosphate source, nitrogen source and temperature were found as the most favorable variables in the maximization of production. Tannase production was enhanced from 1.536 U/g to 5.784 U/g using tamarind seed OVAT optimization and further enhancement up to 6.15 U/g following RSM. An overall 3.76- and 4.0-fold increases in tannase production were achieved in OVAT and RSM, respectively.

Evolution of Fairness in the Not Quite Ultimatum Game

Science.gov (United States)

Ichinose, Genki; Sayama, Hiroki

2014-05-01

The Ultimatum Game (UG) is an economic game where two players (proposer and responder) decide how to split a certain amount of money. While traditional economic theories based on rational decision making predict that the proposer should make a minimal offer and the responder should accept it, human subjects tend to behave more fairly in UG. Previous studies suggested that extra information such as reputation, empathy, or spatial structure is needed for fairness to evolve in UG. Here we show that fairness can evolve without additional information if players make decisions probabilistically and may continue interactions when the offer is rejected, which we call the Not Quite Ultimatum Game (NQUG). Evolutionary simulations of NQUG showed that the probabilistic decision making contributes to the increase of proposers' offer amounts to avoid rejection, while the repetition of the game works to responders' advantage because they can wait until a good offer comes. These simple extensions greatly promote evolution of fairness in both proposers' offers and responders' acceptance thresholds.

Global assessment of oceanic lead pollution using sperm whales (Physeter macrocephalus) as an indicator species.

Science.gov (United States)

Savery, Laura C; Wise, Sandra S; Falank, Carolyne; Wise, James; Gianios, Christy; Douglas Thompson, W; Perkins, Christopher; Zheng, Tongzhang; Zhu, Cairong; Wise, John Pierce

2014-02-15

Lead (Pb) is an oceanic pollutant of global concern. Anthropogenic activities are increasing oceanic levels, but to an unknown extent. The sperm whale (Physeter macrocephalus) has a global distribution and high trophic level. The aim of this study was to establish a global baseline of oceanic Pb concentrations using free-ranging sperm whales as an indicator species. Skin biopsies (n=337) were collected during the voyage of the Odyssey (2000-2005) from 17 regions considering gender and age. Pb was detectable in 315 samples with a global mean of 1.6 ug/gww ranging from 0.1 to 129.6 ug/gww. Papua New Guinea, Bahamas and Australia had the highest regional mean with 6.1, 3.4, and 3.1 ug/gww, respectively. Pb concentrations were not significantly different between sex and age in males. This is the first global toxicological dataset for Pb in a marine mammal and confirms Pb is widely distributed with hotspots in some regions. Copyright © 2014. Published by Elsevier Ltd.

Comparison of image quality and portal vein visualization in IADSP using iopamidol, 76 % urografin, and 38 % urografin

International Nuclear Information System (INIS)

Shibata, Toshiya; Yamashita, Keiji; Konishi, Junji; Hayakawa, Katsumi; Hamanaka, Daizaburo; Okumura, Ryouji; Ishi, Yasushi.

1988-01-01

The image quality of intra-arterial digital subtraction portography (IADSP) was studied in 50 randomly assigned patients using one of three contrast agents: iopamidol, (IOP, 20 cases), 76 % Na-meglumine diatrzioate (76 % UG, 20 cases), and 38 % Na-meglumine diatrizoate (38 % UG, 10 cases). Sharpness and contrast of images, and portal vein visualization were evaluated in these groups. IOP provided better image quality and portal vein visualization than 76 % UG. There was no significant difference between them in terms of side effects, such as contrast medium-induced pain and feeling of warmth, or changes in physiological parameters like blood pressure and heart rate. When a low osmolar contrast agent like IOP passes through the mesentery capillary bed, the eflux of the contrast agent into the interstitial space and the influex of water into the capillary may be less, resulting in less dilution of the contrast agent in the superior mesenteric vein. This might explain the better image quality and portal vein visualization of IOP. (author)

Module Cluster: UG - 001.00 (GSC) Urban Geography.

Science.gov (United States)

Currier, Wade R.

This is one of several module clusters developed for the Camden Teacher Corps project. This module cluster is designed to introduce students to urban studies through the application of a geographic approach. Although geography shares with other social sciences many concepts and methods, it has contributed a distinctive set of viewpoints and a…

Veneetsias lööb laineid kuuba kirjaniku eluloofilm / Andres Laasik

Index Scriptorium Estoniae

Laasik, Andres, 1960-2016

2000-01-01

57. Veneetsia filmifestivalil tõusis üheks favoriidiks Julian Schnabeli mängufilm "Enne õhtu saabumist" ("Before Night Falls") : Ameerika Ühendriigid 2000. Riho Undi nukufilmi "Samueli Internet" näidati edukalt ühes alaprogrammis, mis läheb edasi Milanosse ja Rooma

Journal of Astrophysics and Astronomy | Indian Academy of Sciences

Indian Academy of Sciences (India)

2016-01-27

Jan 27, 2016 ... Astronomical Observatory & Theoretical Astrophysics Center, Juliane Maries Vej 30, 2100 Copenhagen ɸ, Denmark; The Royal Swedish Academy of Sciences, Stockholm Observatory, SE-13336 Saltsjöbaden, Sweden; Dept. of Physics and Astronomy, Michigan State University, East Lansing, MI 48824, ...

Learning from Change: Issues and Experiences in Participatory ...

International Development Research Centre (IDRC) Digital Library (Canada)

Learning from Change: Issues and Experiences in Participatory Monitoring and Evaluation. Book cover Learning from Change: Issues and Experiences in Participatory Monitoring and Evaluation. Directeur(s) : Marisol Estrella, Jutta Blauert, Dindo Campilan, John Gaventa, Julian Gonsalves, Irene Guijt, Deb Johnson, and ...

New Physical Constraints for Multi-Frame Blind Deconvolution

Science.gov (United States)

2014-12-10

Laboratory) Dr. Julian Christou (Large Binocular Telescope Observatory) REAL ACADEMIA DE CIENCIAS Y ARTES DE BARCELONA RAMBLA DE LOS ESTUDIOS 115... CIENCIAS Y ARTES DE BARCELONA RAMBLA DE LOS ESTUDIOS 115 BARCELONA, 08002 SPAIN 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING

A Note on the Application of the Extended Bernoulli Equation

Science.gov (United States)

1999-02-01

SANTANDER SPAIN DEPARTMENTO DE QUIMICA FISICA FACULTAD DE CIENCIAS QUIMICAS UNIVERSIDAD COMPLUTENSE DE MADRID V G BAONZA M TARAVTLLO M CACERAS...UNIVERSIDAD DE OVIEDO FACULTAD DE QUIMICA DEPARTMENTO DE QUIMICA FISICA Y ANALITICA E FRANCISCO AVENIDA JULIAN CLAVERIA S/N 33006 - OVIEDO SPAIN

Halb nali. Oma viga? / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2007-01-01

Näitus "Halb nali" Tallinna Kunstihoones kuni 6. I 2008. Kuraator Johannes Saar, kunstnikud: Tamy Ben-Tor, Nathalie Djurberg, Peter Finnemore, Paul Granjon, Ivars Gravlejs, Igor Grubic, Zlatko Kopljar, Tsui Kuang-Yu, Marko Mäetamm, Jüri Ojaver, Julian Rosefeldt, Tommi Toija

Reliability and concurrent validity of the iPhone® Compass application to measure thoracic rotation range of motion (ROM in healthy participants

Directory of Open Access Journals (Sweden)

James Furness

2018-03-01

Full Text Available Background Several water-based sports (swimming, surfing and stand up paddle boarding require adequate thoracic mobility (specifically rotation in order to perform the appropriate activity requirements. The measurement of thoracic spine rotation is problematic for clinicians due to a lack of convenient and reliable measurement techniques. More recently, smartphones have been used to quantify movement in various joints in the body; however, there appears to be a paucity of research using smartphones to assess thoracic spine movement. Therefore, the aim of this study is to determine the reliability (intra and inter rater and validity of the iPhone® app (Compass when assessing thoracic spine rotation ROM in healthy individuals. Methods A total of thirty participants were recruited for this study. Thoracic spine rotation ROM was measured using both the current clinical gold standard, a universal goniometer (UG and the Smart Phone Compass app. Intra-rater and inter-rater reliability was determined with a Intraclass Correlation Coefficient (ICC and associated 95% confidence intervals (CI. Validation of the Compass app in comparison to the UG was measured using Pearson’s correlation coefficient and levels of agreement were identified with Bland–Altman plots and 95% limits of agreement. Results Both the UG and Compass app measurements both had excellent reproducibility for intra-rater (ICC 0.94–0.98 and inter-rater reliability (ICC 0.72–0.89. However, the Compass app measurements had higher intra-rater reliability (ICC = 0.96 − 0.98; 95% CI [0.93–0.99]; vs. ICC = 0.94 − 0.98; 95% CI [0.88–0.99] and inter-rater reliability (ICC = 0.87 − 0.89; 95% CI [0.74–0.95] vs. ICC = 0.72 − 0.82; 95% CI [0.21–0.94]. A strong and significant correlation was found between the UG and the Compass app, demonstrating good concurrent validity (r = 0.835, p < 0.001. Levels of agreement between the two devices were 24.8° (LoA –9

Learnability and linguistic performance

DEFF Research Database (Denmark)

Drozd, Kenneth

2004-01-01

of the human biological endowment for language in the form of a UNIVERSAL GRAMMAR (UG) (Chomsky, 1965). With respect to experimental design, C&T have strongly maintained that even young children know UG constraints but perform poorly in some experiments-due to the extralinguistic demands associated...... with experimental tasks, particularly those involved in presupposition accommodation and complex response planning. C&T specifically design their experiments to reduce the impact of extralinguistic demands on children's linguistic performance while at the same time providing felicitous environments for adultlike...... performance....

Measurement of superoxide dismutase-like activity in peel and pulp of apple from Anshan acres

Science.gov (United States)

Zhao, Lijuan

2018-04-01

Pyrogallol autoxidation method was used for measurement of SOD-like activity. They are 259.56 u/g and 148.78 u/g in peel and pulp of apple from Anshan acres. The proper-conditions for this measurement was determined through experiment as following: detection wavelength of spectrophotometer 325nm, buffer system Tris-HAc, concentration of Tris-HAc solution 50 mmoL and pH8.2. The inhibition rate of SOD-L again pyrogallol antioxidation are 92% and 90% in peel and pulp of apple.

Association of glucose-6-phosphate dehydrogenase deficiency and X-linked chronic granulomatous disease in a child with anemia and recurrent infections

OpenAIRE

Agudelo-Florez, P.; Costa-Carvalho, Beatriz Tavares [UNIFESP; Lopez, J. A.; Redher, J.; Newburger, P. E.; Alla-Saad, S. T.; Condino-Neto, A.

2004-01-01

Patients with severe leukocyte G6PD deficiency may present with impairment of NADPH oxidase activity and a history of recurrent infections, mimicking the phenotype of chronic granulomatous disease. We report herein a child with recurrent infections who initially received the diagnosis of G6PD deficiency. His erythrocyte G6PD activity was reduced: 1.8 U/g Hb (normal: 12.1 +/- 2.1 U/g Hb). Further studies revealed that G6PD activity in neutrophils, mononuclear leukocytes, and Epstein-Barr virus...

Assessment of acrylamide level in food stuffs in Poland

OpenAIRE

Mojska, H.; Gielecinska, I.; Marecka, D.; Szponar, L.; Swiderska, K.

2009-01-01

The aim of the study was to assess acrylamide content in 159 samples of nine groups of food products randomly collected in Poland in 2004-2007. The analysis was performed by gas chromatography tandem mass spectrometry (GC-MS/MS) using Finnigan GCQ instrument. Deuterium-labelled (d3 labelled) acrylamide was used as internal standard. The highest level of acrylamide was observed in potato crisps and crackers: (904 and 859ug/kg, respectively). The lowest level was found in oat flakes (23ug/kg) a...

Madden-Julian Oscillation: Western Pacific and Indian Ocean

Science.gov (United States)

Fuchs, Z.; Raymond, D. J.

2016-12-01

The MJO has been and still remains a "holy grail" of today's atmospheric science research. Why does the MJO propagate eastward? What makes it unstable? What is the scaling for the MJO, i.e. why does it prefer long wavelengths or planetary wavenumbers 1-3? The MJO has the strongest signal in the Indian ocean and in the West Pacific, but the average vertical structure is very different in each of those basins. We look at the reanalysis/analysis FNL, ERAI vertical structure of temperature and moisture as well as the surface zonal winds for two ocean basins. We also look at data from DYNAMO and TOGA_COARE in great detail (saturation fraction, temperature, entropy, surface zonal winds, gross moist stability, etc). The findings from observations and field projects for the two ocean basins are then compared to a linear WISHE model on an equatorial beta plane. Though linear WISHE has long been discounted as a plausible model for the MJO, the version we have developed explains many of the observed features of this phenomenon, in particular, the preference for large zonal scale, the eastward propagation, the westward group velocity, and the thermodynamic structure. There is no need to postulate large-scale negative gross moist stability, as destabilization occurs via WISHE at long wavelengths only. This differs from early WISHE models because we take a moisture adjustment time scale of order one day in comparison to the much shorter time scales assumed in earlier models. Linear modeling cannot capture all of the features of the MJO, so we are in the process of adding nonlinearity.

Caracterización del ambiente atmosférico en Las Palmas de Gran Canaria y Santa Cruz de Tenerife. 2000 a 2004

Directory of Open Access Journals (Sweden)

Elena López Villarrubia

2008-01-01

Full Text Available Fundamento: El carácter insular de las ciudades de Las Palmas de Gran Canaria y Santa Cruz de Tenerife, su meteorología y la proximidad del continente africano que favorece la llegada de material particulado de origen natural sobre las islas, determinan unas especificidades en su calidad del aire. El objetivo de este artículo es la caracterización de la contaminación atmosférica durante los años 2000 a 2004 como indicador de exposición de los habitantes de estas dos ciudades. Métodos: Se elaboraron los siguientes indicadores de contaminación: promedios de 24 horas de PM10, PM2,5, NO2, SO2 y O3; máximo de las 17 medias móviles octohorarias diarias de O3 y CO; máximo horario diario de SO2, NO2, O3, CO, PM10 y PM2,5. También se calcularon los niveles de la moda gruesa de partículas, como la diferencia entre los valores de PM10 y PM2,5 (PM10-2,5. Se identificaron episodios de intrusión africana. Resultados: En Sta Cruz de TF los promedios de SO2 (14ug/m3N y de O3 (44,4 ug/m3N fueron superiores respecto a los de Las Palmas de GC (8 y 28,3 ug/m3N. Los promedios de NO2 en Las Palmas de GC: 45,8 ug/m3N fueron superiores a los de Sta. Cruz de TF: 30,3 ug/m3N. Debido a las intrusiones africanas, algunos días superaron los 600 ug/m3 de PM10 y los 200 de PM2.5 en ambas ciudades. Conclusiones: Se identifica un patrón de calidad del aire con episodios de polvo mineral africano que en superficie afecta a todas las fracciones granulométricas, una estacionalidad diferente a las ciudades europeas respecto al ozono, así como un patrón de contaminación urbano-industrial en Sta. Cruz de Tf y netamente urbano en Las Palmas de GC. Se hace necesario tener en cuenta estos resultados para analizar su posible impacto sobre la salud de los ciudadanos de las Islas Canarias y establecer sistemas adecuados de vigilancia.

Year 3 Summary Report: Baseline Selenium Monitoring of Agricultural Drains Operated by the Imperial Irrigation District in the Salton Sea Basin

Science.gov (United States)

Saiki, Michael K.; Martin, Barbara A.; May, Thomas W.

2008-01-01

This report summarizes findings from the third year of a 4-year-long field investigation to document selected baseline environmental conditions in 29 agricultural drains and ponds operated by the Imperial Irrigation District along the southern border of the Salton Sea. Routine water quality and fish species were measured at roughly quarterly intervals from April 2007 to January 2008. The water quality measurements included total suspended solids and total (particulate plus dissolved) selenium. In addition, during April and October 2007, water samples were collected from seven intensively monitored drains for measurement of particulate and dissolved selenium, including inorganic and organic fractions. In addition, sediment, aquatic food chain matrices (particulate organic detritus, filamentous algae, net plankton, and midge [chironomid] larvae), and two fish species (western mosquitofish, Gambusia affinis; and sailfin molly, Poecilia latipinna) were sampled from the seven drains for measurement of total selenium concentrations. The mosquitofish and mollies were intended to serve as surrogates for desert pupfish (Cyprinodon macularius), an endangered species that we were not permitted to take for selenium determinations. Water quality values were typical of surface waters in a hot desert climate. A few drains exhibited brackish, near anoxic conditions especially during the summer and fall when water temperatures occasionally exceeded 30 degrees C. In general, total selenium concentrations in water varied directly with conductivity and inversely with pH. Although desert pupfish were found in several drains, sometimes in relatively high numbers, the fish faunas of most drains and ponds were dominated by nonnative species, especially red shiner (Cyprinella lutrensis), mosquitofish, and mollies. Dissolved selenium in water samples from the seven intensively monitored drains ranged from 0.700 to 24.1 ug/L, with selenate as the major constituent in all samples. Selenium

Capacity expansion analysis of UGSs rebuilt from low-permeability fractured gas reservoirs with CO2 as cushion gas

Directory of Open Access Journals (Sweden)

Yufei Tan

2016-11-01

Full Text Available The techniques of pressurized mining and hydraulic fracturing are often used to improve gas well productivity at the later development stage of low-permeability carbonate gas reservoirs, but reservoirs are watered out and a great number of micro fractures are produced. Therefore, one of the key factors for underground gas storages (UGS rebuilt from low-permeability fractured gas reservoirs with CO2 as the cushion gas is how to expand storage capacity effectively by injecting CO2 to displace water and to develop control strategies for the stable migration of gas–water interface. In this paper, a mathematical model was established to simulate the gas–water flow when CO2 was injected into dual porosity reservoirs to displace water. Then, the gas–water interface migration rules while CO2 was injected in the peripheral gas wells for water displacement were analyzed with one domestic UGS rebuilt from fractured gas reservoirs as the research object. And finally, discussion was made on how CO2 dissolution, bottom hole flowing pressure (BHFP, CO2 injection rate and micro fracture parameters affect the stability of gas–water interface in the process of storage capacity expansion. It is shown that the speed of capacity expansion reaches the maximum value at the fifth cycle and then decreases gradually when UGS capacity is expanded in the pattern of more injection and less withdrawal. Gas–water interface during UGS capacity expansion is made stable due to that the solubility of CO2 in water varies with the reservoir pressure. When the UGS capacity is expanded at constant BHFP and the flow rate, the expansion speed can be increased effectively by increasing the BHFP and the injection flow rate of gas wells in the central areas appropriately. In the reservoir areas with high permeability and fracture-matrix permeability ratio, the injection flow rate should be reduced properly to prevent gas–water interface fingering caused by a high-speed flow

Veneetsia filmifestival lõppes Iraani võiduga / Tiit Tuumalu

Index Scriptorium Estoniae

Tuumalu, Tiit, 1971-

2000-01-01

Kuldlõvi sai Jafar Panahi mängufilm "Ring" ("Dayereh"), žürii suure preemia USA režissööri Julian Schnabeli "Enne kui öö saabub" ("Before Night Falls"), parima stsenaariumi preemia itaallase Marco Tullio Giordana "Sada sammu" ("I cento passi")

Highlight: IDRC sponsors Caribbean symposium on impact of ...

International Development Research Centre (IDRC) Digital Library (Canada)

2016-04-15

Apr 15, 2016 ... Among the attendees were the Honourable Julian Robinson, Jamaica's Minister of State for the Ministry of Science, Technology, Energy and Mining and Celia Champagnie, Trade Commissioner ... IDRC project: Harnessing Open Data to Achieve Development Results in Latin America and the Caribbean ...

Climatology and Landfall of Tropical Cyclones in the South- West ...

African Journals Online (AJOL)

with a substantial increase (about 0.3˚C) in sea surface temperature. However, it is ... Julian (1994). El Niño is known to cause increased cyclone activity in the South and in the North-East. Pacific, but decreased activity in the North Atlantic.

Theory of mind deficits partly mediate impaired social decision-making in schizophrenia.

Science.gov (United States)

Yang, Liuqing; Li, Peifu; Mao, Haiying; Wang, Huiling; Shu, Chang; Bliksted, Vibeke; Zhou, Yuan

2017-05-05

Using paradigms from game theory, researchers have reported abnormal decision-making in social context in patients with schizophrenia. However, less is known about the underpinnings of the impairment. This study aimed to test whether theory of mind (ToM) deficits and/or neurocognitive dysfunctions mediate impaired social decision-making in patients with schizophrenia. We compared thirty-five patients with schizophrenia to thirty-eight matched healthy controls with regard to social decision-making using the mini Ultimatum Game (mini UG), a paradigm from game theory. Additionally, we assessed ToM using the Theory of Mind Picture Stories Task, a mental state attribution task, and assessed neurocognition using the Brief Assessment of Cognition in Schizophrenia. Mediation analyses were performed on the data. In contrast to the behavioral pattern of healthy controls in the mini UG, the patients with schizophrenia significantly accepted more disadvantageous offers and rejected more advantageous offers, and showed reduced sensitivity to the fairness-related context changes in the mini UG. Impaired ToM and neurocognition were also found in the patients. Mediation analyses indicated that ToM but not neurocognition partially mediated the group differences on the disadvantageous and advantageous offers in the mini UG. Patients with schizophrenia exhibited impaired social decision-making. This impairment can be partly explained by their ToM deficits rather than neurocognitive deficits. However, the exact nature of the ToM deficits that mediate impaired social decision-making needs to be identified in future.

Pectinase and polygalacturonase production by a thermophilic Aspergillus fumigatus isolated from decomposting orange peels Produção de pectinases e poligalacturonase por Aspergillus fumigatus termofílico isolado de cascas de laranja em decomposição

Directory of Open Access Journals (Sweden)

Urmila Phutela

2005-03-01

Full Text Available A thermophilic fungal strain producing both pectinase and polygalacturonase was isolated after primary screening of 120 different isolates. The fungus was identified as Aspergillus fumigatus Fres. MTCC 4163. Using solid-state cultivation, the optimum levels of variables for pectinase and polygalacturonase (PG production were determined. Maximal levels of enzyme activities were achieved upon growing the culture in a medium containing wheat bran, sucrose, yeast extract and (NH42SO4 after 2-3 days of incubation at a temperature of 50ºC. Highest enzyme activities of 1116 Ug-1 for pectinase and 1270 Ug-1 for polygalacturonase were obtained at pH 4.0 and 5.0, respectively.Através da tiragem de 120 cepas de fungos, isolou-se uma cepa capaz de produzir tanto pectinase quanto poligalacturonase. A cepa foi identificada como Aspergillus fumigatus Fres. MTCC 4163. Empregando cultivo em estado sólido, determinou-se os níveis ótimos das variáveis para a produção de pectinase e de poligalacturonase. Os níveis máximos de atividade enzimática foram obtidos quando a cultura era realizada em meio contendo farelo de trigo, sacarose, extrato de levedura e (NH42SO4 por 2-3 dias a uma temperatura de 50ºC. A atividade máxima de pectinase (1116 Ug-1 e de poligalacturonase (1270 Ug-1 foi obtida em pH 4,0 e 5,0, respectivamente.

Seasonal Shifts in Primary Water Source Type: A Comparison of Largely Pastoral Communities in Uganda and Tanzania

Directory of Open Access Journals (Sweden)

Amber L. Pearson

2016-01-01

Full Text Available Many water-related illnesses show an increase during the wet season. This is often due to fecal contamination from runoff, yet, it is unknown whether seasonal changes in water availability may also play a role in increased illness via changes in the type of primary water source used by households. Very little is known about the dynamic aspects of access to water and changes in source type across seasons, particularly in semi-arid regions with annual water scarcity. The research questions in this study were: (1 To what degree do households in Uganda (UG and Tanzania (TZ change primary water source type between wet and dry seasons?; and (2 How might seasonal changes relate to water quality and health? Using spatial survey data from 92 households each in UG and TZ this study found that, from wet to dry season, 26% (UG and 9% (TZ of households switched from a source with higher risk of contamination to a source with lower risk. By comparison, only 20% (UG and 0% (TZ of households switched from a source with lower risk of contamination to a source with higher risk of contamination. This research suggests that one pathway through which water-related disease prevalence may differ across seasons is the use of water sources with higher risk contamination, and that households with access to sources with lower risks of contamination sometimes choose to use more contaminated sources.

The effects of the MEGA BORG spill on Gulf of Mexico shrimp

International Nuclear Information System (INIS)

Nance, J.

1993-01-01

A brown shrimp stock model was developed at the NMFS Galveston Laboratory to assess the effects of the MEGA BORG oil spill on the brown shrimp population along the Texas coast. Water and sediment samples from near the MEGA BORG spill area were collected and analyzed by the Geochemical and Environmental Research Group at Texas A ampersand M University. Hydrocarbon concentrations found at the sediment collection stations ranged from 1.38 ug/g to 7.42 ug/g, while concentrations at the water column sampling sites ranged from 0.69 ug/l to 27.39 ug/l. Evaluation of chromatograms and analytical data suggested that sediments from the area contained primarily biogenic hydrocarbons. Only one station had elevated hydrocarbon levels. However, these values were only three to five times higher than the concentrations measured at the other stations. Evaluation of the water samples from the area showed only very low concentration levels of hydrocarbons were present in the water column. A bioassay study was conducted by the US Environmental Protection Agency, Environmental Research Laboratory in Gulf Breeze, Florida. The main conclusion from the bioassay study was that the concentrations of hydrocarbons measured at the field sites where water samples were taken tended to be three orders of magnitude lower than the hydrocarbon concentrations causing toxic responses in mysid and white shrimp. There were no detected effects of the brown shrimp population along the Texas coast from the MEGA BORG oil spill

Terra Harvest software architecture

Science.gov (United States)

Humeniuk, Dave; Klawon, Kevin

2012-06-01

Under the Terra Harvest Program, the DIA has the objective of developing a universal Controller for the Unattended Ground Sensor (UGS) community. The mission is to define, implement, and thoroughly document an open architecture that universally supports UGS missions, integrating disparate systems, peripherals, etc. The Controller's inherent interoperability with numerous systems enables the integration of both legacy and future UGS System (UGSS) components, while the design's open architecture supports rapid third-party development to ensure operational readiness. The successful accomplishment of these objectives by the program's Phase 3b contractors is demonstrated via integration of the companies' respective plug-'n'-play contributions that include controllers, various peripherals, such as sensors, cameras, etc., and their associated software drivers. In order to independently validate the Terra Harvest architecture, L-3 Nova Engineering, along with its partner, the University of Dayton Research Institute, is developing the Terra Harvest Open Source Environment (THOSE), a Java Virtual Machine (JVM) running on an embedded Linux Operating System. The Use Cases on which the software is developed support the full range of UGS operational scenarios such as remote sensor triggering, image capture, and data exfiltration. The Team is additionally developing an ARM microprocessor-based evaluation platform that is both energy-efficient and operationally flexible. The paper describes the overall THOSE architecture, as well as the design decisions for some of the key software components. Development process for THOSE is discussed as well.

Exploring the Presence of microDNAs in Prostate Cancer Cell Lines, Tissue, and Sera of Prostate Cancer Patients and its Possible Application as Biomarker

Science.gov (United States)

2016-04-01

ES2 OVCAR8 LnCap PC-3 C4-2 Cell Count 1.8X108 1x108 1.1X108 1.24X108 1.1X108 Episomal DNA (ug) 21.3 23.7 26 15.6 20.4 Starting DNA (ug) 21.3 23.7...kidney, liver, lung, skeletal muscle, spleen, sperm , testis and thymus) (5). EccDNA sequences were then enriched by multiple displacement amplification...including sperm . MicroDNAs arise preferentially from areas with high gene density, GC content, and exon density from promoters with activating chro

About the differential calculus on the quantum groups

International Nuclear Information System (INIS)

Bernard, D.

1992-01-01

Given a solution R of the Yang-Baxter equation admitting a quasi-triangular decomposition we define a quasi-triangular quantum Lie algebra. We describe how to any quasi-triangular quantum Lie algebra U(G R ) is associated a Hopf algebra F(G R ) with a differential calculus on it such that the algebra of the quantum Lie derivatives is the algebra U(G R ). This allows us to make the connection between the differential calculus on quantum groups and the exchange algebras of the algebraic Bethe ansatz. (orig.)

Kwalifikacje i kompetencje trenerów personalnych a oczekiwania rynku pracy Personal trainers professional qualifications - demands of the labour market

OpenAIRE

Leśniewska, Aleksandra; Stosik, Aneta

2016-01-01

Streszczenie Rynek usług fitness w Polsce nieustannie i dynamicznie się rozwija. Kluby fitness oferują obecnie swoim klientom szeroką gamę usług, od zorganizowanych zajęć grupowych po indywidualne formy treningowe, takie jak trening personalny, który cieszy się coraz większym zainteresowaniem. Jednak trenerzy personalni, mimo tak sprzyjających trendów rynkowych, borykają się aktualnie z problemem braku standardów kwalifikacji zawodowych oraz niespójnym systemem kształcenia w Polsce. Celem...

Use and activity levels on newly built bicycle playgrounds

DEFF Research Database (Denmark)

Schipperijn, Jasper; Hansen, Christine Kier; Rask, Simon

2015-01-01

Increasing the use of urban green space (UGS) as well as increasing cycling could potentially help address the growing inactivity problem. Three bicycle playgrounds were designed based on a participatory process and afterwards constructed in the UGS along a cycle-route on the historic outer defence...... close to one of the sites. A future study involving objective before and after measures when a new bicycle playground is build will be needed to reveal if bicycle playgrounds can provide additional activity to its users, or ‘just’ a different type of activity, in a different location....

Gene : CBRC-MMUS-09-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-103 84% MIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCHIPGPTVCISHFSRFSLILS...LFKLSTACFSFSMIFNFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLLWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRNIPGPTVCISHFP ...

Gene : CBRC-MMUS-09-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-108 87% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFSFLAIFHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRF ...

Shutting Down Sensorimotor Interferences after Stroke: A Proof-of-Principle SMR Neurofeedback Study

Science.gov (United States)

Reichert, Johanna L.; Kober, Silvia E.; Schweiger, Daniela; Grieshofer, Peter; Neuper, Christa; Wood, Guilherme

2016-01-01

Introduction: Neurofeedback training aims at learning self-regulation of brain activity underlying cognitive, emotional or physiological functions. Despite of promising investigations on neurofeedback as a tool for cognitive rehabilitation in neurological diseases, such as after stroke, there is still a lack of research on feasibility and efficiency of neurofeedback in this field. Methods: The present study aimed at investigating behavioral and electrophysiological effects of 10 sessions of sensorimotor rhythm (SMR) neurofeedback in a 74-years-old stroke patient (UG20). Based on previous results in healthy young participants, we hypothesized that SMR neurofeedback leads to a decrease in sensorimotor interferences and improved stimulus processing, reflected by changes in event-related potentials (ERPs) and electrophysiological coherence. To assess whether UG20 benefited from the training as much as healthy persons of a similar age, a healthy control group of N = 10 elderly persons was trained as well. Before and after neurofeedback training, participants took part in a multichannel electroencephalography measurement conducted during a non-verbal and a verbal learning task. Results: Both UG20 and the healthy controls were able to regulate their SMR activity during neurofeedback training. Moreover, in a non-verbal learning task, changes in ERPs and coherence were observed after training: UG20 showed a better performance in the non-verbal learning task and a higher P3 amplitude after training than before, and coherence between central and parietal electrodes decreased after training. The control group also showed a behavioral improvement in the non-verbal learning task and tendencies for higher P3 amplitudes and decreased central-parietal coherence after training. Single-case analyses indicated that the changes observed in UG20 were not smaller than the changes in healthy controls. Conclusion: Neurofeedback can be successfully applied in a stroke patient and in healthy

Shutting down sensorimotor interferences after stroke: A proof-of-principle SMR neurofeedback study

Directory of Open Access Journals (Sweden)

Johanna Louise Reichert

2016-07-01

Full Text Available Introduction: Neurofeedback training aims at learning self-regulation of brain activity underlying cognitive, emotional or physiological functions. Despite of promising investigations on neurofeedback as a tool for cognitive rehabilitation in neurological diseases, such as after stroke, there is still a lack of research on feasibility and efficiency of neurofeedback in this field. Methods: The present study aimed at investigating behavioral and electrophysiological effects of 10 sessions of sensorimotor rhythm (SMR neurofeedback in a 74-year-old stroke patient (UG20. Based on previous results in healthy young participants, we hypothesized that SMR neurofeedback leads to a decrease in sensorimotor interferences and improved stimulus processing, reflected by changes in event-related potentials and electrophysiological coherence. To assess whether UG20 benefited from the training as much as healthy persons of a similar age, a healthy control group of N = 10 elderly persons was trained as well. Before and after neurofeedback training, participants took part in a multichannel EEG measurement conducted during a nonverbal and a verbal learning task. Results: Both UG20 and the healthy controls were able to regulate their SMR activity during neurofeedback training. Moreover, in a nonverbal learning task, changes in event-related potentials and coherence were observed after training: UG20 showed a better performance in the nonverbal learning task and a higher P3 amplitude after training than before, and coherence between central and parietal electrodes decreased after training. The control group also showed a behavioral improvement in the nonverbal learning task and tendencies for higher P3 amplitudes and decreased central-parietal coherence after training. Single-case analyses indicated that the changes observed in UG20 were not smaller than the changes in healthy controls. Conclusions: Neurofeedback can be successfully applied in a stroke patient and in

First results of Indian - Current meter moorings along The equator: Vertical current structure variability at equator, 93 degrees E during February-December, 2000

Digital Repository Service at National Institute of Oceanography (India)

Murty, V.S.N.; Suryanarayana, A.; Sarma, M.S.S.; Tilvi, V.; Fernando, V.; Nampoothiri, G.; Sardar, A.; Gracias, D.; Khalap, S.

forcing while the 30-50 day ISO with Madden-Julian Oscillations. The energy spectrum at 280 m shows relatively higher energy than that at 135 m at 10-20 day ISO; while cross-spectra of kinetic energy at these depths reveal high coherence and upward phase...

Qualitative in-depth interviews: Studying religious meaning-making in MMOs

NARCIS (Netherlands)

S.D. Aupers (Stef); J.C.F. Schaap (Julian); L. de Wildt (Lars)

2018-01-01

markdownabstractIn this chapter, Stef Aupers, Julian Schaap, and Lars de Wildt argue that a “game-centered” orientation in the study of religion and video games (studying in-game religious narratives, discourses, and game rules) should be complemented with a “player-centered” perspective. They call

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Biosciences. Anshu Aggarwal. Articles written in Journal of Biosciences. Volume 27 Issue 4 July 2002 pp 339-346 Articles. Place prioritization for biodiversity content · Sahotra Sarkar Anshu Aggarwal Justin Garson Chris R Margules Juliane Zeidler · More Details Abstract Fulltext PDF.

"Informacja chce by? wolna". Strategie kontroli i taktyki uwalniania informacji w epoce cyfrowej

OpenAIRE

Banaszak, Ada

2016-01-01

W niniejszej pracy przygl?dam si? wybranym strategiom kontroli informacji w epoce cyfrowej oraz taktykom jej uwalniania ? dzia?aniom haker?w i haktywist?w, takich jak Richard Stallman, za?o?yciel ruchu wolnego oprogramowania, Julian Assange, cypherpunk i redaktor naczelny WikiLeaks, czy Anonymous. Aleksander Kmak

Pattulangemine ja lunastus / Aare Ermel

Index Scriptorium Estoniae

Ermel, Aare, 1957-2013

2005-01-01

PÖFFi filme - "Taevane lahing" ("Batalla en el cielo" : režissöör Carlos Reygadas : Mehhiko - Prantsusmaa - Saksamaa - Belgia 2005, "Valede kammitsas" ("Separate Lies") : Nigel Balchini rom. "A Way Through the Wood" järgi režissöör Julian Fellowes : Suurbritannia 2005

Strategic Improvements to TSA Spot Program

Science.gov (United States)

2015-03-01

supporting me in this program, and specifically, Assistant Administrators Robin Kane, John Sanders, and Chris McLaughlin for their sponsorship. I hope...analysis. Edited by Michael Borenstein, Larry V. Hedges, Julian P. T. Higgins , and Hannah R. Rothstein, 377–387. Chichester, UK: John Wiley & Sons, 2009

Learning by joining the rhythm

DEFF Research Database (Denmark)

Lund, Ole; Ravn, Susanne; Christensen, Mette Krogh

2012-01-01

This article aims to explore how a joint rhythm is learned. The exploration is based on a combination of a case study of training in elite rowing and theoretical considerations concerning mutual incorporation of skills in learning. In 2009 Juliane and Anne start to row the double sculler together....... The two rowers’ aim is to be among the exclusive group of teams that qualify for the Olympic Games three years later. However Anne is not a rower, and has to be apprenticed by Juliane, who is an experienced elite rower. One important learning goal in the apprenticeship is to find a good joint rhythm......, to be able to put optimal effort into the rowing. Thus the apprenticeship is about developing a sense for a good rhythm in Anne which corresponds to Juliane’s fine-grained sense of what a good rhythm should feel like. Our study suggests that apprenticeship learning has to be understood as an embodied...

Chromium Is Elevated in Fin Whale (Balaenoptera physalus) Skin Tissue and Is Genotoxic to Fin Whale Skin Cells

Science.gov (United States)

Wise, Catherine F.; Wise, Sandra S.; Thompson, W. Douglas; Perkins, Christopher; Wise, John Pierce

2015-01-01

Hexavalent chromium (Cr(VI)) is present in the marine environment and is a known carcinogen and reproductive toxicant. Cr(VI) is the form of chromium that is well absorbed through the cell membrane. It is also the most prevalent form in seawater. We measured the total Cr levels in skin biopsies obtained from healthy free-ranging fin whales from the Gulf of Maine and found elevated levels relative to marine mammals in other parts of the world. The levels in fin whale biopsies ranged from 1.71 ug/g to 19.6 ug/g with an average level of 10.07 ug/g. We also measured the cytotoxicity and genotoxicity of Cr(VI) in fin whale skin cells. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to fin whale skin cells in a concentration-dependent manner. The concentration range used in our cell culture studies used environmentally relevant concentrations based on the biopsy measurements. These data suggest that Cr(VI) may be a concern for whales in the Gulf of Maine. PMID:25805270

Plausible exploitation of Jatropha de-oiled seed cake for lipase and phytase production and simultaneous detoxification by Candida parapsilosis isolated from poultry garbage.

Science.gov (United States)

Kannoju, Balakrishna; Ganapathiwar, Swaruparani; Nunavath, Hanumalal; Sunkar, Bindu; Bhukya, Bhima

2017-02-01

Jatropha de-oiled seed cake was explored to utilize as a basic nutrient source for Candida parapsilosis, isolated from poultry garbage and selected based on the production of lipase and phytase enzymes under submerged fermentation. At optimized parameters under solid-state fermentation, lipase and phytase activities were recorded as 1056.66±2.92 and 833±2.5U/g of substrate (U/g), respectively. Besides enzyme production, complete elimination of phorbol esters and significant phytate reduction from 6.51±0.01 to 0.43±0.01g/100g of seed cake were noted after 3days incubation. Curcin and trypsin inhibition activity were reduced significantly from 26.33±0.43 to 0.56±0.02mg/100g and 229.33±2.02 to 11.66±0.28U/g, respectively after 5days incubation. Saponins were reduced from 5.56±0.19 to 1.95±0.01g/100g of seed cake after 7days incubation. Copyright © 2016 Elsevier Ltd. All rights reserved.

Proposers’ Economic Status Affects Behavioral and Neural Responses to Unfairness

Directory of Open Access Journals (Sweden)

Yijie Zheng

2017-05-01

Full Text Available Economic status played an important role in the modulation of economic decision making. The present fMRI study aimed at investigating how economic status modulated behavioral and neural responses to unfairness in a modified Ultimatum Game (UG. During scanning, participants played as responders in the UG, and they were informed of the economic status of proposers before receiving offers. At the behavioral level, higher rejection rates and lower fairness ratings were revealed when proposers were in high economic status than in low economic status. Besides, the most time-consuming decisions tended to occur at lower unfairness level when the proposers were in high (relative to low economic status. At the neural level, stronger activation of left thalamus was revealed when fair offers were proposed by proposers in high rather than in low economic status. Greater activation of right medial prefrontal cortex was revealed during acceptance to unfair offers in high economic status condition rather than in low economic status condition. Taken together, these findings shed light on the significance of proposers’ economic status in responders’ social decision making in UG.

Epidemiology and effects of gastrointestinal nematode infection on milk productions of dairy ewes

Directory of Open Access Journals (Sweden)

Suarez V.H.

2009-06-01

Full Text Available 66 Pampinta breed ewes were studied during milking to evaluate the infection and the effect of gastrointestinal nematode on milk production sheep system. Naturally infected ewes on pasture were randomly allocated to two groups: TG, suppressively treated group every four weeks with levamisole and UG, untreated group. Faecal nematode egg counts and larval differentiation were conducted monthly. Successive groups of worm free tracer lambs were grazed with ewes and then slaughtered for worm counts. Test-day milk yield of individual ewes was recorded and ewe machine-milking period length (MPL were estimated. Faecal egg counts and tracer nematode numbers increased towards midsummer and declined sharply toward the end of the study. TG (188.0 ± 60 liters produced more (p < 0.066 milk liters than UG (171.9 ± 52.2 and TG had significantly more extended (p < 0.041 MPL than those of UG. The present study showed that dairy sheep were negatively affected by worms, even when exposed to short periods of high acute nematode (mainly Haemonchus contortus infection.

Acessibilidade e utilização dos espaços verdes urbanos nas cidades de Coimbra (Portugal e Salamanca (Espanha

Directory of Open Access Journals (Sweden)

Alejandro Gómez

2014-06-01

Full Text Available ACCESSIBILITY AND USE OF URBAN GREEN SPACES IN THE CITIES OF COIMBRA (PORTUGAL AND SALAMANCA (SPAIN. In a society that values more and more wellbeing, health and free time, the introduction of urban green spaces (UGS next to residential areas has become a citizen’s right and requirement. This paper analyses the distribution and accessibility of UGS in the cities of Coimbra and Salamanca and evaluates their influence on the needs of the resident populations, in terms of users’ age, frequency of usage, as well as of motivation and ways to enjoy the facilities. In Coimbra there is a concentration of UGS, whereas in Salamanca there is a dispersion of such spaces, which has resulted in the different usage that people make of them. In fact, although Coimbra offers more urban green space (per inhabitant, their usage is reduced as people go there mainly by car, contrary to what happens in Salamanca. Consequently, Coimbra’s inhabitants choose these green spaces because of the activities they can be used for, whereas Salamanca’s inhabitants choose them for their proximity.

Total mercury of selected fish species from Laguna de Bay

International Nuclear Information System (INIS)

Relon, Milagros Lontoc

1996-01-01

Dalag Ophicephalus striatus Block, kanduli Arius thalassinus Ruppell, bia Amblygobius phalaena Cuvier et Valenciennes and tilapia Tilapia nilotica Linnnaeus collected from Laguna de Bay between Taguig and Binangonan area in August 1989 to July 1990 were analyzed for total mercury by atomic absorption spectrometry. The highest metal concentration in soft muscle tissue was observed in Dalag followed by kanduli, less in bia and least in tilapia with mean values of 0.021, 0.020, 0.013, and 0.008 ug/g, respectively. Analysis using two-way ANOVA showed a significant difference in the mean total mercury in ug/g in the difference fish samples, among the different months and the interaction between these two variables. Mean total mercury of the four fish samples were significantly higher in April than in October. The results show that the levels of total mercury in the fish samples are below the World Health Organization maximum tolerable consumption of mercury in food of 300 ug or 0.03 mg of total mercury per week. (author)

Predicting the Use of Twitter in Developing Countries: Integrating Innovation Attributes, Uses and Gratifications, and Trust Approaches

Directory of Open Access Journals (Sweden)

Mohammad A. Alajmi

2016-08-01

Full Text Available Based on the diffusion of innovation (DOI theory (Rogers, 2003, the uses and gratifications (U&G theory, and trust theory, this study investigated the factors that influence the use of Twitter among the Kuwaiti community. The study surveyed Twitter users in Kuwait. A structured online questionnaire was used to collect data, and 463 respondents who provided complete answers participated. Multiple regression analysis was used to examine the effect of three theoretical perspectives on Twitter usage. The result of the analysis showed that Twitter usage is better explained by DOI constructs than by U&G constructs. The findings indicated that the perceived relative advantage from DOI, and the need for information, need to pass time, and need for interpersonal utility from the U&G approach, have a direct positive significant effect on the use of Twitter. None of the trust theory constructs was found to be significant in predicting the general use of Twitter. The study results help Twitter providers and users in individual or organizational contexts to understand what factors generally affect the usage of the Twitter service.

Gene : CBRC-MMUS-09-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-136 70% MIFTFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFSMIFTFLAI...FHVPQWTFLNFPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVILSFFNLSTACFSFSMIFSFLAIFHVLQWKFLYFPTFSVFLAIFHVLKCVFLIFRVFQVSRHIPGPTVCISH...FSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

Gene : CBRC-MMUS-09-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available 152306 /ug=Mm.330279 /len=4633 1e-121 83% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVISS...FFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPTFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVISSFFKLSSGCFSFFMIFSFLAIFHVPQWTFLN...VPPFSVFLAIFHVLKCVFLIFRDFQFSCYIPSPTVCISHFSRFSVIFSFFNLSTACFSFSMIFSFLAIFQVLQCAFLIFHVFQ ...

Gene : CBRC-MMUS-23-0035 [SEVENS

Lifescience Database Archive (English)

Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...

Gene : CBRC-MMUS-09-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4152306 /ug=Mm.330279 /len=4633 1e-115 71% MIFSFLAIFKVLQWTFLNFRPLSVFLAIFHVPKCVLLIFRDFQFPRHILGPTVCISHFSGFSVIS...SFFKSSSGCFSFSMIFSFLAIFHVLQWTFLNFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFSRFSVILSFFKLSSGCFSFSLIFSFLAIFHVLQWTFL...NFPPFSVFLAIFHVLKCVFLIFSDFQFSRHIPGPTVCISHFFRFFSDFVIFHVVKWMFLIFHDFHFSCHISCPKVCISHFQ ...

Gene : CBRC-XTRO-01-1571 [SEVENS

Lifescience Database Archive (English)

Full Text Available gi=74306002 /ug=Str.68514 /len=887 2e-11 37% MHLVLRHPVLRHPVLRHPVLRHPVLLHPVLRHPVLLHPVLLHLVLLHPVLLHLVLRHPV...LRHPVLRHPVLRHLVLLHLVLLHLVLRHPVLRHPVLRHLVLLHLVLLHLVLLHPVLLHPVLLHPVLRHLVLLHLVLLHLVLRHPVLRHPV...LRHLVLLHLVLLHLVLLHLVLLHPVLRHPVLLHLVLLHLVLWHPVLPCRSARGSVVRKLIHCCIYHKIALVM ...

Gene : CBRC-CINT-01-0198 [SEVENS

Lifescience Database Archive (English)

Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...

Diplomatic asylum and the Assange case

NARCIS (Netherlands)

den Heijer, M.

2013-01-01

This article traces the place and development of diplomatic asylum in international law in close connection with the more specific questions raised by the case of Julian Assange, who was granted asylum in the Ecuador embassy in London on 16 August 2012. After discussing the historical rise and

The Effects of Speech and Language Therapy Intervention on Children with Pragmatic Language Impairments in Mainstream School

Science.gov (United States)

Adams, Catherine; Lloyd, Julian

2007-01-01

In this article, Catherine Adams, clinical senior lecturer in speech and language therapy at the University of Manchester, and Julian Lloyd, senior lecturer in psychology at Newman College, Birmingham, describe the implementation and effects of an intensive programme of speech and language therapy for children who have pragmatic language…

Estimating C-17 Aircrew Seasoning Given a Prediction of Flying Austerity

Science.gov (United States)

2014-06-01

mission classification, operating organization, operating squadron, actual departure time (in Zulu ), actual arrival time (in Zulu ), and flight time in...zero. The horizontal axis is the time axis and is in Julian day units starting with January 1, 2013 and terminates at 2359 Zulu on June 30th 2013

Morphine-6-glucuronide: analgesic effects and receptor binding profile in rats

Energy Technology Data Exchange (ETDEWEB)

Abbott, F.V.; Palmour, R.M.

1988-01-01

The antinociceptive effects of morphine-6-glucuronide (M6G) were examined in two animal models of pain, the tail immersion test (reflex withdrawal to noxious heat) and the formalin test (behavioral response to minor tissue injury). In the tail immersion test, M6G produced and increase in withdrawal latency that rose rapidly between 0.01 and 0.025 ug ICV or 1 and 2 mg/kg SC. A further increase occurred at doses greater than 0.2 ug ICV or 4 mg/kg SC and was associated with marked catelepsy and cyanosis. Naloxone, 0.1 mg/kg SC, shifted the lower component of the dose-effect relation by a factor of 24. In the formalin test, 0.01 ug M6G ICV produced hyperalgesia, while between 0.05 and 0.2 ug ICV, antinociception increased rapidly without toxicity. The dose effect relations for hyperalgesia and antinociception were shifted to the right by factors of 20- and 3-fold, respectively. By comparison, ICV morphine was 60 (formalin test) to 145-200 (tail immersion test) times less potent than M6G. At sub-nanomolar concentrations, M6G enhanced the binding of (/sup 3/H)-etorphine, (/sup 3/H)-dihydromorphine and (/sup 3/H)-naloxone to rat brain membrane receptors by 20-40%. At higher concentrations, M6G displaced each ligand from binding sites, with K/sub i/ values of about 30 nM, as compared to morphine K/sub i/ values of about 3 nM.

Effects of lead-contaminated sediment on Rana sphenocephala tadpoles

Science.gov (United States)

Sparling, D.W.; Krest, S.K.; Ortiz-Santaliestra, M.

2006-01-01

We exposed larval southern leopard frogs (Rana sphenocephala) to lead-contaminated sediments to determine the lethal and sublethal effects of this metal. Tadpoles were laboratory-raised from early free-swimming stage through metamorphosis at lead concentrations of 45, 75, 180, 540, 2360, 3940, 5520, and 7580 mg/kg dry weight in sediment. Corresponding pore water lead concentrations were 123, 227, 589, 1833, 8121, 13,579, 19,038, and 24,427 ug/L. Tadpoles exposed to lead concentrations in sediment of 3940 mg/kg or higher died within 2 to 5 days of exposure. At lower concentrations, mortality through metamorphosis ranged from 3.5% at 45 mg/kg lead to 37% at 2360 mg/kg lead in sediment. The LC50 value for lead in sediment was 3728 mg/kg (95% CI=1315 to 72,847 mg/kg), which corresponded to 12,539 ug/L lead in pore water (95% CI= 4000 to 35,200 ug/L). Early growth and development were depressed at 2,360 mg/kg lead in sediment (8100 ug/L in pore water) but differences were not evident by the time of metamorphosis. The most obvious effect of lead was its pronounced influence on skeletal development. Whereas tadpoles at 45 mg/kg lead in sediment did not display permanent abnormalities, skeletal malformations increased in frequency and severity at all higher lead concentrations. By 2360 mg/kg, 100% of surviving metamorphs displayed severe spinal problems, reduced femur and humerus lengths, deformed digits, and other bone malformations. Lead concentrations in tissues correlated positively with sediment and pore water concentrations.

Gene : CBRC-PMAR-01-0559 [SEVENS

Lifescience Database Archive (English)

Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...

Gene : CBRC-XTRO-01-2123 [SEVENS

Lifescience Database Archive (English)

Full Text Available /gi=116487409 /ug=Str.18760 /len=4829 9e-15 26% MICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRGPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMICISH...IYCTSVRDPTGPPILLHPQTLGIMICISHIYCTSVRDPTGPPILLHPQTLGIMNSTAQMLWGRAWGGRENFPSFLRIKVFPLETGGRACESHVVPTEHLPQPQ ...

Gene : CBRC-AGAM-05-0028 [SEVENS

Lifescience Database Archive (English)

Full Text Available 27560014 /ug=Aga.24572 /len=986 7e-09 22% MVANTFAIVAKRSAIVAKRSAIIANTFTIVANYSAVVAKSSAIDPKSSAIVGKTFAIVAKTFAIVA...KTFAIVANYSAVVANYSAIVAKSSAIVAKSSAIVANTFAIFANTFAIVANTFAIIAKTFAIVAKTFAIVAKTFAIVAKSSAIVAKSSAIVAKSSAIVANTFAIVAKSS...AIVAKSSAIITNTFTIVANYSAVVAKSSAIVPKNSAIVGKTFAIVAKTFAIVAKTFAIVANTFAIVANYSAVVANYSAIVA...KSSAIVAKSSAIVAKTFAIFANTFAIVANTFAIVANYSAIVAKSSAIVAKSFEIIVKTFAIFAKTFAIVANYSAIVAKTFAIVAINSEIVAKSSATVANTFAIVANTFAIVANTFAIVAKTFAIVANYSAIVA ...

Gene : CBRC-DRER-22-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available 102920926 /ug=Dr.79541 /len=690 4e-72 87% MECAARSGDEKELENSKAGVVAARVLNSGVVARVLISCVVARVLSSGVVARVLISCVVAR...VLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVDARVLNSGVVARVLISCVVARVLNSGVVAR...VLISCVVARVLISCVVARVLISCVVARVLNSGVVARVLISCVVARVLISCVVARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVAR...VLISCVDARVLNSGVVAGVLISCVVARVLNSGVVTRVLISCVVARVLISCVVARVLNSGVVSTLFRLMQT ...

Health risk assessment of plasticizer in wastewater effluents and receiving freshwater systems

CSIR Research Space (South Africa)

Fatoki, O

2012-03-01

Full Text Available t Ku ils Riv er riv er Ve ltw ach ter Ef flu en t Ve ltw ach ter Ri ve r Kir ste nb osc h R ive r ug /l DEHP DEP NP 2CP Fig. 4. Concentrations (?gl-1) of phthalate and phenolic congeners detected in river and WWTP... ter Eff lue nt Ve ltw ach ter Riv er Kir ste nb osc h R ive r ug/ l DBP Fig. 5. DBP concentrations (?gl-1) detected in effluent and river water samples at the different sites. Health Risk Assessment of Plasticizer...

Reliability and concurrent validity of the iPhone® Compass application to measure thoracic rotation range of motion (ROM) in healthy participants

Science.gov (United States)

Schram, Ben; Cox, Alistair J.; Anderson, Sarah L.; Keogh, Justin

2018-01-01

Background Several water-based sports (swimming, surfing and stand up paddle boarding) require adequate thoracic mobility (specifically rotation) in order to perform the appropriate activity requirements. The measurement of thoracic spine rotation is problematic for clinicians due to a lack of convenient and reliable measurement techniques. More recently, smartphones have been used to quantify movement in various joints in the body; however, there appears to be a paucity of research using smartphones to assess thoracic spine movement. Therefore, the aim of this study is to determine the reliability (intra and inter rater) and validity of the iPhone® app (Compass) when assessing thoracic spine rotation ROM in healthy individuals. Methods A total of thirty participants were recruited for this study. Thoracic spine rotation ROM was measured using both the current clinical gold standard, a universal goniometer (UG) and the Smart Phone Compass app. Intra-rater and inter-rater reliability was determined with a Intraclass Correlation Coefficient (ICC) and associated 95% confidence intervals (CI). Validation of the Compass app in comparison to the UG was measured using Pearson’s correlation coefficient and levels of agreement were identified with Bland–Altman plots and 95% limits of agreement. Results Both the UG and Compass app measurements both had excellent reproducibility for intra-rater (ICC 0.94–0.98) and inter-rater reliability (ICC 0.72–0.89). However, the Compass app measurements had higher intra-rater reliability (ICC = 0.96 − 0.98; 95% CI [0.93–0.99]; vs. ICC = 0.94 − 0.98; 95% CI [0.88–0.99]) and inter-rater reliability (ICC = 0.87 − 0.89; 95% CI [0.74–0.95] vs. ICC = 0.72 − 0.82; 95% CI [0.21–0.94]). A strong and significant correlation was found between the UG and the Compass app, demonstrating good concurrent validity (r = 0.835, p reliable tool for measuring thoracic spine rotation which produces greater

Effect of Cu(II) coordination compounds on the activity of antioxidant enzymes catalase and superoxide dismutase in patients with colorectal cancer.

Science.gov (United States)

Kubiak, Katarzyna; Malinowska, Katarzyna; Langer, Ewa; Dziki, Łukasz; Dziki, Adam; Majsterek, Ireneusz

2011-03-01

Colorectal cancer (CRC) is a serious medical and economical problem of our times. It is the most common gastrointestinal cancer in the world. In Poland, the treatment and detection of CRC are poorly developed and the pathogenesis is still unclear. One hypothesis suggests a role of reactive oxygen species (ROS) in the pathogenesis of CRC. Experimental studies in recent years confirm the participation of ROS in the initiation and promotion of CRC. The aim of the study was to examine the effect of the following coordination compounds coordination compounds: dinitrate (V) tetra(3,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dichloro di(3,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dinitrate (V) di(1,4,5-trimethyl-N1-pyrazole-κN2) copper(II), dichloro di(1,3,4,5-tetramethyl-N1-pyrazole-κN2) copper(II) on the activity of antioxidant enzymes superoxide dismutase (SOD, ZnCu-SOD) and catalase (CAT) in a group of patients with colorectal cancer (CRC) and in the control group consisting of patients with minor gastrointestinal complaints. The study was conducted in 20 patients diagnosed with colorectal cancer at the age of 66.5±10.2 years (10 men and 10 women) versus the control group of 20 people (10 men and 10 women) aged 57.89±17.10 years without cancer lesions in the biological material - hemolysate prepared in a proportion of 1ml of water per 1 ml of blood. CAT activity was measured by the Beers method (1952), while SOD activity was measured by the Misra and Fridovich method (1972). We found that patients with CRC showed a statistically significant decrease of SOD and CAT activity (CAT - 12,75±1.97 U/g Hb, SOD - 1111.52±155.52 U/g Hb) in comparison with the control group (CAT - 19.65±2,17 U/g Hb, SOD - 2046.26±507.22 U/g Hb). Simultaneously, we observed that the investigated coordination compounds of Cu(II) significantly increased the antioxidant activity of CAT and SOD in patients with CRC (mean: CAT 25.23±4.86 U/g Hb, SOD - 3075.96±940.20 U/g Hb). Patients with

Komedija "Dzhuno" stala triumfatorom nezavissimogo "Oskara"

Index Scriptorium Estoniae

2008-01-01

Santa Monicas USAs anti 23. veebruaril üle sõltumatu kino aastaauhinnad Spirit Awards. Parimaks filmiks tunnistati Jason Reitmani "Juno", parim stsenaarium oli samale filmile Diablo Cody sulest, parim naisnäitleja Ellen Page samast filmist, parim režissöör filmi "Skafander ja liblikas" looja Julian Schnabel

Love troubles : human attachment and biomedical enhancements

NARCIS (Netherlands)

Nyholm, S.

ABSTRACT In fascinating recent work, Julian Savulescu and his various co-authors argue that human love is one of the things we can improve upon using biomedical enhancements. Is that so? This article first notes that Savulescu and his co-authors mainly treat love as a means to various other goods.

Cinematic Emotion in Horror Films and Thrillers. The Aesthetic Paradox of Pleasurable Fear (paperback edition)

NARCIS (Netherlands)

Hanich, Julian

2012-01-01

Why can fear be pleasurable? Why do we sometimes enjoy an emotion we otherwise desperately wish to avoid? And why are the movies the predominant place for this paradoxical experience? These are the central questions of Julian Hanich’s path-breaking book, in which he takes a detailed look at the

77 FR 9657 - Ocean Transportation Intermediary License Applicants

Science.gov (United States)

2012-02-17

..., Owner, Application Type: Add OFF Service. Cargo Tours International, Inc. dba CTI Global Logistics (NVO.... Deckwell Sky (USA) Inc. dba Monarch Container Line (NVO & OFF), 14343 E. Don Julian Road, City of Industry.... Logistics, Inc. (NVO & OFF), 3905 West Albany Street, McHenry, IL 60050, Officers: Arthur N. Nutig, Chief...

Gene : CBRC-XTRO-01-2729 [SEVENS

Lifescience Database Archive (English)

Full Text Available 559 /gi=71785299 /ug=Str.71415 /len=820 6e-19 35% MQPPVYTTRLFHAAPCISHWALPCSPLYIPLRSSMQPPVYPTALFHAAPCISH...CALPCSPLYIPLRSSMQPPVYTTALFHAAPCISHCALPCSPLYIPLGFSMQPPVYPTGLFHAAPCISHWALPCRPLYIPLGFSMQPPVYPTGLFHAAPCISH...CALPCSPLYIPLRSSMQPPVYPTALFHAAPCISHCALPCSPLYIPLGSSMQPPVYPTALFHAAPCISHWAFPCSPLYIPLGSSMKHRTTFMQKTSTDAPAVPHTRSLTSCKLSLMLLPGLPKPFYIGIPRPYSQ ...

Gene : CBRC-MDOM-02-0490 [SEVENS

Lifescience Database Archive (English)

Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTST...HLHIHPSIHPLIHSSTHPHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTST...YPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTST...HPSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...

Gene : CBRC-DMEL-08-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available 8016 /ug=Dm.1879 /len=6178 4e-22 26% MYCSCTGPVLVLYWSRSGPVLVPYWSRTGPVPGPVLVLGPVLDS...VLGSVLGSVLGSVLVLVLVPYWSRSGPVLVPYWSRTGPVLVPYSVPYSIPYWVQYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVL...VQYSVPYWSRTGRVLCSVLGSVLGPVLVPYWSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGPVLVPYWSRTGP...VLSPVLSPVLVPYWSRTLFRTRFRTRSRTGPVLVPYWSRTGPVLVPYSVPYSVPYSVPYWSRTGPVLVPYWSRTGPVLVPYWSRTRSRTRSRTGP...VLVPYLSCTGPVLGHVLLLYWSRTGPILVPFWSRTGPVLVPYSVPYSYSVPYSIPYWVPYLVPYSVPYSFSYWFRTGPVLVPYWSRTGP

Gene : CBRC-MDOM-04-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available 11) /gb=EF508680 /gi=145232584 /ug=Mdm.4709 /len=10011 0.055 29% MKLINYIYSSVWHFLINFINSS...VWHFLINFIYSSVWHFLINFINSSVWHFLINFIYSSVWHFLINFINSSVWHFLINFINSSVWHFLINFIYSSSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFDQFHILFSLALFDQFHKLFSLALFGQFHILFSLALFL ...

Gene : CBRC-CINT-01-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available 500 /gi=47795328 /ug=Cin.16042 /len=777 0.22 22% MCXXXXXXXXXXXXXXXXXIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKLSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYKMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMSMLIYMMS...MLIYMMSMLIYMMSMLIYRLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Knaves, Knights or Networks: Which Assumption of Lecturer and Manager Motivation Should Underlie Further Education Policy?

Science.gov (United States)

Boocock, Andrew

2015-01-01

Julian Le Grand, a well-known economist, identifies two types of public sector employee: knights (with altruistic motives) and knaves (with self-interested motives). He argues that the quasi-market, predicated on the assumption of knavish behaviour (or agent self-interest), is the most effective way of directing school managers and teachers…

Antinociceptive Properties and Acute Toxicity of Ethanol Extract of ...

African Journals Online (AJOL)

Sarah RG de Lima-Saraiva1, Henrique CC Saraiva2, Juliane C Silva2, Leonardo ... 56.304-205, Petrolina, Pernambuco, 3Universidade Estadual de Feira de ..... Santos VNC, Freitas RA, Deschamps FC, Biavatti, MW. ... Queiroz AC, Lira DP, Dias TL, Souza ET, Matta CB, ... Alexandre-Moreira MS, Piuvezam MR, Araújo CC,.

Viking Quest - an Epic Tale of Loot and Legend

Directory of Open Access Journals (Sweden)

Richard Osgood

2002-10-01

Full Text Available Sounding rather more akin to a promotional release for the Tony Curtis/Kirk Douglas film The Vikings, Viking Quest is another BBC undertaking. From Julian Richards' latest offering, The Blood of the Vikings, this game centres on putting together a crew to undertake a raid on the monastery at Lindisfarne.

Eventos de Agosto (August Events).

Science.gov (United States)

Toro, Leonor; Pla, Myrna

Written in Spanish, this booklet contains brief information on seven August events celebrated by Puerto Ricans: Herbert Hoover's birthdate (August 10); Acta del Seguro Social (Social Security Act, August 14); Julian E. Blanco (August 14), Enmienda 19 Sufragia de la Mujer (Amendment 19, Women's Suffrage, August 26); Benjamin Harrison (August 20);…

Gene : CBRC-PMAR-01-0595 [SEVENS

Lifescience Database Archive (English)

Full Text Available =3' /gb=EE272592 /gi=111172325 /ug=Pma.6919 /len=680 2e-04 30% MRLEYLAAIHFNVMMSHFVMMSHFVMMSHFVMMSHVVMMS...YFVMMSHFVMMSHFVMSHVVMMSHFVMSHFVMMSHVVMMSHFVMMSHFVMMSHVVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMSHVVMMS...HFVMMNHFVMMNHFVMMSHFVMMSHFVMMSHFVMMNHFVMMNHFVMMSHFVMMSHFVXXXXEPLRDDEPLRDDEPLRDDEPLRDDEPLRDDESLR

Gene : CBRC-CINT-01-0197 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1561) /gb=AY895021 /gi=62903344 /ug=Cin.18201 /len=1561 1.4 25% MELDHIVLVLRNIFLMV...VDWPFLWSVRRCHRMELDHTVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMVVEQPFLQLVRRYQRMELDHI...VLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLIVVEQPFLQLVRRYQRMELDHIVLVLGNTLLMEQPFLQLVRRYQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQCMEQEQMKQVKE ...

Toxicity of lead-contaminated sediment to mute swans

Science.gov (United States)

Day, D.D.; Beyer, W.N.; Hoffman, D.J.; Morton, Alexandra; Sileo, L.; Audet, D.J.; Ottinger, M.A.

2003-01-01

Most ecotoxicological risk assessments of wildlife emphasize contaminant exposure through ingestion of food and water. However, the role of incidental ingestion of sediment-bound contaminants has not been adequately appreciated in these assessments. This study evaluates the toxicological consequences of contamination of sediments with metals from hard-rock mining and smelting activities. Lead-contaminated sediments collected from the Coeur d'Alene River Basin in Idaho were combined with either a commercial avian maintenance diet or ground rice and fed to captive mute swans (Cygnus olor) for 6 weeks. Experimental treatments consisted of maintenance or rice diets containing 0, 12 (no rice group), or 24% highly contaminated (3,950 ug/g lead) sediment or 24% reference (9.7 ug/g lead) sediment. Although none of the swans died, the group fed a rice diet containing 24% lead-contaminated sediment were the most severely affected, experiencing a 24% decrease in mean body weight, including three birds that became emaciated. All birds in this treatment group had nephrosis; abnormally dark, viscous bile; and significant (p < 0.05) reductions in hematocrit and hemoglobin concentrations compared to their pretreatment levels. This group also had the greatest mean concentrations of lead in blood (3.2 ug/g), brain (2.2 ug/g), and liver (8.5 ug/g). These birds had significant (alpha = 0.05) increases in mean plasma alanine aminotransferase activity, cholesterol, and uric acid concentrations and decreased plasma triglyceride concentrations compared to all other treatment groups. After 14 days of exposure, mean protoporphyrin concentrations increased substantially, and mean delta-aminolevulinic acid dehydratase activity decreased by more than 95% in all groups fed diets containing highly contaminated sediments. All swans fed diets that contained 24% lead-contaminated sediment had renal acid-fast intranuclear inclusion bodies, which are diagnostic of lead poisoning in waterfowl. Body

Plasma lipid peroxidation, blood GSH concentration and erythrocyte antioxidant enzymes in menstruating females with ovulatory and anovulatory cycles compared with males

Directory of Open Access Journals (Sweden)

G Lutosławska

2003-12-01

Full Text Available This study was undertaken to evaluate plasma TBARS and blood GSH concentration and erythrocyte antioxidant enzymes (glutathione peroxidase, catalase and superoxide dismutase in active, regularly menstruating female physical education students with ovulatory and anovulatory menstrual cycles and in their male counterparts. A total of 27 subjects (12 males and 15 females volunteered to participate in the study. All females were regularly menstruating with cycle length between 26-31 days. Plasma progesterone and 17-β-estradiol concentrations were assayed during the 7th-9th and 22nd-25th day of the menstrual cycle. Women with plasma progesterone concentration exceeding 19 nmol•l-1 during the 22nd-25th day were referred to as ovulatory (Group OV; n=7. Women without a peak plasma progesterone concentration were referred to as anovulatory (Group AN; n=8. Blood from male subjects was withdrawn twice - two weeks apart, at their convenience. It was found that the menstrual cycle phases did not affect plasma TBARS and blood glutathione concentration and erythrocyte GPX, CAT and SOD activity. However, erythrocyte GPX activity either in ovulatory or anovulatory women was by about 30% higher than in male subjects. Erythrocyte SOD activity in ovulatory women both in follicular and luteal phase of the menstrual cycle (1557 U/g Hb and 1394.6 U/g Hb, respectively was markedly lower than in men (1951.8 and 1937.7 U/g Hb for blood sampling I and II, respectively. In contrast, erythrocyte SOD activity in anovulatory women (1855.5 U/g Hb and 1745.7 U/g Hb in the follicular and luteal phases, respectively was similar to that found in men. The above data indicated that erythrocyte GPX and SOD activities are sensitive to plasma ovarian hormone concentration. In addition, they suggested that due to higher erythrocyte GPX activity females even with anovulatory menstrual cycles are protected better than males against hydrogen peroxide action. However, lower superoxide

A preliminary study on the physiological effects of aflatoxin B-1 lactating water buffaloes

International Nuclear Information System (INIS)

Abdelaal, A.E.; Naguib, K.M.; Naguib, M.M.

1986-01-01

Aflatoxin B-1 is one of the biologically active mycotoxins, produced as contaminants in human and animal food by a variety of spoilage molds. The effects of administering aflatoxin B-1 on plasma proteins, total thyroxine, cholesterol, zinc and iron were studied in eight lactating buffaloes (3rd and 8th season of lactation). The toxin was first tested in one animal which received single doses of 400, 1000 and 1500 ug each, mixed with 1 Kg ration, given one week apart. Blood, milk and urine samples were collected over the next 120 hrs. The toxin was not detected in either milk or urine. One week later, the latter dose was offered daily, but the animal lost its appetite and did not consume any of the ration offered on the second day. On the third day through the sixth, the toxin (1500 ug in 5 ml chloroform) was injected into the rumen through the flank region using a long needle and a syringe. However, the toxin could not be detected in either milk or urine. After another week, the dose was increased to 5000 ug intraruminally given for 2 days. The toxin appeared in milk and urine. The other seven animals were then included in the experiment and blood samples were collected 10 and 34 hours after dosing. The results obtained (from the pilot test) showed a transient decrease in serum albumin which lasted for 10-24 hours after oral administration of 400, 1000 and 1500 ug in food. This phenomenon was also confirmed in all animals at 34 hrs. after the intraruminal administration of 5000 ug (p>0.01). On the other hand, serum cholesterol was increased (P>0.01). Serum zinc was also increased though insignificantly. However, no appreciable changes were noted in either serum iron or total thyroxine. This experiment has shown that physiological responses may occur before the detection of the toxin in body fluids. It is suggested that measurement of plasma proteins and cholesterol can be used as a test for the toxic effect of aflatoxin, especially at low doses; a case similar to

Spatial patterns and temporal changes in atmospheric-mercury deposition for the midwestern USA, 2001–2016

Science.gov (United States)

Risch, Martin R.; Kenski, Donna M.

2018-01-01

Spatial patterns and temporal changes in atmospheric-mercury (Hg) deposition were examined in a five-state study area in the Midwestern USA where 32% of the stationary sources of anthropogenic Hg emissions in the continental USA were located. An extensive monitoring record for wet and dry Hg deposition was compiled for 2001–2016, including 4666 weekly precipitation samples at 13 sites and 27 annual litterfall-Hg samples at 7 sites. This study is the first to examine these Hg data for the Midwestern USA. The median annual precipitation-Hg deposition at the study sites was 10.4 micrograms per square meter per year (ug/m2/year) and ranged from 5.8 ug/m2/year to 15.0 ug/m2/year. The median annual Hg concentration was 9.4 ng/L. Annual litterfall-Hg deposition had a median of 16.1 ug/m2/year and ranged from 9.7 to 23.4 ug/m2/year. Isopleth maps of annual precipitation-Hg deposition indicated a recurring spatial pattern similar to one revealed by statistical analysis of weekly precipitation-Hg deposition. In that pattern, high Hg deposition in southeastern Indiana was present each year, frequently extending to southern Illinois. Most of central Indiana and central Illinois had similar Hg deposition. Areas with comparatively lower annual Hg deposition were observed in Michigan and Ohio for many years and frequently included part of northern Indiana. The area in southern Indiana where high Hg deposition predominated had the highest number of extreme episodes of weekly Hg deposition delivering up to 15% of the annual Hg load from precipitation in a single week. Modeled 48-h back trajectories indicated air masses for these episodes often arrived from the south and southwest, crossing numerous stationary sources of Hg emissions releasing from 23 to more than 300 kg Hg per year. This analysis suggests that local and regional, rather than exclusively continental or global Hg emissions were likely contributing to the extreme episodes and at least in part, to the spatial

Constraining the origin of the Messinian gypsum deposits using coupled measurement of δ^{18}O$/δD in gypsum hydration water and salinity of fluid inclusions

Science.gov (United States)

Evans, Nicholas P.; Gázquez, Fernando; McKenzie, Judith A.; Chapman, Hazel J.; Hodell, David A.

2016-04-01

We used oxygen and hydrogen isotopes of gypsum hydration water (GHW) coupled with salinity deduced from ice melting temperatures of primary fluid inclusions in the same samples (in tandem with 87Sr/86Sr, δ34S and other isotopic measurements) to determine the composition of the mother fluids that formed the gypsum deposits of the Messinian Salinity Crisis from shallow and intermediate-depth basins. Using this method, we constrain the origin of the Messinian Primary Lower Gypsum (PLG) of the Sorbas basin (Betic foreland) and both the Upper Gypsum (UG) and the Lower Gypsum of the Sicilian basin. We then compare these results to measurements made on UG recovered from the deep Ionian and Balearic basins drilled during DSDP Leg 42A. The evolution of GHW δ18O/δD vs. salinity is controlled by mixing processes between fresh and seawater, coupled with the degree of evaporation. Evaporation and subsequent precipitation of gypsum from fluids dominated by freshwater will result in a depressed 87Sr/86Sr values and different trajectory in δ18O/δD vs. salinity space compared to fluids dominated by seawater. The slopes of these regression equations help to define the end-members from which the fluid originated. For example, salinity estimates from PLG cycle 6 in the Sorbas basin range from 18 to 51ppt, and after correction for fractionation factors, estimated δ18O and δD values of the mother water are low (-2.6 meteoric water during gypsum deposition, while 87Sr/86Sr (0.708942 fall below those expected from the evaporation of seawater alone, the slope of the regression equation is similar to that of seawater evaporation. This implies that there is a change up-section from a dominantly marine environment in cycle 2 to a greater influence of meteoric water in cycle 6. The UG from the Sicilian basin display greater δ18O/δD values (2.9 meteoric water that subsequently underwent intense evaporation. This observation concurs with the low values of 87Sr/86Sr from the same UG

A national assessment of underground natural gas storage: identifying wells with designs likely vulnerable to a single-point-of-failure

Science.gov (United States)

Michanowicz, Drew R.; Buonocore, Jonathan J.; Rowland, Sebastian T.; Konschnik, Katherine E.; Goho, Shaun A.; Bernstein, Aaron S.

2017-05-01

The leak of processed natural gas (PNG) from October 2015 to February 2016 from the Aliso Canyon storage facility, near Los Angeles, California, was the largest single accidental release of greenhouse gases in US history. The Interagency Task Force on Natural Gas Storage Safety and California regulators recently recommended operators phase out single-point-of-failure (SPF) well designs. Here, we develop a national dataset of UGS well activity in the continental US to assess regulatory data availability and uncertainty, and to assess the prevalence of certain well design deficiencies including single-point-of-failure designs. We identified 14 138 active UGS wells associated with 317 active UGS facilities in 29 states using regulatory and company data. State-level wellbore datasets contained numerous reporting inconsistencies that limited data concatenation. We identified 2715 active UGS wells across 160 facilities that, like the failed well at Aliso Canyon, predated the storage facility, and therefore were not originally designed for gas storage. The majority (88%) of these repurposed wells are located in OH, MI, PA, NY, and WV. Repurposed wells have a median age of 74 years, and the 2694 repurposed wells constructed prior to 1979 are particularly likely to exhibit design-related deficiencies. An estimated 210 active repurposed wells were constructed before 1917—before cement zonal isolation methods were utilized. These wells are located in OH, PA, NY, and WV and represent the highest priority related to potential design deficiencies that could lead to containment loss. This national baseline assessment identifies regulatory data uncertainties, highlights a potentially widespread vulnerability of the natural gas supply chain, and can aid in prioritization and oversight for high-risk wells and facilities.

Influence of Chemotherapy on the Lipid Peroxidation and Antioxidant Status in Patients with Acute Myeloid Leukemia

Directory of Open Access Journals (Sweden)

Zohreh Sanaat

2012-07-01

Full Text Available Chemotherapeutic agents used in patients with cancer cause to generate the enormous amounts of free radicals associated with cell injury. In this study we assess the effects of chemotherapy regimen on oxidant/antioxidant status in patients with acute myeloid leukemia (AML. 38 newly diagnosed patients with acute myeloid leukemia were recruited in this study. All patients received cytarabine and daunorubicin as chemotherapy regimen. Plasma levels of malondialdehyde (MDA, total antioxidant status (TAS, and the levels of erythrocyte activity of superoxide dismutase (SOD and glutathione peroxidase (GPx were determined before chemotherapy and 14 days after chemotherapy with cytarabine and daunorubicin. Plasma MDA concentrations increased significantly (from 2.68±0.89 nmol/L to 3.14±1.29 nmol/L during the 14days post-chemotherapy period (P=0.04. Plasma TAS concentrations changed with chemotherapy from 1.09±0.15 mmol/L to 1.02±0.14 mmol/L with P=0.005. Erythrocyte SOD and GPX activity decreased overtime from 1157.24±543.61 U/g Hb to 984.01±419.09 U/g Hb (P=0.04 and 46.96±13.70 U/g Hb to 41.40±6.44 U/g Hb (P=0.02 respectively. We report here that there is an increase in malondialdehyde levels and a decrease in the levels of antioxidant enzymes and total antioxidant status. This suggests that chemotherapy causes these changes as a result of enormous production of reactive oxygen species in the patients with AML. Antioxidant supplementation must be approached with caution because of the probability of reduction the therapeutic efficacy of these cytotoxic drugs.

Effects of Nonlinear Absorption in BK7 and Color Glasses at 355 nm

International Nuclear Information System (INIS)

Adams, J J; McCarville, T; Bruere, J; McElroy, J; Peterson, J

2003-01-01

We have demonstrated a simple experimental technique that can be used to measure the nonlinear absorption coefficients in glasses. We determine BK7, UG1, and UG11 glasses to have linear absorption coefficients of 0.0217 ± 10% cm -1 , 1.7 ± 10% cm -1 , and 0.82 ± 10% cm -1 , respectively, two-photon absorption cross-sections of 0.025 ± 20% cm/GW, 0.035 ± 20% cm/GW, and 0.047 ± 20% cm/GW, respectively, excited-state absorption cross-sections of 8.0 x 10 -18 ± 20% cm 2 , 2.8 x 10 -16 ± 20% cm 2 , and 5 x 10 -17 ± 20% cm 2 , respectively, and solarization coefficients of 8.5 x 10 -20 ± 20% cm 2 , 2.5 x 10 -18 ± 20% cm 2 , and 1.3 x 10 -19 ± 20% cm 2 , respectively. For our application, nonlinear effects in 10-cm of BK7 are small ((le) 2%) for 355-nm fluences 2 for flat-top pulses. However, nonlinear effects are noticeable for 355-nm fluences at 0.8 J/cm 2 . In particular, we determine a 20% increase in the instantaneous absorption from linear, a solarization rate of 4% per 100 shots, and a 10% temporal droop introduced in the pulse, for 355-nm flat-top pulses at a fluence of 0.8 J/cm 2 . For 0.5-cm of UG1 absorbing glass the non-linear absorption has a similar effect as that from 10-cm of BK7 on the pulse shape; however, the effects in UG11 are much smaller

PRODUKSI ANTIBODI KUNING TELUR (IGY ANTI STREPTOCOCCUS MUTANS SEBAGAI ANTI KARIES GIGI

Directory of Open Access Journals (Sweden)

Okti Nadia Poetri

2006-12-01

Full Text Available The aim of this study was to explore IgY anti Streptococcus mutan production and the ability of Igy Streptococcus mutans blocking adhesion process. The eggs was collected from Single Comb Brown Leghorn which have been immunized by S. mutan. Agar gel precipitation test was done to detect IgY anti S. mutans in serum and egg. Egg which Countain IgY anti S. mutans was collected. IgY anti S. mutans extracted from egg yolk by mean s PEG-Amonium sulfat and purified using fast protein liquid chromatography. The purity of Igy anti S. mutans was determined by UV spectropometer. Biological activities of Igy anti S. mutans to inhibit adhession process was learned by anti adhesion test. We use two dose of IgY, which is 100 ug and 500 ug. Igy anti S. mutans formen in serum five weeks after the first immunization while it formed in egg nine weeks after the first immunization. Igy anti S. mutanss still present in serum andegg until twelve weeks from the first immunization. Igy anti S. mutanss could decrease the amount of bacteria which attach the epithelial cell surface. The amount of sticky bacteria on epithelial cell (without IgY are 40 cell bacteria/epithelial cell. After blocked by IgY anti S. mutanss the amount of bacteria turn into 30 cell bacteria/epithelial cell (for dose of 100 ug IgY and 28 cell bacteria/epitheelial cell (for dose of 500 ug IgY. This research concluded that hens were capable producing IgY anti S. mutanss in egg yolk and it can be used to solve dental caries problem which caused by S. mutanss.