FACTORS INFLUENCING THE LEARNING SUCCESS OF MASTER STUDENTS AT IPB BUSINESS SCHOOL (SB-IPB
Directory of Open Access Journals (Sweden)
Maya Wulan Arini
2017-05-01
Full Text Available Business School of IPB (SB-IPB has a low level of completing of study for its master program students on-time. Based on the report of SB-IPB 2015, only 0.8% of students graduating in 2014/2015 successfully completed their study in the normal time of thesis writing. This study aims to identify what factors cause the students unable to complete their thesis on time, thus affecting their learning success. The primary data in this study came from interviews to the students of year 2011/2012, while the secondary data were obtained from the academic section of SB-IPB. Determination of the number of samples was done using slovin formula obtaining 80 students as the respondents. The data analysis method used was SEM with PLS method. The results of the research indicate that the indicator that has a dominant role on the student characteristics is employment status while the dominant role indicators on the process of thesis writing are the suitability of area of interest and the administrative process. The value of the characteristics of students significantly affecting the process of their thesis writing is-0.283, and this indicates that students who are full time workers have a number of constraints in their thesis writing process. Likewise, the process of the thesis writing has a significant influence on the success of the study i.e. 0.346, and it means that the easier the process of thesis writing, the greater the success of their study. The academic division is expected to be more active in controlling the students who are in the process of writing their thesis, especially for the class whose students work full time so that it can well support the learning success of the students.Keywords: business school, master program, success of the study, PLS, SEMABSTRAKMahasiswa program magister di sekolah bisnis IPB (SB-IPB memiliki tingkat ketepatan penyelesaian studi yang masih rendah. Berdasarkan laporan SB IPB 2015, hanya 0.8% mahasiswa yang lulus tahun
Teaching Crossroads: 8th IPB Erasmus Week
Silva, Elisabete Mendes (Ed.); Pais, Clarisse (Ed.); Pais, L.S. (Ed.)
2013-01-01
We are proud to present the second number of Teaching Crossroads, within the 8th IPB Erasmus week which took place in May 2012. This publication is the result of the papers delivered during our Erasmus Week that is becoming increasingly popular among teaching and non-teaching staff from several Erasmus partner Universities. Similarly to last year, we are continuing the publication of Teaching Crossroads whose main purpose is to reach students and teaching staff of the IPB...
Molecular characterization of Fagaceae species using inter-primer binding site (iPBS) markers.
Coutinho, João Paulo; Carvalho, Ana; Martín, Antonio; Lima-Brito, José
2018-04-01
Retrotransposons (RTNs) contribute for genome evolution, influencing its size and structure. We investigated the utility of the RTN-based markers inter-primer binding site (iPBS) for the molecular characterization of 25 Fagaceae species from genera Castanea, Fagus and Quercus. The assessment of genetic diversity, relationships and structure, as well as taxonomic classification of Fagaceae based on molecular data is important for definition of conservation, forestry management strategies and discrimination among natural hybrids and their parents since natural hybridization may increase with the climate changes. Here, iPBS primers designed by other authors were tested alone and combined. Some of them were discriminative, revealed polymorphism within and among taxa allowing the production of a total of 150 iPBS markers. In addition, several monomorphic iPBS markers were also amplified in each taxon. The UPGMA dendrogram based on the pooled iPBS data revealed 27% of genetic similarity among species. The individuals were clustered per genus and most of the oaks per infrageneric group corroborating the adopted taxonomy. Globally, the iPBS markers demonstrated suitability for DNA fingerprinting, determination of phylogenies and taxonomic discrimination in Fagaceae, and could constitute a useful and alternative tool for germplasm characterization, and for definition of conservation strategies and forestry management. Moreover, these markers would be useful for fingerprinting natural hybrids that share morphological similarities with their parents. Since iPBS markers could also enable insights about RTNs evolution, an eventual correlation among iPBS polymorphism, variability of RTN insertions and/or genome size in Fagaceae is discussed.
Evaluation of genetic diversity in open pollinated guava by iPBS primers
International Nuclear Information System (INIS)
Mehmood, A.; Jaskani, M.J.; Ahmad, S.; Ahmad, R.
2013-01-01
DNA markers are important tools for assessing genetic diversity and relationships among species, cultivars and breeding materials. Many horticultural species are lacking genomic information. DNA markers that do not require prior knowledge of DNA sequences are therefore appealing for horticultural research. A retrotransposon-based DNA marker system, iPBS (inter primer binding sites) developed from conserved primer binding sites within retrotransposons, was used to study the genetic variation and relationships in ornamental guava. PCR from 6 iPBS primers (dominant markers) produced a total of 113 bands (52.38-100% polymorphic) ranging from 150 bp to 3000 bp, and the mean PIC value for each primer ranging from 0.1245 to 0.3698. Molecular information generated from both iPBS was separately scored in a matrix for phylogenetic dendrogram construction. The phylogenetic dendrogram based on iPBS markers reflected morphologic classifications of the accessions that were studied. The iPBS PCR-based genome fingerprinting technology in this study is low-cost and provides another effective alternative in differentiation of accessions in guava (Psidium guajava Linn.) and related species or genera. (author)
Directory of Open Access Journals (Sweden)
Andhika Safaat
2008-01-01
Full Text Available Consumer is the determinant factor for the quality of services. Students as the stakeholder of Bogor Agricultural University (IPB need to receive the best services. The aimed of this research were to analyze students’ satisfaction on dormitory in Bogor Agricultural University (IPB and to identify strategy to improve students’ satisfaction. The design of this research was cross sectional study, which carried out in IPB campus, Darmaga-Bogor, West Java for six months since September 2006 to February 2007. Numbers of samples were 289 students. The result showed that the attributes needed to be improved at man’s dormitory were bath room, water availability, the adjustment program for new students, the material construction of dormitory program, the activity of dormitory program, the access to complaint, the dormitory management, the waste management, the safety at room, the tasteof food at canteen, the menu variation, the nutrition of food, the price of food at canteen, the hygiene of food at canteen, and the cleanliness at canteen. Meanwhile, at women dormitory the main priorities to be improved were bathroom, water availability, the place to iron, dispenser, the license for being late, the night’s alarm, the adjustment program, the material construction of dormitory, the activity of dormitory program, the place for complaint, the waste management, the safety at room, the taste of food at canteen, the menu variation, the hygiene of food and the cleanliness at canteen.
Ensuring the success of IPBES: between interface, market place and parliament.
Vohland, Katrin; Nadim, Tahani
2015-02-19
After years of protracted negotiations, the Intergovernmental science-policy Platform on Biodiversity and Ecosystem Services (IPBES) was finally established in 2012. One year on and we have already witnessed two plenary sessions which have, so far, defined procedures for nominating members for observatory and decision-making panels as well as experts and knowledge holders for the compilation of reports. The sessions also determined the work programme for the next 4 years (2014-2018). According to its internally formulated criteria, the success of IPBES will be determined by how credible, relevant and legitimate its institution and operations are. More specifically, these criteria suggest that success is contingent on the transparency of the processes within IPBES, the autonomy and quality of scientific knowledge, and the early integration of different stakeholders and diverse knowledge and value systems. Currently, we see IPBES encompassing open and integrative approaches as well as providing a convenient trading floor for particulate and opaque agendas formulated elsewhere. In any case, without the backing of large and effective publics the policy-support function of IPBES will be limited. Local capacity building and supporting communities to actively participate in research projects dealing with biodiversity are essential for furthering a practical and emancipatory understanding of the relationship between political and economic decisions, the state and functioning of biodiversity and ecosystems, and current and future human well-being. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Applying Open Researchers and Contributors ID in scholarly journals
Directory of Open Access Journals (Sweden)
Jeonghee Im
2015-02-01
Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.
Special Issue in Journal of Astrophysics & Astronomy (JAA). All ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 39; Issue 1. Editorial. Samir Mandal Indranil Chattopadhyay Anuj Nandi Santabrata Das. Volume 39 Issue 1 February 2018 Article ID 1. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/joaa/039/01/0001. Abstract ...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Acquisition performance of LAPAN-A3/IPB multispectral imager in real-time mode of operation
Hakim, P. R.; Permala, R.; Jayani, A. P. S.
2018-05-01
LAPAN-A3/IPB satellite was launched in June 2016 and its multispectral imager has been producing Indonesian coverage images. In order to improve its support for remote sensing application, the imager should produce images with high quality and quantity. To improve the quantity of LAPAN-A3/IPB multispectral image captured, image acquisition could be executed in real-time mode from LAPAN ground station in Bogor when the satellite passes west Indonesia region. This research analyses the performance of LAPAN-A3/IPB multispectral imager acquisition in real-time mode, in terms of image quality and quantity, under assumption of several on-board and ground segment limitations. Results show that with real-time operation mode, LAPAN-A3/IPB multispectral imager could produce twice as much as image coverage compare to recorded mode. However, the images produced in real-time mode will have slightly degraded quality due to image compression process involved. Based on several analyses that have been done in this research, it is recommended to use real-time acquisition mode whenever it possible, unless for some circumstances that strictly not allow any quality degradation of the images produced.
Alat Pengusang Cepat IPB 77-1 MM Untuk Penapisan Vigor Daya Simpan Benih Kedelai
Terryana, Rerenstradika Tizar; Suhartanto, M. R; Qadir, Abdul
2015-01-01
Accelerated Aging Machine “IPB 77-1 MM” could be used for soybean seed screening based on the seed storability vigor. The aim of the research was to identify simple, fast and accurate accelerated aging method using accelerated aging machine IPB 77-1 MM. Two methods of accelerated aging test (physical and chemical treatment) were applied to seeds of Anjasmoro soybean variety. The best accelerated aging method was then used to screen seed storability vigor of 23 soybean varieties. Seed storabil...
The IPBES Conceptual Framework - connecting nature and people
DEFF Research Database (Denmark)
Díaz, Sandra; Demissew, Sebsebe; Carabias, Julia
2015-01-01
, including indigenous and local knowledge. Because the focus on co-construction of integrative knowledge is shared by an increasing number of initiatives worldwide, this framework should be useful beyond IPBES, for the wider research and knowledge-policy communities working on the links between nature...... and people, such as natural, social and engineering scientists, policy-makers at different levels, and decision-makers in different sectors of society....
Dalia integrated production bundle (IPB): an innovative riser solution for deep water fields
Energy Technology Data Exchange (ETDEWEB)
Reals, Th Boscals de; Gloaguen, M.; Roche, F. [Total E and P (Angola); Marion, A.; Poincheval, A. [Technip, Paris (France)
2008-07-01
The Dalia field is located 210 km north west of Luanda (Angola), about 140 km from shore in 1400 meter water-depth. It was the second major discovery out of 15 made in the block 17 operated by Total. The Dalia Umbilical, Flow lines and Risers EPCI Contract was awarded in 2003. The sea-line network to connect and control the 71 wells and 9 manifolds consist of the following: 40 km of insulated pipe in pipe (12 inches into 17 inches) production flow lines; 45 km of 12 inches water and gas injection lines; 6 off 1.7 km flexible water and gas injection risers; 8 off 1.65 km flexible Integrated Production Bundle (IPB) risers; 75 km of control umbilicals. The flow assurance and associated insulation requirement of the production transport system was one of the main challenges of the project. With a crude temperature of 45 deg C at the wellhead and the required minimum temperature of 35 deg C on arrival at the FPSO, this problem was complex. Understanding that, due to the Joule Thompson effect of the riser gas lift, a 'built in' loss of about 5 deg C is induced and together with further losses through the sub sea pipelines, some up to 6 km long, the agreed solution was 'pipe in pipe' for the production flow lines. The innovative flexible IPB riser, incorporating gas lift and heating to keep the fluid temperature above hydrate formation zone, was the selected riser solution. The IPB is new technology for deep water, developed by Technip for Dalia, and consists of a 12 inches nominal central flexible, surrounded by layers of heat tracing cables, small bore gas lift lines, optical fibres and many insulation layers with an Overall Heat Transfer Coefficient of approximately 3,4 W/m{sup 2}K. After an earlier research and development programme, a further extensive qualification programme was conducted during the course of the project, culminating with the deep water testing phase offshore Brazil. The IPB was then approved for fabrication and installation
Green Campus Study by using 10 UNEP’s Green University Toolkit Criteria in IPB Dramaga Campus
Sisriany, Saraswati; Sitti Fatimah, Indung
2017-10-01
Campus landscape is an important part of campus life, because it is regarded as a physical manifestation of the value of a college. Green campus is a concept to build sustainable living practices that are environmentally friendly in educational institutions around the world, including in IPB Dramaga Campus. The main objective of this study is to identified and analyze IPB Dramaga Campus sustainability used green campus criteria from UNEP (United Nations Environment Programme). The methods stages are data collection, analysis and assessment, and recommendation as the synthesis. All the data analyzed with gap analysis, then it assess with Likert Scale scoring. The results showed that green level of IPB Dramaga Campus is classified as Moderate, with total score 32. The result from each criterias are, Energy, Carbon and Climate Change is Moderate; Water is Not Good; Waste is Moderate; Biodiversity and Ecosystem Services is Very Good; Planning Design & Development is Good; Procurement is Moderate; Green Office is Very Not Good; Green Lab is Moderate; Green IT is Good; and Transport is Good. The Green Level of IPB Dramaga Campus will reach Very Good if these recommendation of strategies applied. The strategies are Green Office, Green Campus Audit, Green Champion, Green Financial Strategies, Water Treatment, Green Lab dan Off Campus Transportation.
IPB: Predicting an Unpredictable Enemy Why We do it? Why the S2 can't do it? What the Staff Should
National Research Council Canada - National Science Library
Acord, Michael D
2007-01-01
.... It hypothesizes that two causes: lack of experience of the principal officers conducting IPB and inadequate emphasis on the staff's role in IPB have cascading effects that prevent staffs and commanders from mastering the planning process...
Genetic analysis of the genus Diospyros ssp. using RAPD and i-PBS methods
Directory of Open Access Journals (Sweden)
Jana Raddová
2012-01-01
Full Text Available Molecular techniques (RAPD and i-PBS were used to study genetic diversity within persimmon collection at Horticulture Faculty of Mendel University in Lednice. The aim of the work was to distinguish 14 known and 6 of unknown origin persimmon cultivars. The basic screening of 20 OPT primers was applied to 4 cultivars differring in the place of origin. Within the group of screened primers there were chosen those, which gave polymorphic repeatable strong and middle strong bands. Selected primers were used for the RAPD reactions within the whole persimmon collection. Three OPA primers previously described in the literature were also used for the RAPD reactions within the whole persimmon collection. Additional 16 i-PBS primers previously described in the literature were also used for i-PBS analysis of the whole group of cultivars. Amplification was successful with 12 i-PBS primers. The FreeTree software package was used to generate a similarity matrix and then to produce a dendrogram using UPGMA analyses. The similarity dendrograms of all persimmon cultivars were created based on both approaches and also on combination of both analyses by program Tree View. All the dendrograms clearly separated the assessed cultivars into 4 clusters. There are cluster of American persimmons – Meader’ (1, ’Garretson’ (2 and ’Early Golden’ (3. They are representatives of D. virginiana. Further part of dendrogram includes single D. lotus (5, which is also clearly separated from other cultivars of the genus Diospyros. The third cluster includes interspecific hybrids ’Rossiyanka’ (10 and ’Nikitskaiya Bordovaiya’ (13, which arised from crosses of D. virginiana and D. kaki. The last cluster is formed by cultivars of Japanese persimmon – ’Mikatani Gosho’, ’Zenjimaru’, ’Tone Wase’, ’Hiratanenashi’, ’Fuyu’, Chinese cultivar – ’Sansi’ and two Italian cultivars ’Vaniglia’ and ’Tipo’. They are clustered without significant
ANALISIS MISI DAN RANCANGAN LAPAN-IPB SATELLITE (LISAT UNTUK PEMANTAUAN KEMANDIRIAN PANGAN
Directory of Open Access Journals (Sweden)
Mahmud Arifin Raimadoya
2011-12-01
Full Text Available LAPAN-IPB micro satellite (LISAT is the first EBA (Experimental Based Application planned to be launched in 2013. The technical schedule implementation includes Phase-1 (2010, Phase-2 (2011, Phase-3 (2012, and Launching/Phase-4 (2013. This research was targeted at the Phase-1 (MAD: Mission Analysis and Design, with priority on space segment and user segment. Goal of this research were three critical elements: (1 initial document of MRD (Mission Requirements Definition as a reference for next LISAT phase (policy, (2 electronic Basic Ricefield Map (e-BARIM at the test site in Subang regency, West Java (user segment, and (3 test flight of 3-channel optical sensor (LISAT-EM3 at the test site (space segment. The study was scheduled for gadu season rice crop of 2010, and most of the work completed, except for flight test that were experiencing delay for several times. Flight was re-scheduled from early July to September, but eventually conducted in early November. This was due to the complexity of coordination of many agencies involved: LAPAN / Pustekelegan (administration, TNI headquarters (security clearance, Theta System, Germany (line-CCD, IPB (area-CCD and Deraya Air (charter aircraft
Xu, Jing-Yuan; Zhu, Yan; Yi, Ze; Wu, Gang; Xie, Guo-Yong; Qin, Min-Jian
2018-01-01
"Wu zhu yu", which is obtained from the dried unripe fruits of Tetradium ruticarpum (A. Jussieu) T. G. Hartley, has been used as a traditional Chinese medicine for treatment of headaches, abdominal colic, and hypertension for thousands of years. The present study was designed to assess the molecular genetic diversity among 25 collected accessions of T. ruticarpum (Wu zhu yu in Chinese) from different areas of China, based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers. Thirteen ISSR primers generated 151 amplification bands, of which 130 were polymorphic. Out of 165 bands that were amplified using 10 iPBS primers, 152 were polymorphic. The iPBS markers displayed a higher proportion of polymorphic loci (PPL = 92.5%) than the ISSR markers (PPL = 84.9%). The results showed that T. ruticarpum possessed high loci polymorphism and genetic differentiation occurred in this plant. The combined data of iPBS and ISSR markers scored on 25 accessions produced five clusters that approximately matched the geographic distribution of the species. The results indicated that both iPBS and ISSR markers were reliable and effective tools for analyzing the genetic diversity in T. ruticarpum. Copyright © 2018 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.
Sakai-Kawada, Francis E; Yakym, Christopher J; Helmkampf, Martin; Hagiwara, Kehau; Ip, Courtney G; Antonio, Brandi J; Armstrong, Ellie; Ulloa, Wesley J; Awaya, Jonathan D
2016-09-22
We report here the 6.0-Mb draft genome assembly of Pseudoalteromonas luteoviolacea strain IPB1 that was isolated from the Hawaiian marine sponge Iotrochota protea Genome mining complemented with bioassay studies will elucidate secondary metabolite biosynthetic pathways and will help explain the ecological interaction between host sponge and microorganism. Copyright © 2016 Sakai-Kawada et al.
ANALISIS DAN STRATEGI MENINGKATKAN KEPUASAN MAHASISWA IPB TERHADAP PENYELENGGARAAN AKADEMIK
Directory of Open Access Journals (Sweden)
Retnaningsih Retnaningsih
2009-01-01
Full Text Available Consumer is the determinant factor for the quality of services. Students as the one of stakeholders of Bogor Agricultural University (IPB needed to be given the best services. The aimed of this research were to analyze students satisfaction on academic performance in Bogor Agricultural University (IPB as well as the strategy to improve students satisfaction. The design of this research was cross sectional study, which carried out in IPB campus, Darmaga-Bogor, West Java for six months since September 2006 to February 2007. Number of samples were 600 students. The result showed that the atributs which needed to be improve in input stage were curriculum appropriateness with the expected competency and system information of incoming students by IPB and department. Meanwhile, on process stage the main priorities to be improved were the appropriateness of material lecture with current condition, the examples used to explain the lecture material, method of delivering lecture material orally, audio-visual equipment, teacher’s effort to make learning process lively, the ease of students to write down and understanding the lecture material, the implementation of learning process evaluation, administrative services in preparation class, teachers and students interaction, grade announcement, last assignment preparation including field study, last assignment administration, passing letter process in faculty, the convenience and cleanness of class, the appropriateness of number tools with number of students in laboratory, field work facility, references collection and the ease of references searching in library, last assignment and middle assignment scheduling, transcript of semester emerging, and also administration services. Whereas in output stage, decision making ability and planning implementation became main priority.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Analisis Perubahan Kualitas Pascapanen Pepaya Varietas IPB 9 pada Umur Petik yang Berbeda
Directory of Open Access Journals (Sweden)
Nur Arifiya
2015-04-01
Full Text Available Papaya is generally harvested at condition of hard green mature. The maturity level depends on the market destination. Understanding the maturity level and its postharvest quality changes of papaya during storage is important in order to determine the market destination. The objective of this study was to investigate the effect of different picking date on the postharvest quality and shelf life of papaya cv. IPB9 during storage period. Sample of papaya fruits were harvested at 135, 131, 128, 121 and 114 days after anthesis. After harvesting, papaya fruits were ripened artificially by injecting 50ppm of ethylene during 24hand then were placed in the room temperature. The results showed that picking date of 128 has the highest starch content. After ripening, this papaya fruit has soluble solid content (SSC of 6.7°Brix. For those papaya fruits with picking date of 135 and 131 have SSC of 8.3°Brix dan 7.5°Brix at four days storage. Papaya fruit with picking days of 128 has the longest shelf life until six days. The shortest shelf life was papaya fruits with picking date of 131 and 135 until four days. These picking date of 114 and 121 showed the lowest SSC. It could be concluded that for papaya fruit cv IPB9, the picking date of 128 was the most suitable for long distance market.
Band co-registration modeling of LAPAN-A3/IPB multispectral imager based on satellite attitude
Hakim, P. R.; Syafrudin, A. H.; Utama, S.; Jayani, A. P. S.
2018-05-01
One of significant geometric distortion on images of LAPAN-A3/IPB multispectral imager is co-registration error between each color channel detector. Band co-registration distortion usually can be corrected by using several approaches, which are manual method, image matching algorithm, or sensor modeling and calibration approach. This paper develops another approach to minimize band co-registration distortion on LAPAN-A3/IPB multispectral image by using supervised modeling of image matching with respect to satellite attitude. Modeling results show that band co-registration error in across-track axis is strongly influenced by yaw angle, while error in along-track axis is fairly influenced by both pitch and roll angle. Accuracy of the models obtained is pretty good, which lies between 1-3 pixels error for each axis of each pair of band co-registration. This mean that the model can be used to correct the distorted images without the need of slower image matching algorithm, nor the laborious effort needed in manual approach and sensor calibration. Since the calculation can be executed in order of seconds, this approach can be used in real time quick-look image processing in ground station or even in satellite on-board image processing.
KELAINAN BANGUN ANATOMIS KUKU KUDA KOLEKSI LABORATORIUM ANATOMI FKH IPB
Directory of Open Access Journals (Sweden)
Kemaz A Dewangga
2009-03-01
Full Text Available The objective of this study is to observe the anatomical structure of horse hooves collected from the Laboratory of Anatomy FKH IPB. Twenty five hoof specimens, consisting of ten fore hooves and fifteen hind hooves were used as research materials. The external morphology such as color, angle, structure and condition of the hoof wall were described. The observation on external morphology showed that the hooves have two basic colors, black and white. Generally, all of the hoof specimens showed abnormalities in such aspect as angle, structure and condition of the wall. The structures of fore hoof and hind hoof from this study are classified into 8 categories, they are: flat foot, flared foot, knol hoef, fever rings, sand crack, club foot, contracted foot and bull nosed foot.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 3 ... Article ID 40 Research Article ... Article ID 41 Research Article ..... Physical hydrodynamic propulsion model study on creeping viscous flow through a ciliated porous tube.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 4. Issue front cover ... Article ID 57 Research Article ... Article ID 58 Research Article ..... A study of fractional Schrödinger equation composed of Jumarie fractional derivative.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 39; Issue 1. Issue front cover thumbnail. Volume 39, Issue 1. February 2018. Article ID 1. Editorial · Samir Mandal Indranil Chattopadhyay Anuj Nandi Santabrata Das · More Details Abstract Fulltext PDF. Article ID 2 Review. High energy transients: The ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 5. Issue front cover thumbnail. Volume 88, Issue 5. May 2017. Article ID 74 .... studied over a wide electron temperature range. Article ID 77 Research Article. Dirac equation, hydrogen atom spectrum and the Lamb shift in dynamical non-commutative spaces.
PEMBANGUNAN DATABASE MANGROVE UNTUK BIODIVERSITY INFORMATICS BIOFARMAKA IPB
Directory of Open Access Journals (Sweden)
Yeni Herdiyeni
2014-12-01
Full Text Available Mangroves are a source of traditional medicine that can be used as a source of bioactive compounds. With the conversion of mangrove ecosystem into another designation led to the extinction of mangrove ecosystems. Therefore we need a good management of natural resources. In natural resource management, biodiversity information is needed to sustain the species utilization, exploration potential of the species and their biological and ecological monitoring, policy making, and for the development of biotechnology innovation. Research center of IPB Biopharmaca (Institute for Research and Community Services of Bogor Agricultural University has the mandate to conduct research from upstream to downstream in the medicinal field. This study develops Indonesian mangrove biodiversity database for Biodiversity Informatics. Biodiversity informatics (BI is the development of computer-based technologies for the management of biodiversity information. BI can be used to improve the knowledge management (knowledge management, exploration, analysis, synthesis, and interpretation of data ranging from the level of genomic biodiversity, species level to the ecosystem level. From the results of this study are expected data, information and knowledge of natural wealth mangroves can be managed properly so that the preservation of natural resources can be properly maintained and can be used in particular to the field of medicinal studies.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 3. Issue front cover thumbnail. Volume 87, Issue 3. September 2016. Theme Issue on Higgs Physics. Article ID 1. Preface · Debajyoti Choudhury · More Details Abstract Fulltext PDF. Article ID 35 Special Issue. A review of the discovery of SM-like Higgs boson ...
Database Description - AcEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available abase Description General information of database Database name AcEST Alternative n...hi, Tokyo-to 192-0397 Tel: +81-42-677-1111(ext.3654) E-mail: Database classificat...eneris Taxonomy ID: 13818 Database description This is a database of EST sequences of Adiantum capillus-vene...(3): 223-227. External Links: Original website information Database maintenance site Plant Environmental Res...base Database Description Download License Update History of This Database Site Policy | Contact Us Database Description - AcEST | LSDB Archive ...
African Journal of Economic Review
African Journals Online (AJOL)
The African Journal of Economic Review (AJER) is a refereed, biannual Journal that ... Other websites associated with this journal: http://www.out.ac.tz/ ... Foreign direct investment and natural resources in sub-Saharan Africa: the role of ...
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
Directory of Open Access Journals (Sweden)
Gaby Haddow
2007-06-01
Full Text Available Objective – To identify valid measures of journal usage by comparing citation data with print and electronic journal use data.Design – Bibliometric study.Setting – Large academic library in Canada.Subjects – Instances of use were collected from 11 print journals of the American Chemical Society (ACS, 9 print journals ofthe Royal Society of Chemistry (RSC, and electronic journals in chemistry and biochemistry from four publishers – ACS, RSC, Elsevier, and Wiley. ACS, Elsevier, and Wiley journals in chemistry‐related subject areas were sampled for Journal Impact Factors and citations data from the Institute for Scientific Information (ISI.Methods – Journal usage data were collected to determine if an association existed between: (1 print and electronic journal use; (2 electronic journal use and citations to journals by authors from the university; and (3 electronic journal use and Journal Impact Factors. Between June 2000 and September 2003, library staff recorded the re‐shelving of bound volumes and loose issues of 20 journal titles published by the ACS and the RSC.Electronic journal usage data were collected for journals published by ACS, RSC, Elsevier, and Wiley within the ISI‐defined chemistry and biochemistry subject area. Data were drawn from the publishers’ Level 1 COUNTER compliant usage statistics. These data equate 1 instance of use with a user viewing an HTML or PDF full text article. The period of data collection varied, but at least 2.5 years of data were collected for each publisher. Journal Impact Factors were collected for all ISI chemistry‐related journals published by ACS, Elsevier, and Wiley for the year 2001. Library Journal Utilization Reports (purchased from ISI were used to determine the number of times researchers at the university cited journals in the same set of chemistry‐related journals over the period 1998 to 2002. The authors call this “local citation data” (512. The results from
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 41; Issue 3 ... Asthma is a chronic disease due to inflammation of the airways of lungs that is clinically ... ACE insertion/deletion (I/D) polymorphism, rs4646994, in asthma in Pakistani patients.
Yang, Chun-Hua; Zhou, Tian-Biao
2015-12-01
This article has been included in a multiple retraction: Chun-Hua Yang and Tian-Biao Zhou Association of the ACE I/D gene polymorphism with sepsis susceptibility and sepsis progression Journal of Renin-Angiotensin-Aldosterone System 1470320314568521, first published on February 3, 2015 doi: 10.1177/1470320314568521 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10.1177/1470320314566019 Tian-Biao Zhou, Xue-Feng Guo, Zongpei
Pramana – Journal of Physics | News
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 3. An efficient algorithm for computation of solitary wave solutions to nonlinear differential equations. KAMRAN AYUB M YAQUB KHAN QAZI MAHMOOD-UL-HASSAN JAMSHAD AHMAD. Research Article Volume 89 Issue 3 September 2017 Article ID 45 ...
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
http://journal.eng.unila.ac.id/index.php/mech/article/view/328
Directory of Open Access Journals (Sweden)
M. Mirmanto
2016-03-01
Full Text Available As the fossil energy has been getting depletion, it is important to utilize alternative energies such as solar energy. An equipment that can be used for capturing and converting solar energy is solar collector. Two identical collectors used in this study were placed facing to the North with an inclination angle of 15°. The collector dimension was 0.8 m x 1 m x 0.05 m. One collector contained 5 parallel pipes and the other contained 7 parallel pipes. The water used in the test was flowed naturally due to the gravity force from a higher tank and was adjusted using a valve fitted at the end of the collector. The water flow rates employed were 200, 250 and 300 cc/minutes and measured using a volume meter and a stop watch. The results showed that the energy coming into the collector, energy absorbed by the absorber and water, increased with an increase in the observation time and reached the peak value at about 2.30 pm. After that, they decreased. The effect of the pipe number is insignificant.
https://journal.unnes.ac.id/sju/index.php/peshr/article/view/6519
Directory of Open Access Journals (Sweden)
Jumanto
2015-08-01
Full Text Available The purpose of this study was to determine how the implementation of development programs and how-owned facilities and infrastructure to support development programs in Krengseng Sejati School Football. The population in this study were athletes and coaches in Krengseng Sejati School Football , Gringsing sub-district, Batang city. The sample in this study were athletes and coaches in Krengseng Sejati School Football , Gringsing sub-district, Batang city as much as a coach and 30 athletes. Sampling technique used is total sampling. Data collection by survey method with questionnaire. Data from the instrument questionnaire prepared by the method of analytical description of the percentage. From the analysis shows that the pattern Soccer School coaching very well categorized by 4 respondents (19%, categorized either as many as 21 respondents (68%, categorized simply by 4 respondents (13%, and no one category is less and less . The conclusion that can be taken was the average rate of pattern formation Krengseng Sejati School Football , Gringsing sub-district, Batang city was 77%. These results indicate that the pattern of development is in good category.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 130; Issue 3. Issue front cover ... More Details Abstract Fulltext PDF. Article ID 22. Synthesis and biological evaluation of some bicyclic [2-(2 .... Non-oxidative methane dehydroaromatization reaction over highly active α-MoC1−x ZSM-5 derived from pretreatment.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 37; Issue 4. Issue front cover thumbnail. Volume 37, Issue 4. December 2016. Science with the Square Kilometre Array: An Indian Perspective. Article ID 25 Review. Probing Statistical Isotropy of Cosmological Radio Sources using Square Kilometre Array.
Directory of Open Access Journals (Sweden)
Anukriti Singh
2018-04-01
Full Text Available Renin angiotensin system (RAS comprising Angiotensin converting enzyme (ACE, Angiotensin II (Ang II and its receptor Angiotensin II receptor type I (AGTR1, plays a critical role in several diseases including cancer. A single nucleotide polymorphism (SNP A1166C located in 3′ untranslated region (UTR of AGTR1 and an insertion/deletion (I/D polymorphism present in intron 16 of ACE gene have been associated with many diseases, but their association with Breast cancer (BCa is still debatable. Here, we for the first time investigated the association of these polymorphisms in a North Indian BCa cohort including 161 patients and 152 healthy women. The polymorphisms were evaluated by polymerase chain reaction (PCR and restriction fragment length polymorphism (RFLP respectively. The association between these polymorphisms and BCa risk was estimated by calculating Odds Ratio (OR and chi-square (χ2 test. The DD genotype/D allele of ACE (I/D polymorphism and “AC and CC” genotype/C allele of AGTR1 (A1166C polymorphism were associated with higher risk of BCa when evaluated independently. Furthermore, interaction analysis of “AC and CC” and DD genotype and combination of “C and D” alleles of both polymorphisms revealed significantly greater BCa risk than that observed independently. Conclusively, women harboring “AC or CC” genotype/C allele for AGTR1 (A1166C polymorphism and DD genotype/D allele for ACE (I/D polymorphisms have a predisposition to develop more aggressive disease with advanced staging and larger tumor size. Our study indicates importance of genetic screening based on these polymorphisms for women, who may have higher risk of BCa.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. S V Nakhe. Articles written in Pramana – Journal of Physics. Volume 75 Issue 5 November 2010 pp 953-959 Conributed Papers. Development of a 16 kHz repetition rate, 110 W average power copper HyBrID laser · R Biswal P K Agrawal G K Mishra S V Nakhe S K Dixit J K ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. S K Dixit. Articles written in Pramana – Journal of Physics. Volume 75 Issue 5 November 2010 pp 953-959 Conributed Papers. Development of a 16 kHz repetition rate, 110 W average power copper HyBrID laser · R Biswal P K Agrawal G K Mishra S V Nakhe S K Dixit J K ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Plane Symmetric Cosmological Model with Quark and Strange Quark Matter in f ( R , T ) Theory of Gravity. P. K. AGRAWAL D. D. PAWAR. Research Article Volume 38 Issue 1 March 2017 Article ID 2 ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 126; Issue 5. First discovery of fossil winged seeds of Pinus L. (family Pinaceae) from the Indian Cenozoic and its palaeobiogeographic significance. Mahasin Ali Khan Subir Bera. Volume 126 Issue 5 July 2017 Article ID 63 ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 1. Issue front cover thumbnail. Volume 88, Issue 1. January 2017. General editorial on publication ethics · More Details Abstract Fulltext PDF. Article ID 1 Regular. Periodic Hamiltonian hierarchies and non-uniqueness of superpotentials · PARTHA MANDAL ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 90; Issue 2. The synchronisation of ... PARIZ ALI KARIMPOUR. Research Article Volume 90 Issue 2 February 2018 Article ID 26 ... In addition, the unpredictability and complexity of the drive systems enhance the security of secure communication. The corresponding ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 2. Issue front cover thumbnail. Volume 89, Issue 2. August 2017. Article ID 19 Research Article. Design of multistable systems via partial synchronization · MOHAMMAD ALI KHAN MAYURAKSHI NAG SWARUP PORIA · More Details Abstract Fulltext PDF.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-08-26
Aug 26, 2016 ... Home; Journals; Journal of Biosciences; Search ... part of the email address of all email addresses used by the office of Indian Academy of Sciences, including those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 2. Issue front cover thumbnail. Volume 38, Issue 2. June 2017. Article ID 18 Research Article. Gulmarg, Kashmir, India: Potential Site for Optical Astronomical Observations · Ajaz Ahmad Dar Manzoor A. Malik · More Details Abstract Fulltext PDF.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 3. Issue front cover thumbnail. Volume 38, Issue 3. September 2017. Special issue on "Physics of Neutron Stars and Related Objects". Article ID 36 Editorial. Editorial · Dipankar Bhattacharya K. S. Dwarakanath Sushan Konar · More Details Abstract ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 2. Issue front cover thumbnail. Volume 87, Issue 2. August 2016. Article ID 17 Research Article. The ( G ′ / G , 1 / G )-expansion method for solving nonlinear space–time fractional differential equations · EMRULLAH YA¸SAR ILKER BURAK GIRESUNLU.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 3. Model-free adaptive sliding mode controller design for generalized projective synchronization of the fractional-order chaotic system via radial basis function neural networks. L M WANG. Research Article Volume 89 Issue 3 September 2017 Article ID 38 ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 1. Issue front cover thumbnail. Volume 89, Issue 1. July 2017. Proceedings of the 3rd E-Workshop/Conference on Computational Condensed Matter Physics and Materials Science. Article ID 1 Special Issue.
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 2. Effects of particle size and laser wavelength on heating of silver nanoparticles under laser irradiation in liquid. HODA MAHDIYAN MOMEN. Research Article Volume 87 Issue 2 August 2016 Article ID 26 ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 37; Issue 2. Issue front cover thumbnail. Volume 37, Issue 2. June 2016. Article ID 8. Stochastic Oscillations of General Relativistic Disks Described by a Fractional Langevin Equation with Fractional Gaussian Noise · Wang Zhi-Yun Chen Pei-Jie · More Details ...
South African Journal of Higher Education: Contact
African Journals Online (AJOL)
Principal Contact. Prof Yusef Waghid Editor-in-Chief South African Journal of Higher Educatio. South African Journal of Higher Education Faculty of Education Stellenbosch University. Private Bag X1 Matieland 7602. Phone: +27 (021) 8082419. Fax: +27 (021) 8082283. Email: yw@sun.ac.za ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 126; Issue 5. Issue front cover thumbnail. Volume 126, Issue 5. July 2017. Article ID 62. Meteorological features associated with unprecedented precipitation over India during 1st week of March 2015 · Naresh Kumar M Mohapatra A K Jaswal · More Details Abstract ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 1. Periodic Hamiltonian hierarchies and ... ABHIJIT BANERJEE. Regular Volume 88 Issue 1 January 2017 Article ID 1 ... Abstract. In this article, a family of periodic quantum Hamiltonians, that is subject to a closure condition is considered. In the context of the ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 4. Issue front cover thumbnail. Volume 89, Issue 4. October 2017. Proceedings of PHENO1: The First Workshop on Beyond Standard Model Physics at IISER Mohali. Article ID 50 Special Issue. Preface · Charanjit S Aulakh Ketan Patel · More Details Abstract ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 23; Issue 1-2 ... We report the discovery of a decay in the superorbital period of the binary X-ray pulsar LMC X-4. ... This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1.
Lifescience Database Archive (English)
Full Text Available (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -...short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -...short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrE...t.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available rot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...oo short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrE...t.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repo...too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repo...too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report...o short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Abundances of La138 and Ta180 Through ν-Nucleosynthesis in 20 M ⊙ Type II Supernova Progenitor, Guided by Stellar Models for Seeds. N. Lahkar S. Kalita H. L. Duorah K. Duorah. Research Article Volume 38 Issue 1 March 2017 Article ID 8 ...
Lifescience Database Archive (English)
Full Text Available ss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...ce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value ...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available wiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -...ence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available iss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...nce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-valu...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available s-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Re...e too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. Joseph John Thomson (1856-1940). Featured Scientist Volume 2 Issue 12 December 1997 pp 114-114. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0114-0114. Resonance – Journal ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 7. Refresher Course in Immunology. Information and Announcements Volume 7 Issue 7 July 2002 pp 92-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/07/0092-0092. Resonance – Journal ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 1. Arrows in Chemistry. Abirami Lakshminarayanan. General Article Volume 15 Issue 1 January 2010 pp 51-63. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/01/0051-0063. Keywords.
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. Physical Research Laboratory. P Sharma. Information and Announcements Volume 4 Issue 7 July 1999 pp 92-96. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/07/0092-0096 ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 96; Issue 5. Haldane and modern evolutionary genetics. BRIAN CHARLESWORTH. HALDANE AT 125 Volume 96 Issue 5 November 2017 pp 773-782. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jgen/096/05/0773-0782. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Vikram A Sarabhai (1919-1971). Featured Scientist Volume 6 Issue 12 December 2001 pp 107-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0107-0107. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Marie Sklodowska Curie (1867-1934). Featured Scientist Volume 6 Issue 3 March 2001 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0098-0098. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 10. Geoffrey Ingram Taylor (1886-1975). Featured Scientist Volume 9 Issue 10 October 2004 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/10/0098-0098. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 2. Jagadis Chandra Bose (1858-1937). Featured Scientist Volume 3 Issue 2 February 1998 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/02/0098-0098. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 9. Ronald Aylmer Fisher (1890-1962). Featured Scientist Volume 2 Issue 9 September 1997 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/09/0098-0098. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 1. Salim Moizuddin Abdul Ali (1896-1987). Featured Scientist Volume 2 Issue 1 January 1997 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/01/0098-0098. Resonance – Journal of ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. S S Bhatnagar (1894-1955). Featured Scientist Volume 16 Issue 12 December 2011 pp 1354-1354. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1354-1354. Resonance – Journal of ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. Electrons in Condensed Matter. T V Ramakrishnan. General Article Volume 2 Issue 12 December 1997 pp 17-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0017-0032 ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2011-03-14
Mar 14, 2011 ... Home; Journals; Journal of Biosciences; Volume 36; Issue 1. Clipboard: New paradigm for ATP synthesis and consumption. C Channakeshava. Volume 36 Issue 1 March 2011 pp 3-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/036/01/0003-0004 ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 26; Issue 2. The roots of ancient medicine: an historical outline. B V Subbarayappa. Perspectives Volume 26 Issue 2 June 2001 pp 135-143. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/026/02/0135-0143. Author Affiliations.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2006-05-06
May 6, 2006 ... Home; Journals; Journal of Biosciences; Volume 31; Issue 2. Kenneth Raper, Elisha Mitchell and Dictyostelium. Eugene R Katz. Perspectives Volume 31 Issue 2 June 2006 pp 195-200. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/031/02/0195-0200 ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. Haber Process for Ammonia Synthesis. Jayant M Modak. General Article Volume 7 Issue 9 September 2002 pp 69-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0069-0077 ...
Lifescience Database Archive (English)
Full Text Available sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL ...(release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Res...ult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX R...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX R...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL... (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Directory of Open Access Journals (Sweden)
Retnaningsih Retnaningsih
2010-01-01
Full Text Available The aim of this research was to analyze factors which influence IPB students attitudes and buying behaviour of piracy book. Research method used cross sectional study design. The primary data from samples was collected along Mei 2009. Data was taken from 100 girls and 100 boys as samples of this research. The samples chosen by proportional sampling in each faculty of IPB. The data consist of primary data and secondary data. Data was analyzed by descriptive and inferential statistic (Mann-Whitney, t-test, multivariate regression, and logistic regression. The result showed that almost samples readed books and mostly they bought a book on the last three months. Almost of them had knowledge about piracy book with average level. Meanwhile, the attitude of the samples to piracy book were neutral. Factors that influenced attitude to piracy book were ages, money allocation, information resources, and level of knowledge. Then, attitude to piracy book was the factor that influenced buying behavior of piracy book.
Lifescience Database Archive (English)
Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link... to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - Tr...EMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to B...lastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available hort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - T...rEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to Bla...stX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to Blas...tX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available .) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMB...L (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link... to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -... TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available hort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link t...o BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available o short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ...- TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) ...Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 26; Issue 4. Is there a role for contraceptive vaccines in fertility control? A Jagannadha Rao. Volume 26 Issue 4 November 2001 pp 425-427. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/026/04/0425-0427. Keywords. Fertility ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 42; Issue 1. What history tells us XLII. A 'new' view of proteins. MICHEL MORANGE. Series Volume 42 Issue 1 March 2017 pp 11-14. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/042/01/0011-0014. Keywords. Allostery ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 29; Issue 1. What impact, if any, has feminism had on science? Evelyn Fox Keller. Perspectives Volume 29 Issue 1 March 2004 pp 7-13. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/029/01/0007-0013. Author Affiliations.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2010-11-09
Nov 9, 2010 ... Home; Journals; Journal of Biosciences; Volume 35; Issue 4. What history tells us XXII. The French neo-Lamarckians. Michel Morange. Series Volume 35 Issue 4 December 2010 pp 515-517. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/035/04/0515-0517 ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Artificial Seeds and their Applications. G V S Saiprasad. General Article Volume 6 Issue 5 May 2001 pp 39-47. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0039-0047 ...
Lifescience Database Archive (English)
Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -... Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) L...ink to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available e too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Rep...ort - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 3...9.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available . Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rele...ase 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available equence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repor...t - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - ...Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 3...9.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -... Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (r...elease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available t op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (...release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL... (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rel...ease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2008-01-31
Jan 31, 2008 ... Home; Journals; Journal of Biosciences; Volume 33; Issue 1. Biological time is fractal: Early events reverberate over a life time. David Lloyd. Perspectives Volume 33 Issue 1 March 2008 pp 9-19. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/033/01/0009- ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 96; Issue 5. J. B. S. Haldane: the John Innes years. SARAH WILMOT. HALDANE AT 125 Volume 96 Issue 5 November 2017 pp 815-826. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jgen/096/05/0815-0826. Keywords. J. B. S. ...
Astronomy and Computing: A New Journal for the Astronomical Computing Community
Mann, R. G.; Accomazzi, A.; Budavári, T.; Fluke, C.; Gray, N.; O'Mullane, W.; Wicenec, A.; Wise, M.
2013-10-01
We introduce Astronomy and Computing (A&C), a new, peer-reviewed journal for the expanding community of people whose work focuses on the application of computer science and information technology within astronomy, rather than on astronomical research per se. A&C arose from a BoF discussion at the ADASS XX conference in Boston, and from the ADASS community will come many of the people who will write, referee and read the papers published in A&C. In this paper, we outline the aims and scope of A&C, together with a summary of the types of paper we envisage it publishing and the criteria that will be used to referee them, and we invite the ADASS community to help us develop these in more detail and to shape a journal that serves the astronomical computing community well.
iPBS: a universal method for DNA fingerprinting and retrotransposon isolation.
Kalendar, Ruslan; Antonius, Kristiina; Smýkal, Petr; Schulman, Alan H
2010-11-01
Molecular markers are essential in plant and animal breeding and biodiversity applications, in human forensics, and for map-based cloning of genes. The long terminal repeat (LTR) retrotransposons are well suited as molecular markers. As dispersed and ubiquitous transposable elements, their "copy and paste" life cycle of replicative transposition leads to new genome insertions without excision of the original element. Both the overall structure of retrotransposons and the domains responsible for the various phases of their replication are highly conserved in all eukaryotes. Nevertheless, up to a year has been required to develop a retrotransposon marker system in a new species, involving cloning and sequencing steps as well as the development of custom primers. Here, we describe a novel PCR-based method useful both as a marker system in its own right and for the rapid isolation of retrotransposon termini and full-length elements, making it ideal for "orphan crops" and other species with underdeveloped marker systems. The method, iPBS amplification, is based on the virtually universal presence of a tRNA complement as a reverse transcriptase primer binding site (PBS) in LTR retrotransposons. The method differs from earlier retrotransposon isolation methods because it is applicable not only to endogenous retroviruses and retroviruses, but also to both Gypsy and Copia LTR retrotransposons, as well as to non-autonomous LARD and TRIM elements, throughout the plant kingdom and to animals. Furthermore, the inter-PBS amplification technique as such has proved to be a powerful DNA fingerprinting technology without the need for prior sequence knowledge.
Evaluation of an Anti-HER2 Nanobody Labeled with 225Ac for Targeted α-Particle Therapy of Cancer.
Pruszynski, Marek; D'Huyvetter, Matthias; Bruchertseifer, Frank; Morgenstern, Alfred; Lahoutte, Tony
2018-04-02
Human epidermal growth factor receptor type 2 (HER2) is overexpressed in numerous carcinomas. Nanobodies (Nbs) are the smallest antibody-derived fragments with beneficial characteristics for molecular imaging and radionuclide therapy. Therefore, HER2-targeting nanobodies could offer a valuable platform for radioimmunotherapy, especially when labeled with α-particle emitters, which provide highly lethal and localized radiation to targeted cells with minimal exposure to surrounding healthy tissues. In this study, the anti-HER2 2Rs15d-nanobody was conjugated with 2-(4-isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid ( p-SCN-Bn-DOTA) and radiolabeled with an α-emitter 225 Ac with a high yield (>90%) and a radiochemical purity above 95%. The 225 Ac-DOTA-Nb binding affinity was 4.12 ± 0.47 nM with an immunoreactive fraction above 80%. Binding to low HER2-expressing MDA-MB-231 cells was negligible, whereas HER2-overexpressing SKOV-3 cells could be blocked with an excess of unlabeled nanobody, confirming the specificity of binding. Noncompeting binding to HER2 was observed in the presence of an excess of trastuzumab. The cell-associated fraction of 225 Ac-DOTA-Nb was 34.72 ± 16.66% over 24 h. In vitro, the radioconjugate was toxic in an HER2-mediated and dose-dependent manner, resulting in IC 50 values of 10.2 and 322.1 kBq/mL for 225 Ac-DOTA-Nb and the 225 Ac-DOTA control, respectively, on SKOV-3 cells, and 282.2 kBq/mL for 225 Ac-DOTA-Nb on MDA-MB-231 cells. Ex vivo biodistribution studies, performed in mice bearing subcutaneous HER2-overexpressing and low HER2-expressing tumors, showed a fast uptake in SKOV-3 tumors compared to MDA-MB-231 (4.01 ± 1.58% ID/g vs 0.49 ± 0.20% ID/g after 2 h), resulting also in high tumor-to-normal tissue ratios. In addition, coinjection of 225 Ac-DOTA-Nb with Gelofusine reduced kidney retention by 70%. This study shows that 225 Ac-DOTA-Nb is a promising new radioconjugate for targeted α-particle therapy
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
Lifescience Database Archive (English)
Full Text Available quence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ... Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-val...ue - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Se
Lifescience Database Archive (English)
Full Text Available quence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ... Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-val...ue - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Se
International Journal of Biological and Chemical Sciences - Vol 11 ...
African Journals Online (AJOL)
West Africa) : perceptions and endogenous measures of adaptation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D.O. Bello, L.E. Ahoton, A Saidu, I.P.B. Akponikpe, V.A. Ezin, ...
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Wireless Telegraphic Communication. Guglielmo Marconi. Classics Volume 7 Issue 1 January 2002 pp 95-101. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/01/0095-0101 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 9. Spintronics - Principles. R Srinivasan. General Article Volume 10 Issue 9 September 2005 pp 53-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/09/0053-0062. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. Iterated Functions and Intermittency. V Balakrishnan. General Article Volume 6 Issue 1 January 2001 pp 18-27. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0018-0027 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 8. Justus Freiherr von Liebig. Gopalpur Nagendrappa. General Article Volume 18 Issue 8 August 2013 pp 691-711. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/08/0691-0711. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Ludwig Boltzmann and Entropy. Sriram Ramaswamy. Volume 10 Issue 12 December 2005 pp 176-178. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0176-0178. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 1. A Scientific Autobiography. Sushan Konar. Book Review Volume 21 Issue 1 January 2016 pp 89-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/01/0089-0092. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 9. Life at High Temperatures. Ramesh Maheshwari. General Article Volume 10 Issue 9 September 2005 pp 23-36. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/09/0023-0036. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Editorial / Associate Editor's Column. Alladi Sitaram. Editorial Volume 4 Issue 11 November 1999 pp 1-1. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/11/0001-0001. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. Editorial / Associate Editor's Column. Rajaram Nityananda. Editorial Volume 5 Issue 4 April 2000 pp 1-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/04/0001-0003. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 2. Editorial / Associate Editor's Column. Rajaram Nityananda. Editorial Volume 5 Issue 2 February 2000 pp 1-1. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/02/0001-0001. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Living Science Creatively. A Rajanikanth. Information and Announcements Volume 3 Issue 3 March 1998 pp 93-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0093-0094 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 1. Elements of Chemistry. Antoine-Laurent Lavoisier. Classics Volume 17 Issue 1 January 2012 pp 92-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/01/0092-0100. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 2. Communicating Information. K Viswanath. General Article Volume 7 Issue 2 February 2002 pp 26-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/02/0026-0032. Keywords. Entropy ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Chemistry of Colours. Jayanthi Chandrasekaran. General Article Volume 6 Issue 3 March 2001 pp 66-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0066-0075. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 9. Atomic Warrior. Shabhana Narasimhan. Book Review Volume 6 Issue 9 September 2001 pp 106-109. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/09/0106-0109. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 9. Polarography. V Lakshminarayanan. General Article Volume 9 Issue 9 September 2004 pp 51-61. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/09/0051-0061. Keywords. Polarography ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Physical Chemistry. Mohammed Farooq Ahmed. Book Review Volume 3 Issue 3 March 1998 pp 73-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0073-0075. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Turbulence and Flying Machines. Rama Govindarajan. General Article Volume 4 Issue 11 November 1999 pp 54-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/11/0054-0062 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 9. Sonya Vasilievna Krukovskaya (1850-1891). Featured Scientist Volume 1 Issue 9 September 1996 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/09/0098-0098. Resonance ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 10. Man and Natural Selection. Theodosius Dobzhansky. Reflections Volume 5 Issue 10 October 2000 pp 92-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/10/0092-0100 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 12. The Enigmatic Moon. Biman Nath. Book Review Volume 13 Issue 12 December 2008 pp 1173-1175. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/12/1173-1175. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. The Three Colour Problem. Dinoj Surendran. Classroom Volume 4 Issue 2 February 1999 pp 76-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0076-0081. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 11. Spintronics - Devices and Materials. R Srinivasan. General Article Volume 10 Issue 11 November 2005 pp 8-17. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/11/0008-0017. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Nuclear Science Centre. N Madhavan. Information and Announcements Volume 2 Issue 10 October 1997 pp 92-96. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0092-0096 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 7. Workshops on Writing Science. Information and Announcements Volume 22 Issue 7 July 2017 pp 718-718. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/07/0718-0718. Abstract ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Pollen Grains, Random Walks and Einstein. Sriram Ramaswamy. Volume 10 Issue 12 December 2005 pp 106-124. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0106-0124 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 11. Integration and Polar Coordinates. S Kesavan. General Article Volume 18 Issue 11 November 2013 pp 996-1003. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/11/0996-1003. Keywords.
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Radio Broadcast Technology. Harsh Vardhan. General Article Volume 7 Issue 1 January 2002 pp 53-63. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/01/0053-0063. Keywords. Hertzian ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 4. The Evolution of Diesel Engines. U Shrinivasa. General Article Volume 17 Issue 4 April 2012 pp 365-377. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/04/0365-0377. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 9. Hardy's “A Mathematician's Apology”. L J Mordell. Reflections Volume 3 Issue 9 September 1998 pp 83-89. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/09/0083-0089. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. Albert Einstein-The Man Behind the Myths. John Stachel. Reflections Volume 3 Issue 8 August 1998 pp 76-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0076-0092 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. High-Altitude Cirrus Clouds and Climate. S Veerabuthiran. General Article Volume 9 Issue 3 March 2004 pp 23-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0023-0032. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein and the Special Theory of Relativity. Supurna Sinha. Volume 10 Issue 12 December 2005 pp 96-105. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0096-0105 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 12. Introduction to Special Theory of Relativity. Sukanya Sinha. Book Review Volume 4 Issue 12 December 1999 pp 106-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/12/0106-0107 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Tinker, Builder, Physicist, and Teacher ! Prajval Shastri. Face to Face Volume 22 Issue 3 March 2017 pp 319-321. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/03/0319-0321. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 4. Chemistry Nobel Prize 2002 - Mass Spectrometry. M Vairamani. Research News Volume 8 Issue 4 April 2003 pp 69-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/04/0069-0076 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 3. Bessels contain Continued Fractions of Progressions. B Sury. Classroom Volume 10 Issue 3 March 2005 pp 80-87. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/03/0080-0087. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. Edwin Powell Hubble. Swara Ravindranath. Article-in-a-Box Volume 14 Issue 3 March 2009 pp 211-213. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/03/0211-0213. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 1. A Joyous Romp Through Basic Physics. V Balakrishnan. Book Review Volume 1 Issue 1 January 1996 pp 110-114. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/01/0110-0114 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Quantization of the Radiation Field. Avinash Khare. General Article Volume 8 Issue 8 August 2003 pp 10-16. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0010-0016. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 9. Entropy in Biology. Jayant B Udgaonkar. General Article Volume 6 Issue 9 September 2001 pp 61-66. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/09/0061-0066. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 7. Science - its Philosophy and Spirit. Hermann Bondi. Reflections Volume 1 Issue 7 July 1996 pp 82-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/07/0082-0095. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 8. Insect Detectives - Forensic Entomology. P K Sumodan. General Article Volume 7 Issue 8 August 2002 pp 51-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/08/0051-0058. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 4. The Origins of Science Thales' Leap. Gangan Prathap. Reflections Volume 1 Issue 4 April 1996 pp 67-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/04/0067-0073. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 9. Xylitol: A Sweetener with Special Qualities. Anil Lachke. Research News Volume 11 Issue 9 September 2006 pp 90-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/09/0090-0092 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 12. Mathematics and Sports. Vivek S Borkar. Book Review Volume 4 Issue 12 December 1999 pp 107-108. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/12/0107-0108. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 2. Electrostatics of Atoms and Molecules. G Narahari Sastry. Book Review Volume 7 Issue 2 February 2002 pp 90-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/02/0090-0091 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 1. Complex Numbers and Plane Geometry. Anant R Shastri. General Article Volume 13 Issue 1 January 2008 pp 35-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/01/0035-0053 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 12. The Wright Family. Roddam Narasimha. Article-in-a-Box Volume 8 Issue 12 December 2003 pp 5-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/12/0005-0005. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 2. Hydrotalcite - The Clay that Cures. N Bejoy. General Article Volume 6 Issue 2 February 2001 pp 57-61. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/02/0057-0061. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Very Long Instruction Word Processors. S Balakrishnan. General Article Volume 6 Issue 12 December 2001 pp 61-68. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0061-0068 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 5. Rotational Rectification of an Alternating Magnetic Field. N Kumar. Classroom Volume 18 Issue 5 May 2013 pp 458-467. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/05/0458-0467 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. Standard Weights and Measures. Vasant Natarajan. General Article Volume 6 Issue 8 August 2001 pp 44-59. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0044-0059. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Perkin's Mauve: The History of the Chemistry. Andrew Filarowski. Volume 16 Issue 12 December 2011 pp 1140-1145. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1140-1145 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 4. Cosmology, Mach's Principle and Relativity. R H Dicke. Classics Volume 16 Issue 4 April 2011 pp 372-391. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/04/0372-0391. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. On Science Education and Scientific Research. R K Varma. Volume 3 Issue 8 August 1998 pp 8-13. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0008-0013. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 8. Project Lifescape – An Invitation. Madhav Gadgil. Classroom Volume 4 Issue 8 August 1999 pp 80-90. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/08/0080-0090. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 1. Project Lifescape – Diseases:Paddy. R J Ranjit Daniels. Classroom Volume 5 Issue 1 January 2000 pp 93-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/01/0093-0100 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 1. Fermi and the Art of Estimation. Rajaram Nityananda. General Article Volume 19 Issue 1 January 2014 pp 73-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/019/01/0073-0081. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 1. International Physics Olympiad'98 – 1. Experiments. Saikat Guha. Classroom Volume 5 Issue 1 January 2000 pp 83-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/01/0083-0092 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 6. Drought Signaling in Plants. G Sivakumar Swamy. General Article Volume 4 Issue 6 June 1999 pp 34-44. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/06/0034-0044. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 1. Breaking Rules - Making Bonds. A G Samuelson. General Article Volume 21 Issue 1 January 2016 pp 43-48. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/01/0043-0048. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Wallace and Natural Selection, 1858. Sahotra Sarkar. General Article Volume 13 Issue 3 March 2008 pp 236-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/03/0236-0244. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 5. What is 'Natural' in Natural Selection? Abhijeet S Bardapurkar. Classroom Volume 18 Issue 5 May 2013 pp 475-482. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/05/0475-0482 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. Introduction to Game Theory. S Ramasubramanian. Book Review Volume 9 Issue 3 March 2004 pp 81-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0081-0081. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 8. The Age of Extinction. Prasanna Venkhatesh V. Book Review Volume 20 Issue 8 August 2015 pp 748-750. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/08/0748-0750. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 8. Prevent or Perish. Prasanna Venkhatesh V. Book Review Volume 20 Issue 8 August 2015 pp 750-752. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/08/0750-0752. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Physics Training and Talent Search. Information and Announcements Volume 23 Issue 2 February 2018 pp 244-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/023/02/0244-0244. Abstract ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy; Volume 34; Issue 1. General Editorial on Publication Ethics. Ram Sagar R. Ramaswamy N. Mukunda. Volume 34 Issue 1 March 2013 pp 1-2. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/joaa/034/01/0001-0002 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 7. Norms and the Conservation of Biodiversity. Sahotra Sarkar. General Article Volume 13 Issue 7 July 2008 pp 627-637. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/07/0627-0637 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 4. The Pursuit of Science : Its Motivations. S Chandrasekhar. Reflections Volume 2 Issue 4 April 1997 pp 82-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/04/0082-0095. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 9. The Concept of Experiment in Science. Samir Roy. Classroom Volume 1 Issue 9 September 1996 pp 72-74. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/09/0072-0074. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 12. The Nobel Prize in Physics - 1996. R Srinivasan. Research News Volume 1 Issue 12 December 1996 pp 65-68. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/12/0065-0068 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. On Teaching the Theory of Evolution. Rajkumar Radder. Classroom Volume 11 Issue 4 April 2006 pp 100-105. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/04/0100-0105. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 7. Teaching Chemistry through Riddles. Mala Das Sharma. Classroom Volume 9 Issue 7 July 2004 pp 74-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/07/0074-0076. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 11. IAP Statement on the Teaching of Evolution. Feature Article Volume 11 Issue 11 November 2006 pp 93-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/11/0093-0095. Resonance ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 5. Some Reminiscences of My Teaching Career. Arnold Sommerfeld. Classics Volume 20 Issue 5 May 2015 pp 472-475. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/05/0472-0475 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 11. Handbook of Solar Radiation Data for India. Anna Mani. Classics Volume 13 Issue 11 November 2008 pp 1082-1086. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/11/1082-1086 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 11. Can Light Travel Faster than Light? Supurna Sinha. Research News Volume 5 Issue 11 November 2000 pp 90-93. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/11/0090-0093 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. Imaging Sensors: Artificial and Natural. Vikram Dhar. General Article Volume 4 Issue 2 February 1999 pp 27-36. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0027-0036 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 5. Behavioural View of Language Acquisition. Rajeev Sangal. Book Review Volume 13 Issue 5 May 2008 pp 487-489. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/05/0487-0489 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. The Synthesis of Ammonia from its Elements. Fritz Haber. Classics Volume 7 Issue 9 September 2002 pp 86-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0086-0094 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 2. Cholesterol and Health. Pravina Piste Vidyadhar Patil. General Article Volume 11 Issue 2 February 2006 pp 74-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/02/0074-0077. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 2. Nature's Solar Cell. Stephen Suresh Gautham Nadig. Research News Volume 1 Issue 2 February 1996 pp 102-104. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/02/0102-0104 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 5. Discourses on Algebra. Rajaram Nityananda. Book Review Volume 22 Issue 5 May 2017 pp 509-511. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/05/0509-0511. Keywords. Discourses ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 5. Contributions of Maxwell to Electromagnetism. P V Panat. General Article Volume 8 Issue 5 May 2003 pp 17-29. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/05/0017-0029. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 2. Matrix Magic: Spin Half Systems. Kovid Goyal. Classroom Volume 8 Issue 2 February 2003 pp 76-79. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/02/0076-0079. Keywords. Quantum ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 4. Refresher Course in Earth System Science. Information and Announcements Volume 10 Issue 4 April 2005 pp 91-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/04/0091-0091 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 8. Reflections on Software Research. Dennis M Ritchie. Classics Volume 17 Issue 8 August 2012 pp 810-816. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/08/0810-0816. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. Game Theory - Conventions and Knowledge. P G Babu. General Article Volume 3 Issue 8 August 1998 pp 46-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0046-0055 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Vikram A Sarabhai. Mrinalini Sarabhai. Article-in-a-Box Volume 6 Issue 12 December 2001 pp 5-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0005-0007. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. The Theory of Positrons. Richard P Feynman. Classics Volume 2 Issue 12 December 1997 pp 107-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0107-0107. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. All about the Dirac Delta Function (?). V Balakrishnan. General Article Volume 8 Issue 8 August 2003 pp 48-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0048-0058. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 12. Mycorrhiza: The Oldest ... Babita Saha Siraj Datta. General Article Volume 21 Issue 12 December 2016 pp 1093-1104. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/12/1093-1104 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. Lightning Bugs. B Gajendra Babu M Kannan. General Article Volume 7 Issue 9 September 2002 pp 49-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0049-0055. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 5. How Many Equivalent Resistances? Sameen Ahmed Khan. General Article Volume 17 Issue 5 May 2012 pp 468-475. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/05/0468-0475 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 2. George Andrews' Game. Jerold Mathews. General Article Volume 14 Issue 2 February 2009 pp 172-178. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/02/0172-0178. Keywords. Fibonacci ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. The Isoperimetric Inequality. S Kesavan. General Article Volume 7 Issue 9 September 2002 pp 8-18. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0008-0018. Keywords. Isoperimetric ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 1. Life without Water. M K Chattopadhyay. General Article Volume 14 Issue 1 January 2009 pp 60-65. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/01/0060-0065. Keywords. Anhydrobiosis ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. Fermat's Two Squares Theorem Revisited. Bhaskar Bagchi. General Article Volume 4 Issue 7 July 1999 pp 59-67. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/07/0059-0067 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 3. On Fermat's Two-Square Theorem. Shailesh A Shirali. Classroom Volume 2 Issue 3 March 1997 pp 69-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/03/0069-0073. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 7. Fermat: A Versatile Genius. Utpal Mukhopadhyay. General Article Volume 16 Issue 7 July 2011 pp 648-662. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/07/0648-0662. Keywords. Fermat ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Chromatography – An Educational Tool. Rekha Rajiv Vartak. Classroom Volume 6 Issue 5 May 2001 pp 83-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0083-0091 ...
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
Astronomy and Computing: A New Journal for the Astronomical Computing Community
Mann, R.G.; Accomazzi, A.; Budavári, T.; Fluke, C.; Gray, N.; O'Mullane, W.; Wicenec, A.; Wise, M.
2013-01-01
We introduce Astronomy and Computing (A&C), a new, peer-reviewed journal for the expanding community of people whose work focuses on the application of computer science and information technology within astronomy, rather than on astronomical research per se. A&C arose from a BoF discussion at the
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 6. Life and Times of Bourbaki. C S Yogananda. Book Review Volume 20 Issue 6 June 2015 pp 556-559. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/06/0556-0559. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. Florence Jessie MacWilliams (1917-1990). Priti Shankar. Article-in-a-Box Volume 10 Issue 1 January 2005 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/01/0002-0003 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 1. Do Trees Tell About the Past? H S Suresh. General Article Volume 17 Issue 1 January 2012 pp 33-43. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/01/0033-0043. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 11. Francis Crick (1916-2004). S Mahadevan. Article-in-a-Box Volume 9 Issue 11 November 2004 pp 3-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/11/0003-0007. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. Special Relativity – An Exoteric Narrative. S R Madhu Rao. Classroom Volume 3 Issue 5 May 1998 pp 63-72. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0063-0072. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 7. Chelates for Micronutrient Nutrition among Crops. B S Sekhon. General Article Volume 8 Issue 7 July 2003 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/07/0046-0053. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 6. Waring's Problem and the Circle Method. C S Yogananda. General Article Volume 9 Issue 6 June 2004 pp 51-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/06/0051-0055. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. Prafulla Chandra Rây. Animesh Chakravorty. Article-in-a-Box Volume 6 Issue 1 January 2001 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0003-0005. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Gödel's Explorations in Terra Incognita. Vijay Chandru. General Article Volume 6 Issue 7 July 2001 pp 22-28. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/07/0022-0028. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 2. On How to Arrange Infinitely many Marriages! B Sury. Classroom Volume 6 Issue 2 February 2001 pp 71-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/02/0071-0073. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Which way does the Flame Point? Jaywant H Arakeri. Classroom Volume 6 Issue 5 May 2001 pp 79-82. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0079-0082. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. A Course in Number Theory and Cryptology. Rajat Tandon. Book Review Volume 6 Issue 6 June 2001 pp 91-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0091-0094 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 5. The Indian Institute of Science: Marking a Centenary. P Balaram. General Article Volume 14 Issue 5 May 2009 pp 416-429. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/05/0416-0429 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. A Student Experiment on Photochromism. Arati Tripathi S V Eswaran. Classroom Volume 6 Issue 8 August 2001 pp 90-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0090-0092 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 4. What's New in Computers? Digital Libraries. T B Rajashekar. Feature Article Volume 2 Issue 4 April 1997 pp 60-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/04/0060-0073 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 6. Algebra in Ancient and Modern Times. K B Sinha. Book Review Volume 3 Issue 6 June 1998 pp 80-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/06/0080-0081. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 10. The Story of Nuclear Matter. R Rajaraman. General Article Volume 10 Issue 10 October 2005 pp 8-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/10/0008-0032. Keywords. Nuclear ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 12. Darshana Jolts - The Physical World – 1. V V Raman. Reflections Volume 15 Issue 12 December 2010 pp 1132-1141. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/12/1132-1141 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 7. The Present Concept of the Physical World. Homi Jehangir Bhabha. Reflections Volume 3 Issue 7 July 1998 pp 81-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/07/0081-0091 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. Project Lifescape – Freshwater Fishes: Catfishes. R J Ranjit Daniels. Classroom Volume 5 Issue 4 April 2000 pp 97-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/04/0097-0107 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. Preparing for the Transit of Venus. N Rathnasree Sanat Kumar. Classroom Volume 9 Issue 3 March 2004 pp 65-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0065-0075. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 7. Memory as a Life - Walking down Memory Lanes. S Krishnaswamy. Book Review Volume 1 Issue 7 July 1996 pp 79-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/07/0079-0081 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 1. Norbert Wiener and Control Engineering. Vivek S Borkar. Article-in-a-Box Volume 4 Issue 1 January 1999 pp 3-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/01/0003-0004 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 1. Impressions of the 37th IMO 96. Ajay C Ramdoss. Classroom Volume 2 Issue 1 January 1997 pp 60-64. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/01/0060-0064. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Expert Systems : An Introduction. K S R Anjaneyulu. General Article Volume 3 Issue 3 March 1998 pp 46-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0046-0058. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. Lagrange and Classical Mechanics. N Mukunda. Article-in-a-Box Volume 11 Issue 4 April 2006 pp 5-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/04/0005-0007. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 7. Inverting Matrices Constructed from Roots of Unity. A John Wilson. Classroom Volume 11 Issue 7 July 2006 pp 70-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/07/0070-0076 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 6. Chemistry Behind the Life of a Transformer. Rashmi Sanghi. General Article Volume 8 Issue 6 June 2003 pp 17-23. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/06/0017-0023. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 1. The Legend of Louis Pasteur. S Mahadevan. General Article Volume 12 Issue 1 January 2007 pp 15-22. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/01/0015-0022. Keywords. Pasteur ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 10. GNR – A Tribute. D Balasubramanian. Article-in-a-Box Volume 6 Issue 10 October 2001 pp 2-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/10/0002-0004. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. Learning from a Sea Snail: Eric Kandel. Rohini Balakrishnan. Research News Volume 6 Issue 6 June 2001 pp 86-90. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0086-0090 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 12. Isaac Newton (1642/43-1727). Bikram Phookun. Article-in-a-Box Volume 11 Issue 12 December 2006 pp 3-6. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/12/0003-0006 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 5. TIFRAC, India's First Computer - A Retrospective. P V S Rao. General Article Volume 13 Issue 5 May 2008 pp 420-429. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/05/0420-0429 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Wollemi Pine: Living Fossil from Jurassic Landscape. N S Leela. General Article Volume 8 Issue 8 August 2003 pp 43-47. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0043-0047 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 11. Where Are All the Typical Numbers–2. B V Rao. General Article Volume 16 Issue 11 November 2011 pp 1029-1038. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/11/1029-1038 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. What is New in Computers? - Mobile Computing. L M Patnaik. Feature Article Volume 3 Issue 5 May 1998 pp 48-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0048-0062 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 4. Chief Editor's column / Science Smiles. R K Laxman. Science Smiles Volume 1 Issue 4 April 1996 pp 4-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/04/0004-0004. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 9. The Bakhshāli Square Root Formula. Shailesh A Shirali. General Article Volume 17 Issue 9 September 2012 pp 884-894. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/09/0884-0894 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 8. A Taste of Functional Programming – I. Madhavan Mukund. General Article Volume 12 Issue 8 August 2007 pp 27-48. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/08/0027-0048 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Biodiversity – A Manual for College Teachers. N S Leela. Book Review Volume 2 Issue 10 October 1997 pp 80-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0080-0081 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 5. The Indian Monsoon - Physics of the Monsoon. Sulochana Gadgil. Series Article Volume 12 Issue 5 May 2007 pp 4-20. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/05/0004-0020 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 3. The Story of Fermat's Last Theorem. Shailesh A Shirali. Book Review Volume 4 Issue 3 March 1999 pp 81-84. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/03/0081-0084. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 7. A Course on Integration Theory. B J Venkatachala. Book Review Volume 2 Issue 7 July 1997 pp 93-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/07/0093-0094. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Chemistry of Materials - A Letter to a Young Friend. C N R Rao. Volume 16 Issue 12 December 2011 pp 1110-1119. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1110-1119 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. On Kepler's First Law - The Law of Ellipses. Shailesh A Shirali. General Article Volume 3 Issue 5 May 1998 pp 30-42. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0030-0042 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Paul Erdös, the Western Ramanujan. C S Yogananda. Article-in-a-Box Volume 3 Issue 3 March 1998 pp 2-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0002-0004. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 1. Role of Wind Tunnels in Aircraft Design. S P Govinda Raju. General Article Volume 8 Issue 1 January 2003 pp 72-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/01/0072-0076. Keywords.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. Henrietta Leavitt – A Bright Star of Astronomy. Biman Nath. Article-in-a-Box Volume 6 Issue 6 June 2001 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0002-0003 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. Galileo Galilei: Father of Modern Science. C S Yogananda. Article-in-a-Box Volume 6 Issue 8 August 2001 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0003-0005 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Why did I opt for Career in Science? Jayant V Narlikar. Personal Reflections Volume 6 Issue 3 March 2001 pp 90-93. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0090-0093 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Paul Adrien Maurice Dirac –An Appreciation. N Mukunda. Article-in-a-Box Volume 8 Issue 8 August 2003 pp 3-6. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0003-0006 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 4. Gender in Plants Why Do Plants Change Sex? Renee M Borges. General Article Volume 3 Issue 4 April 1998 pp 64-71. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/04/0064-0071 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. The Football - From Euclid to Soccer it is... A R Rao. General Article Volume 6 Issue 1 January 2001 pp 28-41. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0028-0041. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. Erwin Schrödinger – A Sketch. Virendra Singh. Article-in-a-Box Volume 4 Issue 2 February 1999 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0003-0005. Author Affiliations.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 6. Head-on Collision of Two Balls Revisited. Umapati Pattar A W Joshi. Classroom Volume 7 Issue 6 June 2002 pp 67-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/06/0067-0077 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 11. Stephen Jay Gould: A View of Life. Renee M Borges. Article-in-a-Box Volume 7 Issue 11 November 2002 pp 2-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/11/0002-0005 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 11. On Parallel Computing – Indian Trends. U N Sinha. Article-in-a-Box Volume 3 Issue 11 November 1998 pp 2-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/11/0002-0005 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. What are the shapes of the f - orbitals. K L Sebastian. Think It Over Volume 2 Issue 12 December 1997 pp 88-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0088-0091 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 5. The Meaning of Integration – II. A K Nandakumaran. General Article Volume 9 Issue 5 May 2004 pp 41-50. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/05/0041-0050. Keywords. Riemann ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 3. Interactions and Mergers of Galaxies. S M Alladin S N Hasan. General Article Volume 12 Issue 3 March 2007 pp 13-26. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/03/0013-0026 ...
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Journal of Language, Technology & Entrepreneurship in Africa ...
African Journals Online (AJOL)
... the Editor at firaki@usiu.ac.ke as email attachment for consideration at any time. ... The journal is a property of the United States International University. ... Use double quotation marks for short quotes but place longer quotes in an indented
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Life and Work of Kurt Gödel – A Brief Sketch. S M Srivastava. Article-in-a-Box Volume 6 Issue 7 July 2001 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/07/0002-0003 ...
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Zhou, Tian-Biao; Guo, Xue-Feng; Jiang, Zongpei; Li, Hong-Yan
2015-12-01
The following article has been included in a multiple retraction: Tian-Biao Zhou, Xue-Feng Guo, Zongpei Jiang, and Hong-Yan Li Relationship between the ACE I/D gene polymorphism and T1DN susceptibility/risk of T1DM developing into T1DN in the Caucasian population Journal of Renin-Angiotensin-Aldosterone System 1470320314563425, first published on February 1, 2015 doi: 10.1177/1470320314563425 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Since January 2016, the Journal of Astrophysics and Astronomy has moved to Continuous Article Publishing (CAP) mode. This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1. Articles are also visible in Web of Science immediately.
Final PHP bench-scale report for the DOE-ID/SAIC sole source contract
International Nuclear Information System (INIS)
1997-04-01
The Plasma Hearth Process (PHP) Technology Development Project was established to develop, test, and evaluate a new concept for treating mixed waste. The new concept uses direct current (dc) transferred-arc plasma torch technology to process mixed waste into a glass-like end-product. Under the cognizance of the US Department of Energy (DOE) Office of Technology Development (OTD) Mixed Waste Focus Area (MWFA), the technology is being explored for its potential to treat mixed waste. Because it is a mature technology, well-understood and commercially available, it is expected to develop rapidly in this new application. This report summarizes the radioactive bench-scale system activities funded under PHP Sole Source Contract DE-AC07-94ID13266 through the end of the contract
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
Lifescience Database Archive (English)
Full Text Available rEMBL tr_hit_id Q1L0Q7 Definition tr|Q1L0Q7|Q1L0Q7_BOEDR At3g12490-like protein OS=Boechera drummondii Align... producing significant alignments: (bits) Value tr|Q1L0Q7|Q1L0Q7_BOEDR At3g12490-like protein OS=Boechera drummo...3g12490-like protein OS=Boechera drummondii PE=4 SV=1 Length = 231 Score = 188 bits (477), Expect = 3e-46 Id
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
Zhong, Weiqiang; Jiang, Zongpei; Zhou, Tian-Biao
2015-12-01
This article has been included in a multiple retraction: Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10.1177/1470320314566019 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Since January 2016, the Journal of Astrophysics and Astronomy has moved to Continuous Article Publishing (CAP) mode. This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1. Articles are also visible in Web of Science ...
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available 4. 5' end sequence. DK953406 CL390Contig1 Show DK953406 Clone id TST39A01NGRL0017_K24 Library TST39 Length 5...83 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_K24. 5' end sequence. Accession DK953406...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953406...ids Res. 25:3389-3402. Query= DK953406|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_K24, 5' (583
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
All correspondence regarding subscription within India should be addressed to the Circulation Department, Indian Academy of Sciences, at the address below, or by e-mail to orders@ias.ac.in. See the Academy journals page for the latest subscription information (PDF file) and 2018 subscription prices (Library, Personal).
Lifescience Database Archive (English)
Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Journal of Earth System Science; Volume 127; Issue 3. Pedotransfer functions to estimate soil water content at field capacity and permanent wilting point in hot Arid Western India. Priyabrata Santra Mahesh Kumar R N Kumawat D K Painuli K M Hati G B M Heuvelink N H Batjes. Volume 127 Issue 3 April 2018 Article ID 35 ...
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
Lifescience Database Archive (English)
Full Text Available 5. 5' end sequence. DK954065 CL168Contig1 Show DK954065 Clone id TST39A01NGRL0019_H05 Library TST39 Length 6...25 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_H05. 5' end sequence. Accession DK95406... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95406...ids Res. 25:3389-3402. Query= DK954065|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_H05, 5' (625 ...TST39A01NGRL0019_H05 625 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_H0
Lifescience Database Archive (English)
Full Text Available 4. 5' end sequence. DK948015 CL1717Contig1 Show DK948015 Clone id TST38A01NGRL0002_C24 Library TST38 Length ...543 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_C24. 5' end sequence. Accession DK94801...ids Res. 25:3389-3402. Query= DK948015|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0002_C24, 5' (486 ...TST38A01NGRL0002_C24 543 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_C2...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
Lifescience Database Archive (English)
Full Text Available YMU02A01NGRL0015_K22 477 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_K2...2. 5' end sequence. DK947373 - Show DK947373 Clone id YMU02A01NGRL0015_K22 Library YMU02 Length 477 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_K22. 5' end sequence. Accession DK947373 Tissue t...t (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P17673 Definition sp|P17673...ams, Nucleic Acids Res. 25:3389-3402. Query= DK947373|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL001
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Energy Technology Data Exchange (ETDEWEB)
Essler, Markus; Gaertner, Florian C.; Blechert, Birgit; Senekowitsch-Schmidtke, Reingard; Seidl, Christof [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Neff, Frauke [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)
2012-04-15
Targeted delivery of alpha-particle-emitting radionuclides is a promising novel option in cancer therapy. We generated stable conjugates of the vascular tumour-homing peptide F3 both with {sup 225}Ac and {sup 213}Bi that specifically bind to nucleolin on the surface of proliferating tumour cells. The aim of our study was to determine the therapeutic efficacy of {sup 225}Ac-DOTA-F3 in comparison with that of {sup 213}Bi-DTPA-F3. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were determined via clonogenic assays. The therapeutic efficacy of both constructs was assayed by repeated treatment of mice bearing intraperitoneal MDA-MB-435 xenograft tumours. Therapy was monitored by bioluminescence imaging. Nephrotoxic effects were analysed by histology. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were 53 kBq/ml and 67 Bq/ml, respectively. The median survival of control mice treated with phosphate-buffered saline was 60 days after intraperitoneal inoculation of 1 x 10{sup 7} MDA-MB-435 cells. Therapy with 6 x 1.85 kBq of {sup 225}Ac-DOTA-F3 or 6 x 1.85 MBq of {sup 213}Bi-DTPA-F3 prolonged median survival to 95 days and 97 days, respectively. While F3 labelled with short-lived {sup 213}Bi (t{sub 1/2} 46 min) reduced the tumour mass at early time-points up to 30 days after treatment, the antitumour effect of {sup 225}Ac-DOTA-F3 (t{sub 1/2} 10 days) increased at later time-points. The difference in the fraction of necrotic cells after treatment with {sup 225}Ac-DOTA-F3 (43%) and with {sup 213}Bi-DTPA-F3 (36%) was not significant. Though histological analysis of kidney samples revealed acute tubular necrosis and tubular oedema in 10-30% of animals after treatment with {sup 225}Ac-DOTA-F3 or {sup 213}Bi-DTPA-F3, protein casts were negligible (2%), indicating only minor damage to the kidney. Therapy with both {sup 225}Ac-DOTA-F3 and {sup 213}Bi-DTPA-F3 increased survival of mice with peritoneal carcinomatosis. Mild renal toxicity of both
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
Lifescience Database Archive (English)
Full Text Available s-Prot sp_hit_id P09992 Definition sp|P09992|NCAP_LYCVA Nucleoprotein OS=Lymphocytic choriomeningitis virus ...riomeningit... 29 8.4 >sp|P09992|NCAP_LYCVA Nucleoprotein OS=Lymphocytic choriomeningitis
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
https://www.ias.ac.in/article/fulltext/reso/008/07/0022-0032. Keywords. Birds. nesting. territory; coloniality; heronries. ecology; nesting strategies. Author Affiliations. Abdul Jamil Urfi1. Department of Environmental Biology, School of Environmental Studies, University of Delhi, Delhi 110007. Resonance – Journal of Science ...
Improvement of the ID model for quantitative network data
DEFF Research Database (Denmark)
Sørensen, Peter Borgen; Damgaard, Christian Frølund; Dupont, Yoko Luise
2015-01-01
Many interactions are often poorly registered or even unobserved in empirical quantitative networks. Hence, the output of the statistical analyses may fail to differentiate between patterns that are statistical artefacts and those which are real characteristics of ecological networks. Such artefa......Many interactions are often poorly registered or even unobserved in empirical quantitative networks. Hence, the output of the statistical analyses may fail to differentiate between patterns that are statistical artefacts and those which are real characteristics of ecological networks......)1. This presentation will illustrate the application of the ID method based on a data set which consists of counts of visits by 152 pollinator species to 16 plant species. The method is based on two definitions of the underlying probabilities for each combination of pollinator and plant species: (1), pi...... reproduce the high number of zero valued cells in the data set and mimic the sampling distribution. 1 Sørensen et al, Journal of Pollination Ecology, 6(18), 2011, pp129-139...
Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W
2016-09-01
Is inhibitor of DNA-binding protein 2 (ID2) a mediator of the transforming growth factor (TGF)-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis? The TGF-β1-induced changes in the metabolic phenotype of peritoneal mesothelial cells from women with endometriosis are mediated through the ID2 pathway. TGF-β1 induces the metabolic conversion of glucose to lactate via aerobic glycolysis (the 'Warburg effect') in the peritoneum of women with endometriosis, through increased expression of the transcription factor hypoxia inducible factor α (HIF-1α). ID proteins are transcriptional targets of TGF-β1. Expression of ID2 was investigated in luteal phase peritoneal biopsies from women with regular menstrual cycles, with and without endometriosis (n = 8-10 each group) by quantitative RT-PCR (qRT-PCR) and immunohistochemistry. ID2 mRNA expression in primary human peritoneal mesothelial cells (HPMC) and immortalized mesothelial cells (MeT-5A) was assessed by qRT-PCR (n = 6). The effects of TGF-β1 and ID2 siRNA on HIF-1α mRNA expression and lactate secretion was assessed using qRT-PCR and a colorimetric lactate assay. ID2 is localized to peritoneal mesothelial and stromal cells of women with and without endometriosis. ID2 mRNA expression is lower in peritoneum adjacent to the endometriosis lesions compared to distal sites (P endometriosis. None. This work was funded by a Wellbeing of Women research grant (R42533) awarded to A.W.H., J.K.B. and W.C.D.; and an MRC Centre Grant G1002033. V.J.Y. received grant support from Federation of Women Graduates (134225) and a PhD studentship from the College of Medicine and Veterinary Medicine at the University of Edinburgh. There are no competing interests to declare. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Lifescience Database Archive (English)
Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result ...: TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available inition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEM...BL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : ...TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result :... TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ion - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (...No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL... (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available inition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEM...BL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available efinition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : Tr...EMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available ion - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (...No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available d - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result... : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Lifescience Database Archive (English)
Full Text Available finition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrE...MBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
Lifescience Database Archive (English)
Full Text Available ot sp_hit_id Q65ZG0 Definition sp|Q65ZG0|GN_VZVD Glycoprotein N OS=Varicella-zoster virus (strain Dumas... OS=Varicella-zoster virus (strain Dumas) GN=GN PE=3 SV=1 Length = 87 Score = 28.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
Impedance and ac conductivity studies of Ba (Pr1/2Nb1/2) O3 ceramic
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 36; Issue 4. Impedance and a.c. conductivity studies of ... Abstract. Impedance and electrical conduction studies of Ba(Pr1/2Nb1/2)O3 ceramic prepared through conventional ceramic fabrication technique are presented. The crystal symmetry, space group and unit cell ...
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
In Vitro Conservation of Sweet Potato Genotypes
Directory of Open Access Journals (Sweden)
Maria de Fátima Arrigoni-Blank
2014-01-01
Full Text Available The aim of this study was to develop a protocol for the in vitro conservation of sweet potato genotypes using the slow growth technique. The first experiment was conducted in a 4×5×2 factorial scheme, testing four genotypes (IPB-007, IPB-052, IPB-072, and IPB-137, five concentrations of abscisic acid (ABA (0.0, 1.0, 2.0, 4.0, and 8.0 mg·L−1, and two temperatures (18 and 25°C. The second experiment was conducted in a 4×3×3 factorial scheme at 18°C, testing four genotypes (IPB-007, IPB-052, IPB-072, and IPB-137, three variations of MS salts (50, 75, and 100%, and three concentrations of sucrose (10, 20, and 30 g·L−1. Every three months, we evaluated the survival (%, shoot height, and shoot viability. In vitro conservation of the sweet potato genotypes IPB-052 and IPB-007 was obtained over three and six months, respectively, using MS medium plus 2.0 mg·L−1 of ABA at either 18 or 25°C. Genotypes IPB-072 and IPB-137 can be kept for three and six months, respectively, in MS medium without ABA at 18°C. It is possible to store IPB-052 and IPB-072 for six months and IPB-007 and IPB-137 for nine months using 30 g·L−1 of sucrose and 50% MS salts.
Lifescience Database Archive (English)
Full Text Available ot sp_hit_id Q6XNL5 Definition sp|Q6XNL5|RDRP_MRNV RNA-directed RNA polymerase OS=Macrobrachium rosenbergii ...ge factor 6 O... 30 8.9 >sp|Q6XNL5|RDRP_MRNV RNA-directed RNA polymerase OS=Macrobrachium rosenberg
Lifescience Database Archive (English)
Full Text Available TrEMBL tr_hit_id B8CKP7 Definition tr|B8CKP7|B8CKP7_9GAMM Putative uncharacterized protein OS=Shewanella piezo...B8CKP7|B8CKP7_9GAMM Putative uncharacterized protein OS=Shewanella piezotolerans
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB886 (Link to dictyBase) - - - Contig-U16382-1 VFB886E (Link...) Clone ID VFB886 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...t alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 2234 0.0 1 AC116957 |AC116957.2 Dict...4, complete sequence. 2107 0.0 3 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 2034 0.0 1 AC115579 |AC115579.2 Dict...4 0.0 2 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer
Directory of Open Access Journals (Sweden)
Phuc Thinh Doan
2013-06-01
Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43
Lifescience Database Archive (English)
Full Text Available sp_hit_id P09311 Definition sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas...1.6 OS=C... 30 8.2 >sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas
Lifescience Database Archive (English)
Full Text Available t_id B2AIZ9 Definition tr|B2AIZ9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain...Z9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain R1
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25
Lifescience Database Archive (English)
Full Text Available Swiss-Prot sp_hit_id P09287 Definition sp|P09287|UL25_VZVD Virion gene 34 protein OS=Varicella-zoster virus (strain Dumas...in 47 O... 30 8.7 >sp|P09287|UL25_VZVD Virion gene 34 protein OS=Varicella-zoster virus (strain Dumas) GN=34
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Lifescience Database Archive (English)
Full Text Available t_id B5JPY8 Definition tr|B5JPY8|B5JPY8_9BACT Helix-turn-helix domain protein OS=Verrucomicrobiae bacterium ...5JPY8_9BACT Helix-turn-helix domain protein OS=Verrucomicrobiae bacterium DG1235 GN=VDG1235_3181 PE=4 SV=1 L
Institute of Scientific and Technical Information of China (English)
姜燕梅; 郭晓芳; 王曙明; 刘承军; 陈鑫
2012-01-01
Based on the advertising operation experience of Journal of HV & AC, this paper presents in detail the application of new media such as mobile phone messages, websites, microblogs and so on in the advertising operation of sci-tech journals.%以《暖通空调》为例,结合广告经营实践经验,介绍手机短信、网站、微博等新媒体形式在科技期刊广告经营中的运用。
Directory of Open Access Journals (Sweden)
Nura ,
2016-02-01
Full Text Available ABSTRACTCommercial varieties of chili is still susceptible to anthracnose disease. Anthracnose is one of diseases which caused yield loss about 10-80% in rainy season and 2-35% in dry season. One of the disease control method is to develop new varieties resistant to anthracnose through gamma-ray irradiation. This research was aimed to determine radiosensitivity level and heritability of chili which generated by mutation inductions of three genotypes: IPB C2, IPB C10, and IPB C15. Seed of the three genotypes were irradiated by gamma rays at dosages of 100, 200, 300, 400, 500, 600, 700, 800, 900 and 1,000 Gy. The LD50 in IPB C2, IPB C10, and IPB C15 were 317.9, 591.4, and 538.8 Gy, respectively. The character of IPB C2 mutants ranged between very susceptible to resistant against anthracnose disease, IPB C10 tended to very susceptible to highly resistant, and genotype IPB C15 tended to susceptible to highly resistant. Genotype IPB C2 had high level in heritability for disease resistance character, while medium level in heritability value was obtained on genotype IPB C10 and IPB C15.Keywords: genotype, LD50, mutant, mutation, seed
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
Lifescience Database Archive (English)
Full Text Available Result : TrEMBL tr_hit_id Q2VJ73 Definition tr|Q2VJ73|Q2VJ73_9ENTR Zeaxanthin glucosyl transferase OS=Enterobacteriaceae...r|Q2VJ73|Q2VJ73_9ENTR Zeaxanthin glucosyl transferase OS=Enterobacteriaceae bacterium DC416 GN=crtX PE=4 SV=
Lifescience Database Archive (English)
Full Text Available L + R+ID G Sbjct: 451 PRTRFGAFARGAKVVLYTKKSGAHLRIIDGG 481 >sp|Q9NQ79|CRAC1_HUMAN Cartilage acidic protein 1 OS=Homo sapiens GN=CRTAC1...ovel protein similar to H.sapiens CRTAC1... 146 1e-33 tr|B6MKC0|B6MKC0_BRAFL Putative uncharacterized protei
Lifescience Database Archive (English)
Full Text Available : Swiss-Prot sp_hit_id O13798 Definition sp|O13798|CID16_SCHPO Caffeine-induced p...uences producing significant alignments: (bits) Value sp|O13798|CID16_SCHPO Caffeine...nucleotidase surE OS=Janthinobacterium s... 29 8.2 >sp|O13798|CID16_SCHPO Caffeine-induced protein 16 OS=Sch
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
2010-06-01
and Commitment and Their Relationships to Turnover Intention: Does Organizational Heirarchy Matter?‖ Journal of Organizational Behaviour 27, no. 5...For the practical consumer , John Balmer, Guillaume Soenen, and Stephen Greyser acted on this premise to produce the trademarked AC2ID test, focused...television advertising, following the trail the Army so famously blazed with its ―Be All You Can Be‖ jingle in 1981.50 Use of the medium of television
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Lifescience Database Archive (English)
Full Text Available Link to BlastX Result : TrEMBL tr_hit_id Q8HXU8 Definition tr|Q8HXU8|Q8HXU8_CABUN Alpha adrenergic receptor 2B (Fragment) OS=Cabasso...Alpha adrenergic receptor 2B (Fragment) OS=Cabassous unicinctus GN=adra2B PE=3 SV=1 Length = 383 Score = 32.
Lifescience Database Archive (English)
Full Text Available Gamma-enolase OS=Gallus gallus GN=ENO2 PE=2... 55 2e-09 sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python regius...FEFFMD 79 E+ID A Y + +I +DVAA EF+ D Sbjct: 229 EAIDKAGYTDKIVIGMDVAASEFYRD 254 >sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python
Lifescience Database Archive (English)
Full Text Available r_hit_id A3U3S0 Definition tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola bats...0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola batsensis HTCC2597 GN=OB2597_03684 PE=4 SV=1 L
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict
Agallamh Oisín agus Phádraig: léamha ón bparaitéacs
Directory of Open Access Journals (Sweden)
Síle Ní Mhurchú
2016-10-01
Full Text Available San aiste seo, baintear úsáid as coincheap an pharaitéacs le Gérard Genette chun anailís a dhéanamh ar na cóipeanna lámhscríbhinne d’Agallamh Oisín agus Phádraig. Léiríonn na paraitéacsanna seo go raibh níos mó i gceist le saothar an scríobhaí ná cóipeáil: rinne mórán acu machnamh dian ar an ábhar a bhí á scríobh acu agus thugadar freagra ar ghluaiseachtaí stairiúla agus intleachtúla a bhí ag dul i bhfeidhm orthu ina gcuid scríbhinní paraitéacsúla. Féachtar ar na hathruithe a rinneadh ar chur i láthair na dtéacsanna le himeacht na mblianta agus ar na scríbhinní paraitéacsúla éagsúla — teidil, réamhráite, gluaiseanna, aistriúcháin, agus téacsanna eile nach iad — a cuireadh leis an Agallamh. Thug an paraitéacs spás do scríobhaithe inar fhéad siad dul i gcion ar phátrúin agus ar léitheoirí eile agus is iad seo a leanas na príomhthéamaí a eascraíonn ó anailís ar pharaitéacsanna an Agallaimh: cuntais na scríobhaithe ar cheird na scríbhneoireachta; athruithe i leagan amach na dtéacsanna faoi thionchar an chlóphreasa; an Béarla sa pharaitéacs; tagairtí do shaothar James Macpherson; meath na Gaeilge. Ar deireadh, fiafraítear an dtugann na scríbhinní paraitéacsúla léargas dúinn ar na mothúcháin a mhúscail an tAgallamh ina léitheoirí agus ina éisteoirí.
Journal de la Recherche Scientifique de l'Université de Lomé
African Journals Online (AJOL)
Journal de la Recherche Scientifique de l'Universite de Lome. ... B.A.K. Dossa, V.J. Mama, S Karimou, A.C. Mamam-Djibril, T Houetchegnon, I Toko .... des facteurs de risque cardiovasculaire et de cancer dans l'aire sanitaire de Zowla au Togo ...
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
Directory of Open Access Journals (Sweden)
Mirnawati Bachrum Sudarwanto
2017-01-01
Full Text Available Sub-clinical mastitis causes decrease in milk production and milk quality. It is not only happen tomilking dairies, but also happens to dairy buffalos and goats. The objective of this study is to know thedifferences between IPB-1 mastitis test (IMT and Breed method to diagnose sub-clinical mastitis ondairy buffaloes and goats. Fourty two samples of buffalo’s milk and 20 samples of goat’s milk were used tosomatic cell count (SCC with direct and indirect method. Direct method was performed by counting themilk’s SCC with Breed method, and indirect method was performed by observing the reaction betweenIMT reagent and milk. The results showed that 28 from 42 samples (66.67% of buffalo’s milk and 13 from20 samples (65% of goat’s milk tested with Breed method came from the herds which suffered from subclinicalmastitis and 27 from 42 samples (64.28% and 10 from 20 samples (50% of goat’s milk testedwith IMT showed positive reaction. This research also showed that IMT has sensitivity of 96% and specivicityof 100% for buffalo’s milk and sensitivity of 71% and specivicity of 100% for goat’s milk. IMT can be usedto obtain fast result for sub-clinical mastitis diagnosis and it is faster and easier for buffalo’s and goat’smilk.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Lifescience Database Archive (English)
Full Text Available lastX Result : TrEMBL tr_hit_id B8CPG2 Definition tr|B8CPG2|B8CPG2_9GAMM Exporter of the RND superfamily OS=Shewanella piezo...acterized protein OS=Trich... 34 4.2 >tr|B8CPG2|B8CPG2_9GAMM Exporter of the RND superfamily OS=Shewanella piezo
Lifescience Database Archive (English)
Full Text Available e 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP... E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP ...na GN=CAT1... 79 5e-15 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 90
Lifescience Database Archive (English)
Full Text Available sults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP........................done Score E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP...TA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 248 2e-65 >sp|O24339|CATA_SOLAP Ca
Lifescience Database Archive (English)
Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB770 (Link to dictyBase) - - - Contig-U16382-1 VFB770E (Link...) Clone ID VFB770 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyosteliu...m discoideum gene for actin A8. 2230 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 16...deum actin 15 gene, complete cds. 2030 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB524 (Link to dictyBase) - - - Contig-U14169-1 VFB524Z (Link... to Original site) - - VFB524Z 233 - - - - Show VFB524 Library VF (Link to library) Clone ID VFB524 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14169-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dict... cds. 40 0.81 2 Z70204 |Z70204.1 Caenorhabditis elegans cosmid C11G6. 40 2.7 2 AC117176 |AC117176.2 Dictyost
Lifescience Database Archive (English)
Full Text Available 06_9POAL NADH dehydrogenase subunit B OS=Danthonia... 118 2e-25 tr|O03150|O03150_OSMCL NdhB protein (Fragment) OS=Osmunda clay...n (Fragment) OS=Osmunda claytoniana GN=ndhB PE=2 SV=1 Length = 148 Score = 117 bits (294), Expect = 2e-25 Id...QMYNSPG--ISIALIFITVGLGFKLSLAPFHQWTPDVYEGS 242 >tr|O03150|O03150_OSMCL NdhB protei
Lifescience Database Archive (English)
Full Text Available hit_id Q306W7 Definition sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (s...E Sequences producing significant alignments: (bits) Value sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine...domain-conta... 29 6.3 >sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (st
Lifescience Database Archive (English)
Full Text Available tX Result : Swiss-Prot sp_hit_id Q09033 Definition sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria f...ducing significant alignments: (bits) Value sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria fimicola...... 30 8.1 >sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria fimicola GN=FRQ PE=3 SV=1 Length = 997 S
Lifescience Database Archive (English)
Full Text Available Result : TrEMBL tr_hit_id A3U3S0 Definition tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola bats...5 >tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola batsensis HTCC2597 GN=OB2597
Lifescience Database Archive (English)
Full Text Available Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP...............done Score E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP Catal...23|CATA3_MAIZE Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=... 365 e-101 >sp|O24339|CATA_SOLAP Catalase OS=Sol
Lifescience Database Archive (English)
Full Text Available s ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP...................done Score E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP C... sp|P49284|CATA1_SOLTU Catalase isozyme 1 OS=Solanum tuberosum GN... 114 2e-25 >sp|O24339|CATA_SOLAP Catalas
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
Aruna, S. A.; Zhang, P.; Lin, F. Y.; Ding, S. Y.; Yao, X. X.
2000-04-01
Within the framework of the thermally activated process of the flux line or flux line bundles, and by time integration of the 1D equation of motion of the circulating current density icons/Journals/Common/vecJ" ALT="vecJ" ALIGN="TOP"/> (icons/Journals/Common/rho" ALT="rho" ALIGN="TOP"/> ,t ), which is suitable for thin superconducting films (R >>d ,icons/Journals/Common/le" ALT="le" ALIGN="TOP"/> icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/> ), we present numerical calculations of the current profiles, magnetization hysteresis loops and ac susceptibility icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> n = icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´n +iicons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´´n for n = 1, 3 and 5 of a thin disc immersed in an axial time-dependent external magnetic field Ba (t ) = Bdc +Bac cos(2icons/Journals/Common/pi" ALT="pi" ALIGN="TOP"/> icons/Journals/Common/nu" ALT="nu" ALIGN="TOP"/> t ). Our calculated results are compared with those of the critical state model (CSM) and found to prove the approximate validity of the CSM below the irreversibility field. The differences between our computed results and those of the CSM are also discussed.
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
Lifescience Database Archive (English)
Full Text Available se 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9Y2K2 Definition sp|Q9Y2K2...........done Score E Sequences producing significant alignments: (bits) Value sp|Q9Y2K...AM 32 OS=Homo sapiens GN=ADAM32 PE=1 SV=1 29 8.4 >sp|Q9Y2K2|QSK_HUMAN Serine/thre
Lifescience Database Archive (English)
Full Text Available sp_hit_id Q5XHH7 Definition sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin-B OS=Xenopus laevi...ducing significant alignments: (bits) Value sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin...iquitin-protein ligase synoviolin-B OS=Xenopus laevis GN=syvn1-B PE=2 SV=1 Length = 595 Score = 30.8 bits (6
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSC836 (Link to dictyBase) - - - - SSC836E (Link to Original s...ite) - - - - - - SSC836E 502 Show SSC836 Library SS (Link to library) Clone ID SSC836 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...t alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) g...ene, complete cds. 779 0.0 1 AC116984 |AC116984.2 Dictyostelium discoideum chromo
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD405 (Link to dictyBase) - - - Contig-U15984-1 CHD405E (Link... Clone ID CHD405 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15984-1 Original site URL http://dict...ts) Value N AC115599 |AC115599.2 Dictyostelium discoideum chromosome 2 map 422909...8-4354721 strain AX4, complete sequence. 42 3e-11 9 AC115598 |AC115598.2 Dictyostelium discoideum chromosome... 2 map 581427-735498 strain AX4, complete sequence. 50 4e-11 11 CK417372 |CK417372.1 AUF_IpInt_56_d19 Intestine cDNA library Ict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC115 (Link to dictyBase) - - - Contig-U16382-1 VFC115E (Link...) Clone ID VFC115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 954 0.0 7 AC116957 |AC116957.2 Dict...X4, complete sequence. 906 0.0 9 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 890 0.0 7 AC115579 |AC115579.2 Dict...0.0 7 U25660 |U25660.1 Dictyostelium discoideum actin gene, partial cds. 866 0.0
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Lifescience Database Archive (English)
Full Text Available tr_hit_id A5WW09 Definition tr|A5WW09|A5WW09_DANRE Novel protein similar to autism susceptibility candidate ... Novel protein similar to autism susceptib... 42 0.028 tr|A9H6U3|A9H6U3_GLUDA Put...Putative uncharacterized protein OS=Planc... 33 9.9 >tr|A5WW09|A5WW09_DANRE Novel protein similar to autism
Lifescience Database Archive (English)
Full Text Available 3. 5' end sequence. DK944068 - Show DK944068 Clone id YMU02A01NGRL0004_O03 Library YMU02 Length 116 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_O03. 5' end sequence. Accession DK944068 Tissue t...YMU02A01NGRL0004_O03 116 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_O0
Lifescience Database Archive (English)
Full Text Available t : TrEMBL tr_hit_id A6GRE8 Definition tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter...bacter... 33 9.4 >tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter ........done Score E Sequences producing significant alignments: (bits) Value tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limno
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
Lifescience Database Archive (English)
Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog
Lifescience Database Archive (English)
Full Text Available 5W9_9INFA Hemagglutinin OS=Influenza A virus (A/cinnamon teal/Bolivia/4537/2001(H...o BlastX Result : TrEMBL tr_hit_id Q0Q5W9 Definition tr|Q0Q5W9|Q0Q5W9_9INFA Hemagglutinin OS=Influenza A virus (A/cinnamon teal/Boliv...ia/4537/2001(H7N3)) Align length 51 Score (bit) 36.6 E-v
Lifescience Database Archive (English)
Full Text Available to BlastX Result : TrEMBL tr_hit_id B1NTT1 Definition tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachel....done Score E Sequences producing significant alignments: (bits) Value tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trache...li... 36 0.84 >tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachelium c
Lifescience Database Archive (English)
Full Text Available sult : TrEMBL tr_hit_id Q54CF8 Definition tr|Q54CF8|Q54CF8_DICDI Chromo (CHRomatin Organization...ments: (bits) Value tr|Q54CF8|Q54CF8_DICDI Chromo (CHRomatin Organization MOdifier) ... 41 0.059 tr|B1SAI8|B... protein OJ1249_F... 33 9.5 >tr|Q54CF8|Q54CF8_DICDI Chromo (CHRomatin Organization MOdifier) domain-containi
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFH557 (Link to dictyBase) - - - - - (Link to Original site) C...FH557F 132 - - - - - - Show CFH557 Library CF (Link to library) Clone ID CFH557 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFH...roducing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyosteliu...m discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 3e-28 3 X51892 |X51892.1 Dict
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB594 (Link to dictyBase) - G00395 DDB0218201 Contig-U09553-1...brary) Clone ID VFB594 (Link to dictyBase) Atlas ID - NBRP ID G00395 dictyBase ID DDB0218201 Link to Contig ...Contig-U09553-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-...s thaliana BAC F21J9 from chromosome I, complete sequence. 44 0.14 3 AC115612 |AC115612.2 Dictyostelium disc...: cytoskeletal 4.0 %: mitochondrial 4.0 %: vesicles of secretory system >> prediction for VFB594 is nuc 5' e
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
Lifescience Database Archive (English)
Full Text Available 9.9) Link to BlastX Result : TrEMBL tr_hit_id B2CJ80 Definition tr|B2CJ80|B2CJ80_9HYPO Coatamer subunit protein OS=Epichloe.....done Score E Sequences producing significant alignments: (bits) Value tr|B2CJ80|B2CJ80_9HYPO Coatamer subunit protein OS=Epichloe...3 7.1 >tr|B2CJ80|B2CJ80_9HYPO Coatamer subunit protein OS=Epichloe festucae GN=17
Lifescience Database Archive (English)
Full Text Available to BlastX Result : TrEMBL tr_hit_id B8CPU2 Definition tr|B8CPU2|B8CPU2_9GAMM GGDEF domain protein OS=Shewanella piezo...ore E Sequences producing significant alignments: (bits) Value tr|B8CPU2|B8CPU2_9GAMM GGDEF domain protein OS=Shewanella piezo...t... 33 5.5 >tr|B8CPU2|B8CPU2_9GAMM GGDEF domain protein OS=Shewanella piezotolerans WP3 G
Lifescience Database Archive (English)
Full Text Available 8. 5' end sequence. DK950801 - Show DK950801 Clone id TST38A01NGRL0009_K18 Library TST38 Length 645 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_K18. 5' end sequence. Accession DK950801 Tissue t...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950801|Adiantum capillus-v...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950801|Adiantum