Application of a decanter centrifuge for casein fractionation on pilot scale

NARCIS (Netherlands)

Schubert, Thomas; Meric, Asutay; Boom, Remko; Hinrichs, Jörg; Atamer, Zeynep

2018-01-01

Individual casein fractions are of growing interest because of their multifunctional applications. The fractions of caseins (α<sub>S>-, β- & κ-) possess a wide range of bio- and techno-functional properties. Although various isolation and purification methods to obtain casein fractions

A generalized fractional sub-equation method for fractional differential equations with variable coefficients

International Nuclear Information System (INIS)

Tang, Bo; He, Yinnian; Wei, Leilei; Zhang, Xindong

2012-01-01

In this Letter, a generalized fractional sub-equation method is proposed for solving fractional differential equations with variable coefficients. Being concise and straightforward, this method is applied to the space–time fractional Gardner equation with variable coefficients. As a result, many exact solutions are obtained including hyperbolic function solutions, trigonometric function solutions and rational solutions. It is shown that the considered method provides a very effective, convenient and powerful mathematical tool for solving many other fractional differential equations in mathematical physics. -- Highlights: ► Study of fractional differential equations with variable coefficients plays a role in applied physical sciences. ► It is shown that the proposed algorithm is effective for solving fractional differential equations with variable coefficients. ► The obtained solutions may give insight into many considerable physical processes.

Uptake of SO/sub 2/ and NO/sub 2/ by the isolated upper airways

Energy Technology Data Exchange (ETDEWEB)

Yokoyama, E

1968-01-01

SO/sub 2/ and NO/sub 2/ concentrations were measured above and below isolated tracheas of 2 dogs and 3 rabbits. Air--gas mixtures were pumped through nose to upper trachea for 10 to 15 min at rates of 3.5 and 0.75 liters/min, respectively. Gas concentrations ranged from 7 to 87 ppM SO/sub 2/ and from 4 to 41 ppM NO/sub 2/. The rate of uptake for the isolated airways was a generally constant 93.7% for SO/sub 2/ and 42.1% for NO/sub 2/, a significant difference.

Lysophosphatidic acid signaling via LPA{sub 1} and LPA{sub 3} regulates cellular functions during tumor progression in pancreatic cancer cells

Energy Technology Data Exchange (ETDEWEB)

Fukushima, Kaori; Takahashi, Kaede; Yamasaki, Eri; Onishi, Yuka [Division of Molecular Oncology, Department of Life Science, Faculty of Science and Engineering, Kindai University, 3-4-1, Kowakae, Higashiosaka, Osaka 577-8502 (Japan); Fukushima, Nobuyuki [Division of Molecular Neurobiology, Department of Life Science, Faculty of Science and Engineering, Kindai University, 3-4-1, Kowakae, Higashiosaka, Osaka 577-8502 (Japan); Honoki, Kanya [Department of Orthopedic Surgery, Nara Medical University, 840 Shijo-cho, Kashihara, Nara 634-8521 (Japan); Tsujiuchi, Toshifumi, E-mail: ttujiuch@life.kindai.ac.jp [Division of Molecular Oncology, Department of Life Science, Faculty of Science and Engineering, Kindai University, 3-4-1, Kowakae, Higashiosaka, Osaka 577-8502 (Japan)

2017-03-01

Lysophosphatidic acid (LPA) signaling via G protein-coupled LPA receptors exhibits a variety of biological effects, such as cell proliferation, motility and differentiation. The aim of this study was to evaluate the roles of LPA{sub 1} and LPA{sub 3} in cellular functions during tumor progression in pancreatic cancer cells. LPA{sub 1} and LPA{sub 3} knockdown cells were generated from PANC-1 cells. The cell motile and invasive activities of PANC-1 cells were inhibited by LPA{sub 1} and LPA{sub 3} knockdown. In gelatin zymography, LPA{sub 1} and LPA{sub 3} knockdown cells indicated the low activation of matrix metalloproteinase-2 (MMP-2) in the presence of LPA. Next, to assess whether LPA{sub 1} and LPA{sub 3} regulate cellular functions induced by anticancer drug, PANC-1 cells were treated with cisplatin (CDDP) for approximately 6 months. The cell motile and invasive activities of long-term CDDP treated cells were markedly higher than those of PANC-1 cells, correlating with the expression levels of LPAR1 and LPAR3 genes. In soft agar assay, the long-term CDDP treated cells formed markedly large sized colonies. In addition, the cell motile and invasive activities enhanced by CDDP were significantly suppressed by LPA{sub 1} and LPA{sub 3} knockdown as well as colony formation. These results suggest that LPA signaling via LPA{sub 1} and LPA{sub 3} play an important role in the regulation of cellular functions during tumor progression in PANC-1 cells. - Highlights: • The cell motile and invasive activities of PANC-1 cells were stimulated by LPA{sub 1} and LPA{sub 3}. • LPA{sub 1} and LPA{sub 3} enhanced MMP-2 activation in PANC-1 cells. • The expressions of LPAR1 and LPAR3 genes were elevated in PANC-1 cells treated with cisplatin. • The cell motile and invasive activities of PANC-1 cells treated with cisplatin were suppressed by LPA{sub 1} and LPA{sub 3} knockdown. • LPA{sub 1} and LPA{sub 3} are involved in the regulation of cellular functions during tumor

Measurement of the B{sub s}{sup 0}{yields}J/{psi}K{sub S}{sup 0} branching fraction

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); and others

2012-07-09

The B{sub s}{sup 0}{yields}J/{psi}K{sub S}{sup 0} branching fraction is measured in a data sample corresponding to 0.41 fb{sup -1} of integrated luminosity collected with the LHCb detector at the LHC. This channel is sensitive to the penguin contributions affecting the sin2{beta} measurement from B{sup 0}{yields}J/{psi}K{sub S}{sup 0}. The time-integrated branching fraction is measured to be B(B{sub s}{sup 0}{yields}J/{psi}K{sub S}{sup 0})=(1.83{+-}0.28) Multiplication-Sign 10{sup -5}. This is the most precise measurement to date.

Effect of fractionated extracts and isolated pure compounds of ...

African Journals Online (AJOL)

This study attempted to elucidate the neurotransmitter systems involved in the neurophysiological properties of ethanolic extract, fractions and pure isolates of Spondias mombin leaves in mice (n = 6) after intraperitoneal (i.p.) route of administration. The crude ethanolic extract of spondian mombin leaves was fractionated ...

SO{sub 2}-ethanol-water (SEW) fractionation of lignocellulosics

Energy Technology Data Exchange (ETDEWEB)

Iakovlev, M.

2011-10-15

This study deals with SO{sub 2}-ethanol-water (SEW) fractionation as a potential method for a Lignocellulosic Biorefinery to achieve high yield separation of the three important components of biomass; cellulose, hemicelluloses and lignin. Representatives of all principal biomass species were successfully treated by SEW fractionation at similar rates. The kinetics of delignification, polysaccharides removal and cellulose hydrolysis at different temperatures and SO{sub 2} concentrations are described and interpreted from the viewpoint of acid-catalysed degradation of the biomass polymers. The fractionation pattern is compared to that of commercial acid sulfite cooking. The kinetics of delignification, hemicelluloses removal and cellulose hydrolysis during SEW fractionation each follow a two phase behaviour. The delignification is first order in lignin and SO{sub 2}. The observed lignin sulfonation and delignification patterns can be explained using Haegglund's consecutive fast sulfonation-slow hydrolysis scheme. During the initial phase of fractionation, the hemicelluloses removal and cellulose hydrolysis rates are related to the delignification rate, while in the following bulk phase the former two processes proceed independently from the latter. It is proposed that during the initial phase the hemicelluloses are removed together with lignin in the form of lignocarbohydrate complexes, while cellulose is protected by lignin from hydrolytic attack leading to a lower hydrolysis rate. Most hemicellulose side units as well as acetyl groups are cleaved during the first phase, while the glucomannan and xylan backbone polymers are removed at a considerably lower rate in the second (bulk) phase following first order kinetics in the residual polysaccharides. The observed polysaccharides dissolution behaviour can be interpreted in terms of low glucomannan stabilisation by crystallisation on cellulose at the applied conditions. Minimal cellulose dissolution occurs during

Determining the sub-cellular localization of proteins within Caenorhabditis elegans body wall muscle.

Science.gov (United States)

Meissner, Barbara; Rogalski, Teresa; Viveiros, Ryan; Warner, Adam; Plastino, Lorena; Lorch, Adam; Granger, Laure; Segalat, Laurent; Moerman, Donald G

2011-01-01

Determining the sub-cellular localization of a protein within a cell is often an essential step towards understanding its function. In Caenorhabditis elegans, the relatively large size of the body wall muscle cells and the exquisite organization of their sarcomeres offer an opportunity to identify the precise position of proteins within cell substructures. Our goal in this study is to generate a comprehensive "localizome" for C. elegans body wall muscle by GFP-tagging proteins expressed in muscle and determining their location within the cell. For this project, we focused on proteins that we know are expressed in muscle and are orthologs or at least homologs of human proteins. To date we have analyzed the expression of about 227 GFP-tagged proteins that show localized expression in the body wall muscle of this nematode (e.g. dense bodies, M-lines, myofilaments, mitochondria, cell membrane, nucleus or nucleolus). For most proteins analyzed in this study no prior data on sub-cellular localization was available. In addition to discrete sub-cellular localization we observe overlapping patterns of localization including the presence of a protein in the dense body and the nucleus, or the dense body and the M-lines. In total we discern more than 14 sub-cellular localization patterns within nematode body wall muscle. The localization of this large set of proteins within a muscle cell will serve as an invaluable resource in our investigation of muscle sarcomere assembly and function.

[Effects of sub-micro emulsion composition on cellular disposition of incorporated lipophilic drug].

Science.gov (United States)

Sun, Xiao-Yi; Xiang, Zhi-Qiang; Wu, Shuo; Lv, Yuan-Yuan; Liang, Wen-Quan

2013-09-01

To investigate the effects of sub-micro emulsion composition on cellular uptake and disposition of incorporated lipophilic drug. Sub-micro emulsions containing 10 % oil, 1.2 % lecithin and 2.25 % glycerol were prepared, and the fluorescent agent coumarin 6 was used as a model drug. The effects of oil types, co-surfactants and cationic lipid on uptake and elimination kinetics of 6-coumarin in HeLa cells were studied. The uptake mechanism of sub-micro emulsions was further investigated. Oil type and Tweens had no influence on the cellular uptake. Modifications of surfactants with Span series increased the cellular influx, among which Span 20 with hydrophilic-lipophilic balance (HLB) value of 8.6 was the best enhancer. The intracellular drug level reached up to (46.09 ± 1.98)ng/μg protein which had significant difference with control group [(38.54 ± 0.34)ng/μg protein]. The positively charged emulsions significantly increased the uptake rate constant and elimination rate constant which were 4 times and 1.5 times of those in anionic groups, respectively. The uptake enhancement was also observed in cationic emulsions, cellular concentrations at plateau were (42.73 ± 0.84)ng/μg protein, which was about 3 times of that in anionic emulsions [(15.71 ± 0.74)ng/μg protein], when extracellular drug concentration kept at 100 ng/ml. Cationic emulsions delivered the payload mainly by direct drug transfer to contacted cells, while the negative ones depended on both drug passive diffusion and clathrin-mediated endocytosis of drug containing oil droplets which accounted for 20% of the intracellular drug. Interfacial characteristic of sub-micro emulsions such as co-surfactants HLB as well as zeta potentials can influence lipophilic drug both in cellular uptake and elimination.

Isolation of a hemidesmosome-rich fraction from a human squamous cell carcinoma cell line

Energy Technology Data Exchange (ETDEWEB)

Hirako, Yoshiaki, E-mail: s47526a@cc.nagoya-u.ac.jp [Division of Biological Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Yonemoto, Yuki; Yamauchi, Tomoe [Division of Biological Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Nishizawa, Yuji; Kawamoto, Yoshiyuki [Department of Biomedical Sciences, Chubu University, 1200 Matsumoto-cho, Kasugai 487-8501 (Japan); Owaribe, Katsushi [Division of Biological Science, Graduate School of Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan)

2014-06-10

Hemidesmosomes are cell-to-matrix adhesion complexes anchoring keratinocytes to basement membranes. For the first time, we present a method to prepare a fraction from human cultured cells that are highly enriched in hemidesmosomal proteins. Using DJM-1 cells derived from human squamous cell carcinoma, accumulation of hemidesmosomes was observed when these cells were cultured for more than 10 days in a commercial serum-free medium without supplemental calcium. Electron microscopy demonstrated that numerous electron-dense adhesion structures were present along the basal cell membranes of DJM-1 cells cultured under the aforementioned conditions. After removing cellular materials using an ammonia solution, hemidesmosomal proteins and deposited extracellular matrix were collected and separated by electrophoresis. There were eight major polypeptides, which were determined to be plectin, BP230, BP180, integrin α6 and β4 subunits, and laminin-332 by immunoblotting and mass spectrometry. Therefore, we designated this preparation as a hemidesmosome-rich fraction. This fraction contained laminin-332 exclusively in its unprocessed form, which may account for the promotion of laminin deposition, and minimal amounts of Lutheran blood group protein, a nonhemidesmosomal transmembrane protein. This hemidesmosome-rich fraction would be useful not only for biological research on hemidesmosomes but also for developing a serum test for patients with blistering skin diseases. - Highlights: • A defined condition promoted accumulation of hemidesmosomes in human cultured cells. • A fraction isolated from the cells contained eight major polypeptides. • The polypeptides were the five major hemidesmosome proteins and laminin-332. • The cultured cells deposited laminin-332 in its unprocessed form under the condition. • We report a method to prepare a fraction highly enriched in hemidesmosome proteins.

Characteristics of Staphylococcus aureus isolated from acute, sub-acute and sub-clinical staphylococcosis in rabbits

Directory of Open Access Journals (Sweden)

Rajeshkumar J. Tirpude

2012-12-01

Full Text Available Staphylococcus aureus bacteria isolated from different clinical presentations of staphylococcosis in rabbits were examined for the production of various virulence factors using biochemical and immunological tests. In the total of 106 S. aureus isolates; toxic shock syndrome toxin-1, staphylococcal enterotoxin-C, DNase, α-haemolysin, β-haemolysin, δ-haemolysin, protein A and clumping factor were observed with a frequency of 33.2, 16.98, 83.96, 69.81, 36.79, 100, 78.30 and 54.72 percent, respectively. No SE-A, SE-B and SE-D producing isolates were recovered in this study. All the S. aureus isolates from acute staphylococcosis produced TSST-1, SE-C and protein A. While δ–haemolysin and clumping factor were not detected in any acute isolates, these factors were observed at a relatively higher frequency in isolates from sub-acute and sub-clinical staphylococcosis. Coagulase type III was observed more predominantly with a frequency of 45.28%, while coagulase types V and VII were not observed in any isolate. Most of the virulence factors belonged to coagulase type III followed by type VI. TSST-1 and SE-C along with coagulase types III and VI could be correlated with the acute and sub-acute staphylococcal infections in rabbits in this study.

Amorphous and nanocrystalline fraction calculus for the Fe{sub 73.5}Si{sub 3.5}Ge{sub 10}Nb{sub 3}B{sub 9}Cu{sub 1} alloy

Energy Technology Data Exchange (ETDEWEB)

Muraca, D. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires (Argentina); Moya, J. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires (Argentina); Carrera del Investigador, CONICET (Argentina); Cremaschi, V.J. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires (Argentina) and Carrera del Investigador, CONICET (Argentina)]. E-mail: vcremas@fi.uba.ar; Sirkin, H.R.M. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires (Argentina); Carrera del Investigador, CONICET (Argentina)

2007-09-01

We studied the relationship between the saturation magnetization (M {sub S}) of the Fe{sub 73.5}Si{sub 3.5}Ge{sub 10}Nb{sub 3}B{sub 9}Cu{sub 1} alloy and its nanocrystalline structure. Amorphous ribbons obtained by the melt spinning technique were heat-treated for 1 h at different temperatures. The optimal treatment to obtain a homogeneous structure of Fe{sub 3}(Si,Ge) nanocrystals with a grain size of around 10 nm embedded in an amorphous matrix involved heating at 540 C for 1 h. We calculated the magnetic contribution of the nanocrystals to the heat treated alloy using a linear model and measured the M {sub S} of the Fe{sub 73.5}Si{sub 3.5}Ge{sub 10}Nb{sub 3}B{sub 9}Cu{sub 1} nanocrystalline and of an amorphous alloy of the same composition of the amorphous matrix: Fe{sub 58}Si{sub 0.5}Ge{sub 3.5}Cu{sub 3}Nb{sub 9}B{sub 26}. Using experimental data and theoretical calculations, we obtained the amorphous and crystalline fraction of the heat-treated ribbons.

Isolation of bioactive allelochemicals from sunflower (variety Suncross-42) through fractionation-guided bioassays.

Science.gov (United States)

Anjum, Tehmina; Bajwa, Rukhsana

2010-11-01

Plants are rich source of biologically active allelochemicals. However, natural product discovery is not an easy task. Many problems encountered during this laborious practice can be overcome through the modification of preliminary trials. Bioassay-directed isolation of active plant compounds can increase efficiency by eliminating many of the problems encountered. This strategy avoids unnecessary compounds, concentrating on potential components and thus reducing the cost and time required. In this study, a crude aqueous extract of sunflower leaves was fractionated through high performance liquid chromatography. The isolated fractions were checked against Chenopodium album and Rumex dentatus. The fraction found active against two selected weeds was re-fractionated, and the active components were checked for their composition. Thin layer chromatography isolated a range of phenolics, whereas the presence of bioactive terpenoids was confirmed through mass spectroscopy and nuclear magnetic resonance spectroscopy.

Isolation and evaluation of a high H{sub 2}-producing lab isolate from cow dung

Energy Technology Data Exchange (ETDEWEB)

Pandey, Anjana; Sinha, Pallavi [Nanotechnology and Molecular Biology Lab, Department of Biotechnology, University of Allahabad, Allahabad-211002, Uttar Pradesh (India); Kotay, Shireen Meher; Das, Debabrata [Department of Biotechnology, Indian Institute of Technology, Kharagpur-721302, West Bengal (India)

2009-09-15

Hydrogen producing bacterial strain was isolated from Indian cow dung and identified of the bacterial family Enterobacteriaceae. This lab isolate was differentiated from Citrobacter Y-19 at molecular level by using RAPD, PCR based technique, and OPO-03{sub 460} and OPO-17{sub 800} RAPD marker for this specific strain (lab isolate) was identified. Fermentative studies were investigated for important parameters, starting with pH of the culture, temperature, inoculum age and inoculum volume, initial substrate concentration and different substrates. Among different substrates, dextrose and sucrose were the preferred substrates for hydrogen production. The optimal starting pH of the culture was found to be 5.0. The H{sub 2} production increased with increase in temperature up to 30 C. The maximum value of H{sub 2} production was recorded when inoculum volume was 12.5% of the culture broth and inoculum age was 14 h. Under batch fermentation conditions, the maximum hydrogen production rate and yield were 355.2 ml l{sup -1} h{sup -1} and 2.1 mol/mol glucose (conversion 35%), respectively. These results indicate that this lab isolate is an ideal hydrogen producer. (author)

Sub-cellular distribution and translocation of TRP channels.

Science.gov (United States)

Toro, Carlos A; Arias, Luis A; Brauchi, Sebastian

2011-01-01

Cellular electrical activity is the result of a highly complex processes that involve the activation of ion channel proteins. Ion channels make pores on cell membranes that rapidly transit between conductive and non-conductive states, allowing different ions to flow down their electrochemical gradients across cell membranes. In the case of neuronal cells, ion channel activity orchestrates action potentials traveling through axons, enabling electrical communication between cells in distant parts of the body. Somatic sensation -our ability to feel touch, temperature and noxious stimuli- require ion channels able to sense and respond to our peripheral environment. Sensory integration involves the summing of various environmental cues and their conversion into electrical signals. Members of the Transient Receptor Potential (TRP) family of ion channels have emerged as important mediators of both cellular sensing and sensory integration. The regulation of the spatial and temporal distribution of membrane receptors is recognized as an important mechanism for controlling the magnitude of the cellular response and the time scale on which cellular signaling occurs. Several studies have shown that this mechanism is also used by TRP channels to modulate cellular response and ultimately fulfill their physiological function as sensors. However, the inner-working of this mode of control for TRP channels remains poorly understood. The question of whether TRPs intrinsically regulate their own vesicular trafficking or weather the dynamic regulation of TRP channel residence on the cell surface is caused by extrinsic changes in the rates of vesicle insertion or retrieval remain open. This review will examine the evidence that sub-cellular redistribution of TRP channels plays an important role in regulating their activity and explore the mechanisms that control the trafficking of vesicles containing TRP channels.

Isolation and partial characterization of two porcine spleen ferritin fractions with different electrophoretic mobility

NARCIS (Netherlands)

C.M. Van Gelder (Carin); M.I.E. Huijskes-Heins (M. I E); D. Klepper (D.); W.L. van Noort (W.); M.I. Cleton-Soeteman (Maud); H.G. van Eijk (Henk)

1996-01-01

textabstractFerritin isolated from porcine spleen could routinely be separated in two fractions on nondenaturating gradient gels. Both fractions could be isolated with a purity of 96% when applied to two serially linked columns, each 200 cm in length, packed respectively with Sepharose 4B and

Cellular content of biomolecules in sub-seafloor microbial communities

DEFF Research Database (Denmark)

Braun, Stefan; Morono, Yuki; Becker, Kevin W.

2016-01-01

the lifetime of their microbial sources. Here we provide for the first time measurements of the cellular content of biomolecules in sedimentary microbial cells. We separated intact cells from sediment matrices in samples from surficial, deeply buried, organic-rich, and organic-lean marine sediments by density...... content. We find that the cellular content of biomolecules in the marine subsurface is up to four times lower than previous estimates. Our approach will facilitate and improve the use of biomolecules as proxies for microbial abundance in environmental samples and ultimately provide better global estimates......Microbial biomolecules, typically from the cell envelope, can provide crucial information about distribution, activity, and adaptations of sub-seafloor microbial communities. However, when cells die these molecules can be preserved in the sediment on timescales that are likely longer than...

Modulation of hyaluronan synthase activity in cellular membrane fractions.

Science.gov (United States)

Vigetti, Davide; Genasetti, Anna; Karousou, Evgenia; Viola, Manuela; Clerici, Moira; Bartolini, Barbara; Moretto, Paola; De Luca, Giancarlo; Hascall, Vincent C; Passi, Alberto

2009-10-30

Hyaluronan (HA), the only non-sulfated glycosaminoglycan, is involved in morphogenesis, wound healing, inflammation, angiogenesis, and cancer. In mammals, HA is synthesized by three homologous HA synthases, HAS1, HAS2, and HAS3, that polymerize the HA chain using UDP-glucuronic acid and UDP-N-acetylglucosamine as precursors. Since the amount of HA is critical in several pathophysiological conditions, we developed a non-radioactive assay for measuring the activity of HA synthases (HASs) in eukaryotic cells and addressed the question of HAS activity during intracellular protein trafficking. We prepared three cellular fractions: plasma membrane, cytosol (containing membrane proteins mainly from the endoplasmic reticulum and Golgi), and nuclei. After incubation with UDP-sugar precursors, newly synthesized HA was quantified by polyacrylamide gel electrophoresis of fluorophore-labeled saccharides and high performance liquid chromatography. This new method measured HAS activity not only in the plasma membrane fraction but also in the cytosolic membranes. This new technique was used to evaluate the effects of 4-methylumbeliferone, phorbol 12-myristate 13-acetate, interleukin 1beta, platelet-derived growth factor BB, and tunicamycin on HAS activities. We found that HAS activity can be modulated by post-translational modification, such as phosphorylation and N-glycosylation. Interestingly, we detected a significant increase in HAS activity in the cytosolic membrane fraction after tunicamycin treatment. Since this compound is known to induce HA cable structures, this result links HAS activity alteration with the capability of the cell to promote HA cable formation.

Measurement of the branching fraction Br (B⁰<sub>s> → D<sub>s*D_{s>* using the D0 detector at Fermilab}

Energy Technology Data Exchange (ETDEWEB)

Walder, James William [Lancaster Univ. (United Kingdom)

2008-05-01

This thesis describes a measurement of the branching fraction Br (B⁰<sub>s> → D<sub>s*D<sub>s>*) made using a data sample collected from proton-antiproton collisions at a centre-of-mass energy of 1.96 TeV, corresponding to approximately 1.3 fb^-1 of integrated luminosity collected in 2002--2006 by the D0 detector at the Fermilab Tevatron Collider. One D*<sub>s> meson was partially reconstructed in the decay D<sub>s> → Φμv, and the other D*<sub>s> meson was identified using the decay D<sub>s> → Φπ where no attempt was made to distinguish D<sub>s> and D*<sub>s> states. The resulting measurement is Br (B⁰<sub>s> → D_s*D<sub>s>*) = 0.039^+0.019_-0.017sub>(stat) ^+0.016<sub>-0.015sub>(syst). This was subsequently used to estimate the width difference ΔΓ^CP<sub>s> in the B⁰<sub>s>-$\\bar{B}$⁰<sub>s> system: ΔΓ^CP<sub>s/Γ<sub>s> = 0.079^+0.038_-0.035sub>(stat)^+0.031<sub>-0.030sub>(syst), and is currently one of the most precise estimates of this quantity and consistent with the Standard Model.

The relationship between I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}){sup 2} and crystalline volume fraction in microcrystalline silicon growth

Energy Technology Data Exchange (ETDEWEB)

Chantana, Jakapan; Higuchi, Takuya; Nagai, Tomoyuki; Sasaki, Shota; Sobajima, Yasushi; Toyama, Toshihiko; Sada, Chitose; Matsuda, Akihisa; Okamoto, Hiroaki [Graduate School of Engineering Science, Osaka University, 1-3 Machikaneyama-cho, Toyonaka, Osaka 560-8531 (Japan)

2010-03-15

Optical-emission-intensity ratio of I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) during film growth has been used as a simple indicator to predict crystallinity (crystal-volume fraction: X{sub C}) in the resulting microcrystalline silicon ({mu}c-Si:H) thin films. The relationship between I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) and X{sub C} has been checked under a wide variety of film-preparation conditions including low-deposition-rate (<0.1 nm/s) and high-deposition-rate (>5 nm/s) cases. On the basis of theoretical consideration, we have proposed optical-emission-intensity ratio of I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) {sup 2} as a new indicator of X{sub C} during film growth of {mu}c-Si:H. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

The improved fractional sub-equation method and its applications to the space–time fractional differential equations in fluid mechanics

International Nuclear Information System (INIS)

Guo, Shimin; Mei, Liquan; Li, Ying; Sun, Youfa

2012-01-01

By introducing a new general ansätz, the improved fractional sub-equation method is proposed to construct analytical solutions of nonlinear evolution equations involving Jumarie's modified Riemann–Liouville derivative. By means of this method, the space–time fractional Whitham–Broer–Kaup and generalized Hirota–Satsuma coupled KdV equations are successfully solved. The obtained results show that the proposed method is quite effective, promising and convenient for solving nonlinear fractional differential equations. -- Highlights: ► We propose a novel method for nonlinear fractional differential equations. ► Two important fractional differential equations in fluid mechanics are solved successfully. ► Some new exact solutions of the fractional differential equations are obtained. ► These solutions will advance the understanding of nonlinear physical phenomena.

Agent-Based Modeling of Mitochondria Links Sub-Cellular Dynamics to Cellular Homeostasis and Heterogeneity.

Directory of Open Access Journals (Sweden)

Giovanni Dalmasso

Full Text Available Mitochondria are semi-autonomous organelles that supply energy for cellular biochemistry through oxidative phosphorylation. Within a cell, hundreds of mobile mitochondria undergo fusion and fission events to form a dynamic network. These morphological and mobility dynamics are essential for maintaining mitochondrial functional homeostasis, and alterations both impact and reflect cellular stress states. Mitochondrial homeostasis is further dependent on production (biogenesis and the removal of damaged mitochondria by selective autophagy (mitophagy. While mitochondrial function, dynamics, biogenesis and mitophagy are highly-integrated processes, it is not fully understood how systemic control in the cell is established to maintain homeostasis, or respond to bioenergetic demands. Here we used agent-based modeling (ABM to integrate molecular and imaging knowledge sets, and simulate population dynamics of mitochondria and their response to environmental energy demand. Using high-dimensional parameter searches we integrated experimentally-measured rates of mitochondrial biogenesis and mitophagy, and using sensitivity analysis we identified parameter influences on population homeostasis. By studying the dynamics of cellular subpopulations with distinct mitochondrial masses, our approach uncovered system properties of mitochondrial populations: (1 mitochondrial fusion and fission activities rapidly establish mitochondrial sub-population homeostasis, and total cellular levels of mitochondria alter fusion and fission activities and subpopulation distributions; (2 restricting the directionality of mitochondrial mobility does not alter morphology subpopulation distributions, but increases network transmission dynamics; and (3 maintaining mitochondrial mass homeostasis and responding to bioenergetic stress requires the integration of mitochondrial dynamics with the cellular bioenergetic state. Finally, (4 our model suggests sources of, and stress conditions

Combined phase and X-Ray fluorescence imaging at the sub-cellular level

International Nuclear Information System (INIS)

Kosior, Ewelina

2013-01-01

This work presents some recent developments in the field of hard X-ray imaging applied to biomedical research. As the discipline is evolving quickly, new questions appear and the list of needs becomes bigger. Some of them are dealt with in this manuscript. It has been shown that the ID22NI beamline of the ESRF can serve as a proper experimental setup to investigate diverse aspects of cellular research. Together with its high spatial resolution, high flux and high energy range the experimental setup provides bigger field of view, is less sensitive to radiation damages (while taking phase contrast images) and suits well chemical analysis with emphasis on endogenous metals (Zn, Fe, Mn) but also with a possibility for exogenous one's like these found in nanoparticles (Au, Pt, Ag) study. Two synchrotron-based imaging techniques, fluorescence and phase contrast imaging were used in this research project. They were correlated with each other on a number of biological cases, from bacteria E.coli to various cells (HEK 293, PC12, MRC5VA, red blood cells). The explorations made in the chapter 5 allowed preparation of more established and detailed analysis, described in the next chapter where both techniques, X-ray fluorescence and phase contrast imaging, were exploited in order to access absolute metal projected mass fraction in a whole cell. The final image presents for the first time true quantitative information at the sub-cellular level, not biased by the cell thickness. Thus for the first time a fluorescence map serves as a complete quantitative image of a cell without any risk of misinterpretation. Once both maps are divided by each other pixel by pixel (fluorescence map divided by the phase map) they present a complete and final result of the metal (Zn in this work) projected mass fraction in ppm of dry weight. For the purpose of this calculation the analysis was extended to calibration (non-biological) samples. Polystyrene spheres of a known diameter and known

Effect of fractionated extracts and isolated pure compounds of Spondias mombin (L. Anacardiaceae) leaves on novelty-induced rearing and grooming behaviours in mice.

Science.gov (United States)

Ayoka, Abiodun O; Owolabi, Rotimi A; Bamitale, Samuel K; Akomolafe, Rufus O; Aladesanmi, Joseph A; Ukponmwan, Eghe O

2013-01-01

This study attempted to elucidate the neurotransmitter systems involved in the neurophysiological properties of ethanolic extract, fractions and pure isolates of Spondias mombin leaves in mice (n = 6) after intraperitoneal (i.p.) route of administration.The crude ethanolic extract of Spondian mombin leaves was fractionated using the partitioning method to obtain the ethylacetate, butanolic and aqueous fractions. Open column chromatographic fractionation of the ethylacetate fraction yielded seven sub-fractions, out of which the pure coumaroyl, quercetin and gallic acid derivatives were obtained after purification on Sephadex LH 20. The ethanolic extract, butanolic fraction, ethylacetate subfractions and pure isolates of the Spondian mombin leaves were tested on novelty-induced rearing and grooming behaviours in mice with standard pharmacological tools using the open field method. The extract and its fractions decreased novelty-induced rearing in a dose-dependent manner. While the Coumaroyl derivative had no effect on novelty-induced rearing, it significantly reversed the inhibitory effect of yohimbine, propranolol and haloperidol on novelty-induced rearing. Quercetin significantly potentiated the inhibitory effect of yohimbine on novelty-induced rearing. Naloxone significantly potentiated the quercetin-induced suppression of novelty-induced rearing. Gallic acid derivative significantly potentiated the inhibitory effect of yohimbine on novelty-induced rearing. Naloxone, atropine and haloperidol pretreatments significantly potentiated gallic acid derivative-induced suppression of novelty-induced rearing.The extract and its fractions had biphasic effect on novelty-induced grooming in mice. Coumaroyl derivative significantly increased novelty-induced grooming, while quercetin and gallic acid derivative decreased novelty-induced grooming significantly. The three pure isolates significantly reversed the effects of yohimbine and atropine on the novelty-induced grooming in

Zr{sub 61}Ti{sub 2}Cu{sub 25}Al{sub 12} metallic glass for potential use in dental implants: Biocompatibility assessment by in vitro cellular responses

Energy Technology Data Exchange (ETDEWEB)

Li, Jing [School of Stomatology, China Medical University, 117 Nanjing North Sreet, Shenyang, 110002 (China); Shi, Ling-ling; Zhu, Zhen-dong; He, Qiang [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang, 110016 (China); Ai, Hong-jun, E-mail: aih0620@yahoo.com.cn [School of Stomatology, China Medical University, 117 Nanjing North Sreet, Shenyang, 110002 (China); Xu, Jian, E-mail: jianxu@imr.ac.cn [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang, 110016 (China)

2013-05-01

In comparison with titanium and its alloys, Zr{sub 61}Ti{sub 2}Cu{sub 25}Al{sub 12} (ZT1) bulk metallic glass (BMG) manifests a good combination of high strength, high fracture toughness and lower Young's modulus. To examine its biocompatibility required for potential use in dental implants, this BMG was used as a cell growth subtract for three types of cell lines, L929 fibroblasts, human umbilical vein endothelial cells (HUVEC), and osteoblast-like MG63 cells. For a comparison, these cell lines were in parallel cultured and grown also on commercially pure titanium (CP-Ti) and Ti6–Al4–V alloy (Ti64). Cellular responses on the three metals, including adhesion, morphology and viability, were characterized using the SEM visualization and CCK-8 assay. Furthermore, real-time RT-PCR was used to measure the activity of integrin β, alkaline phosphatase (ALP) and type I collagen (COL I) in adherent MG63 cells. As indicated, in all cases of three cell lines, no significant differences in the initial attachment and viability/proliferation were found between ZT1, CP-Ti, and Ti64 until 5 d of incubation period. It means that the biocompatibility in cellular response for ZT1 BMG is comparable to Ti and its alloys. For gene expression of integrin β, ALP and COL I, mRNA level from osteoblast cells grown on ZT1 substrates is significantly higher than that on the CP-Ti and Ti64. It suggests that the adhesion and differentiation of osteoblasts grown on ZT1 are even superior to those on the CP-Ti and Ti64 alloy, then promoting bone formation. The good biocompatibility of ZT1 BMG is associated with the formation of zirconium oxide layer on the surface and good corrosion-resistance in physiological environment. Quantitative analysis of Real-time PCR for MG63 cells cultured on Zr{sub 61}Ti{sub 2}Cu{sub 25}Al{sub 12} BMG, CP-Ti, and Ti64 as well as plastic as a control at several incubation periods. Relative amounts of (a) integrin β, (b) ALP, and (c) COL I (*p < 0

Investigation of cellular microstructure and enhanced coercivity in sputtered Sm{sub 2}(CoCuFeZr){sub 17} film

Energy Technology Data Exchange (ETDEWEB)

Bhatt, Ranu, E-mail: rbhatt@barc.gov.in; Schütz, G. [Max Planck Institute for Intelligent Systems (formerly Max Planck Institute for Metals Research), Heisenbergstr. 3, 70569 Stuttgart (Germany); Bhatt, Pramod [Solid State Physics Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India)

2014-03-14

We have investigated the effect of annealing temperature on the microstructure and magnetic properties of Sm{sub 2}(CoCuFeZr){sub 17} films prepared using ion beam sputtering at room temperature. The as-deposited film shows randomly oriented polycrystalline grains and exhibits small coercivity (H{sub C}) of 0.04 T at room temperature. Post annealing of these films at 700 °C under Ar atmosphere shows significant changes in the microstructure transforming it to the development of cellular growth, concomitant with enhanced coercivity up to 1.3 T. The enhanced coercivity is explained using the domain wall pinning mechanism.

Studies on proinsulin and proglucagon biosynthesis and conversion at the subcellular level: I. Fractionation procedure and characterization of the subcellular fractions

Science.gov (United States)

Noe, BD; Baste, CA; Bauer, GE

1977-01-01

Anglerfish islets were homogenized in 0.25 M sucrose and separated into seven separate subcellular fractions by differential and discontinuous density gradient centrifugation. The objective was to isolate microsomes and secretory granules in a highly purified state. The fractions were characterized by electron microscopy and chemical analyses. Each fraction was assayed for its content of protein, RNA, DNA, immunoreactive insulin (IRI), and immunoreactive glucagon (IRG). Ultrastructural examination showed that two of the seven subcellular fractions contain primarily mitochondria, and that two others consist almost exclusively of secretory granules. A fifth fraction contains rough and smooth microsomal vesicles. The remaining two fractions are the cell supernate and the nuclei and cell debris. The content of DNA and RNA in all fractions is consistent with the observed ultrastructure. More than 82 percent of the total cellular IRI and 89(percent) of the total cellular IRG are found in the fractions of secretory granules. The combined fractions of secretory granules and microsomes consistently yield >93 percent of the total IRG. These results indicate that the fractionation procedure employed yields fractions of microsomes and secretory granules that contain nearly all the immunoassayable insulin and glucagons found in whole islet tissue. These fractions are thus considered suitable for study of proinsulin and proglucagon biosynthesis and their metabolic conversion at the subcellular level. PMID:328517

DNA supercoiling: changes during cellular differentiation and activation of chromatin transcription

International Nuclear Information System (INIS)

Luchnik, A.N.; Bakayev, V.V.; Glaser, V.M.; Moscow State Univ., USSR)

1983-01-01

In this paper it is reported that elastic DNA torsional tension has been observed in a fraction of isolated SV40 minichromosomes, which are shown to be transcriptionally active, and that the number of DNA topological (titratable superhelical) turns in closed superhelical loops of nuclear DNA decreases during cellular differentiation, which, we propose, may be responsible for the coordinate switch in transcription of genes controlling cellular proliferation. 37 references, 6 figures, 2 tables

Pre-fractionation strategies to resolve pea (Pisum sativum sub-proteomes

Directory of Open Access Journals (Sweden)

Claudia Nicole Meisrimler

2015-10-01

Full Text Available Legumes are important crop plants and pea (Pisum sativum L. has been investigated as a model with respect to several physiological aspects. The sequencing of the pea genome has not been completed. Therefore, proteomic approaches are currently limited. Nevertheless, the increasing numbers of available EST-databases as well as the high homology of the pea and medicago genome (Medicago truncatula G. allow the successful identification of proteins. Due to the un-sequenced pea genome, pre-fractionation approaches have been used in pea proteomic surveys in the past. Aside from a number of selective proteome studies on crude extracts and the chloroplast, few studies have targeted other components such as the pea secretome, an important sub-proteome of interest due to its role in abiotic and biotic stress processes. The secretome itself can be further divided into different sub-proteomes (plasma membrane, apoplast, cell wall proteins. Cell fractionation in combination with different gel-electrophoresis, chromatography methods and protein identification by mass spectrometry are important partners to gain insight into pea sub-proteomes, post-translational modifications and protein functions. Overall, pea proteomics needs to link numerous existing physiological and biochemical data to gain further insight into adaptation processes, which play important roles in field applications. Future developments and directions in pea proteomics are discussed.

Isolation and characterisation of in vitro and cellular free radical scavenging peptides from corn peptide fractions.

Science.gov (United States)

Wang, Liying; Ding, Long; Wang, Ying; Zhang, Yan; Liu, Jingbo

2015-02-16

Corn gluten meal, a corn processing industry by-product, is a good source for the preparation of bioactive peptides due to its special amino acid composition. In the present study, the in vitro and cellular free radical scavenging activities of corn peptide fractions (CPFs) were investigated. Results indicated that CPF1 (molecular weight less than 1 kDa) and CPF2 (molecular weight between 1 and 3 kDa) exhibited good hydroxyl radical, superoxide anion radical and 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulphonicacid) diammonium salt (ABTS) radical scavenging activity and oxygen radical absorbance capacity (ORAC). Meanwhile, the in vitro radical scavenging activity of CPF1 was slightly higher than that of CPF2. Both CPF1 and CPF2 also exhibited significant cytoprotective effects and intracellular reactive oxygen species scavenging activity in Caco-2 cells exposed to hydrogen peroxide (H2O2). The amino acid composition analysis revealed that the CPF were rich in hydrophobic amino acids, which comprised of more than 45% of total amino acids. An antioxidant peptide sequence of Tyr-Phe-Cys-Leu-Thr (YFCLT) was identified from CPF1 using matrix-assisted laser desorption/ionization time-of-flight/time-of-flight mass spectrometry (MALDI TOF/TOF MS). The YFCLT exhibited excellent ABTS radical scavenging activity with a 50% effective concentration (EC50) value of 37.63 µM, which was much lower than that of Trolox. In conclusion, corn gluten meal might be a good source to prepare antioxidant peptides.

Isolation and application of SO{sub X} and NO{sub X} resistant microalgae in biofixation of CO{sub 2} from thermoelectricity plants

Energy Technology Data Exchange (ETDEWEB)

Radmann, Elisangela Martha; Vieira Camerini, Felipe; Duarte Santos, Thaisa [Laboratory of Biochemical Engineering, College of Chemistry and Food Engineering, Federal University of Rio Grande (FURG), P.O. Box 474, Rio Grande-RS 96201-900 (Brazil); Vieira Costa, Jorge Alberto, E-mail: dqmjorge@furg.br [Laboratory of Biochemical Engineering, College of Chemistry and Food Engineering, Federal University of Rio Grande (FURG), P.O. Box 474, Rio Grande-RS 96201-900 (Brazil)

2011-09-15

Highlights: {yields} Microalgae can help reduce global warming. {yields} Synechococcus nidulans and Chlorella vulgaris were isolated in a thermoelectric plant. {yields} Microalgae were compared with Spirulina and Scenedesmus obliquus for CO{sub 2} fixation. {yields} Microalgae were exposed to CO{sub 2}, SO{sub 2} and NO, simulating a gas from coal combustion. {yields} C. vulgaris and Spirulina sp. showed 13.43% of maximum daily fixation. - Abstract: Microalgae have been studied for their potential use in foodstuffs, agriculture, in the treatment of wastewater and, in particular, in the reduction of atmospheric carbon dioxide, the main cause of global warming. Thermoelectricity plants account for 22% of CO{sub 2} emitted into the atmosphere and native microalgae may be more tolerant to the gases emitted from burning fossil fuels. In the study presented here, microalgae were isolated from ponds next to a Thermoelectricity Plant, located in southern Brazil, and identified as Synechococcus nidulans and Chlorella vulgaris. The isolated microalgae were grown and compared with two different strains of microalgae, Spirulina sp. and Scenedesmus obliquus, for CO{sub 2} biofixation. The microalgae were exposed to 12% CO{sub 2}, 60 ppm of SO{sub 2} and 100 ppm of NO, simulating a gas from coal combustion. The C. vulgaris had similar behavior to Spirulina sp., with 13.43% of maximum daily fixation. The microalgae with the greater fixing capacity were C. vulgaris and Spirulina sp. and these can be grown in electric power plants for CO{sub 2} biofixation of the coal combustion gas, which would help reduce global warming.

Intraspecies cellular fatty acids heterogeneity of Lactobacillus plantarum strains isolated from fermented foods in Ukraine.

Science.gov (United States)

Garmasheva, I; Vasyliuk, O; Kovalenko, N; Ostapchuk, A; Oleschenko, L

2015-09-01

The intraspecies heterogeneity of cellular fatty acids composition of Lactobacillus plantarum strains isolated from Ukrainian traditional fermented foods was examined. Seven cellular fatty acids were identified. All Lact. plantarum strains investigated contained C16:0 (from 7·54 to 49·83% of total fatty acids), cC18:1 (3·23-38·67% of total fatty acids) and cycC19:0 acids (9·03-67·68% of total fatty acids) as the major fatty acids. The tC18:1 acid made up 1·47-22·0% of the total fatty acids. The C14:0 and C16:1 acids were present in small amounts (0·22-6·96% and 0·66-7·42% respectively) in most Lact. plantarum strains. Differences in relative contents of some fatty acids between Lact. plantarum strains depending on the source isolation were found. Isolates of dairy origin contained slightly greater levels of the C16:0 and tC18:1 fatty acids and lower levels of the cC18:1 than strains obtained from fermented vegetables. The origin of Lact. plantarum strains affects their fatty acids composition, which in turn, appears to be related to their ability to growth under stress factors. Cellular fatty acids composition is an important chemotaxonomic characteristic of bacterial cells. At the same time cellular fatty acids play a key role in maintaining the viability of micro-organisms in different environmental conditions. In this study, intraspecies heterogeneity of cellular fatty acids composition of Lactobacillus plantarum strains was examined. This work provides novel and important information about a relationship between cellular fatty acids composition of Lact. plantarum strains and source of isolation or stress resistance profile. Our results showed that cellular fatty acids composition is quite diverse among Lact. plantarum strains derived from different sources and may reflect previous cell's history. Our findings should be considered in chemotaxonomic studies of lactic acid bacteria and its ecology. © 2015 The Society for Applied Microbiology.

Sequential Isolation of Saturated, Aromatic, Resinic and Asphaltic Fractions Degrading Bacteria from Oil Contaminated Soil in South Sumatera

Directory of Open Access Journals (Sweden)

Pingkan Aditiawati

2012-04-01

Full Text Available Sequential isolation has been conducted to obtain isolates of saturated, aromatic, resin, and asphaltene fractions degrading bacteria from oil contaminated sites. Five soil samples were collected from South Sumatera. These were analyzed using soil extract medium enriched with oil recovery or Remaining-Oil recovery Degradated (ROD as sole carbon and energy sources according to the isolation stage. ROD at the end of every isolation stage analyzed oil fractions by use of the SARA analysis method. Six isolates of bacteria have been selected, one isolate was fraction saturates degrading bacteria that are Mycobacterium sp. T1H2D4-7 at degradation rate 0.0199 mgs/h with density 8.4x106 cfu/g from stage I. The isolate T2H1D2-4, identified as Pseudomonas sp. was fraction aromatics degrading bacteria at accelerate 0.0141 mgs/h with density 5.1x106 cfu/g are obtained at stage II. Two isolates namely Micrococcus sp. T3H2D4-2 and Pseudomonas sp. T1H1D5-5 were fraction resins degrading bacteria by accelerate 0.0088 mgs/h at density 5.6x106 cfu/g and 0.0089 mgs/h at density 5.7x106 cfu/g are obtained at stage III. Isolation of stage IV has been obtained two isolates Pseudomonas sp. T4H1D3-1and Pseudomonas sp. T4H3D5-4 were fraction asphaltenes degrading bacteria by accelerate 0.0057 mgs/h at density 5.6x106 cfu/g and accelerate 0.0058 mgs/h at density 5.7x106 cfu/g.

Sequence analysis of sub-genotype D hepatitis B surface antigens isolated from Jeddah, Saudi Arabia

Directory of Open Access Journals (Sweden)

Sahar EL Hadad

2018-05-01

Full Text Available Little is known about the prevalence of HBV genotypes/sub-genotypes in Jeddah province, although the hepatitis B virus (HBV was identified as the most predominant type of hepatitis in Saudi Arabia. To characterize HBV genotypes/sub-genotypes, serum samples from 15 patients with chronic HBV were collected and subjected to HBsAg gene amplification and sequence analysis. Phylogenetic analysis of the HBsAg gene sequences revealed that 11 (48% isolates belonged to HBV/D while 4 (18% were associated with HBV/C. Notably, a HBV/D sub-genotype phylogenetic tree identified that eight current isolates (72% belonged to HBV/D1, whereas three isolates (28% appeared to be more closely related to HBV/D5, although they formed a novel cluster supported by a branch with 99% bootstrap value. Isolates belonging to D1 were grouped in one branch and seemed to be more closely related to various strains isolated from different countries. For further determination of whether the three current isolates belonged to HBV/D5 or represented a novel sub-genotype, HBV/DA, whole HBV genome sequences would be required. In the present study, we verified that HBV/D1 is the most prevalent HBV sub-genotype in Jeddah, and identified novel variant mutations suggesting that an additional sub-genotype designated HBV/DA should be proposed. Overall, the results of the present HBsAg sequence analyses provide us with insights regarding the nucleotide differences between the present HBsAg/D isolates identified in the populace of Jeddah, Saudi Arabia and those previously isolated worldwide. Additional studies with large numbers of subjects in other areas might lead to the discovery of the specific HBV strain genotypes or even additional new sub-genotypes that are circulating in Saudi Arabia. Keywords: Hepatitis B virus, HBV sub-genotypes, HBV/D, HBsAg, Viral isolates, Population studies

Cytotoxic activity of isolated constituents from leaves of Premna serratifolia on MCF-7 and HT-29 cell lines

Directory of Open Access Journals (Sweden)

Mahesh Biradi

2015-03-01

Full Text Available Premna serratifolia (Syn: Premna integrifolia is an important medicinal herb known as “Agnimantha” in Ayurveda and traditionally used for anticancer activity. The objective of present study was to isolate the cytotoxic phytoconstituents from the n-hexane soluble fraction of P. serratifolia leaf extract. Unsaponifiable portion of n-hexane soluble fraction was subjected to silica based column chromatography. The major constituents present in all the sub-fractions were identified by TLC and phytochemical tests. Two constituents were isolated and they were purified. Sub-fractions with isolates were tested for cytotoxic effect by BSL bioassay. Two isolates were found to be active and which were tested on cancer cell lines MCF-7 and HT-29 for their cytotoxicity. Among two isolates, one compound has shown significant cytotoxicity. From the results we conclude that the plant isolates showed cytotoxicity against selected human cancer cell lines.

Exact Solutions for Fractional Differential-Difference Equations by an Extended Riccati Sub-ODE Method

International Nuclear Information System (INIS)

Feng Qinghua

2013-01-01

In this paper, an extended Riccati sub-ODE method is proposed to establish new exact solutions for fractional differential-difference equations in the sense of modified Riemann—Liouville derivative. By a fractional complex transformation, a given fractional differential-difference equation can be turned into another differential-difference equation of integer order. The validity of the method is illustrated by applying it to solve the fractional Hybrid lattice equation and the fractional relativistic Toda lattice system. As a result, some new exact solutions including hyperbolic function solutions, trigonometric function solutions and rational solutions are established. (general)

Isolation, Fractionation and Characterization of Catalase from Neurospora crassa (InaCC F226)

Science.gov (United States)

Suryani; Ambarsari, L.; Lindawati, E.

2017-03-01

Catalase from Indigenous isolate Neurospora crassa InaCC F226 has been isolated, fractionated and characterized. Production of catalase by Neurospora crassa was done by using PDA medium (Potato Dextrosa Agar) and fractionated with ammonium sulphate with 20-80% saturation. Fraction 60% was optimum saturation of ammonium sulphate and had highest specific activity 3339.82 U/mg with purity 6.09 times, total protein 0.920 mg and yield 88.57%. The optimum pH and temperature for catalase activity were at 40°C and pH 7.0, respectively. The metal ions that stimulated catalase activity acted were Ca2+, Mn2+ and Zn2+, and inhibitors were EDTA, Mg2+ and Cu2+. Based on Km and Vmax values were 0.2384 mM and 13.3156 s/mM.

Large-scale isolation and fractionation of organs of Drosophila melanogaster larvae.

Science.gov (United States)

Zweidler, A; Cohen, L H

1971-10-01

Methods for the mass isolation of diverse organs from small animals are described. They involve novel devices: a mechanical dissecting system, a centrifugal agitator for the separation of fibrillar from globular particles, and a settling chamber for the fractionation at unit gravity of particles with sedimentation velocities above the useful range for centrifugation. The application of these methods to the isolation of polytene and nonpolytene nuclei from Drosophila melanogaster larvae is described.

Measurement of the inclusive branching fraction tau- → nu/sub tau/π-π0 + neutral meson(s)

International Nuclear Information System (INIS)

Moses, W.W.

1986-12-01

This dissertation measures an inclusive branching fraction of (13.9 +- 2.0/sub -2.4//sup +2.1/)% for the decay tau - → nu/sub tau/π - π 0 + nh 0 where h 0 is a π 0 or an eta and n ≥ 1. The data sample, obtained with the TPC detector facility at PEP, corresponds to an integrated luminosity of 72 pb -1 at 29 GeV center of mass energy. The measured value for this branching fraction is somewhat greater than the theoretical prediction and, taking errors into account, resolves the present difference between the inclusive and the sum of the exclusive tau - branching fractions into one charged prong. In addition, a lower limit of 8.3% (95% CL) is placed on the branching fraction B(tau - → nu/sub tau/π - π 0 π 0 )

Cellular metabolic rates from primary dermal fibroblast cells isolated from birds of different body masses.

Science.gov (United States)

Jimenez, Ana Gabriela; Williams, Joseph B

2014-10-01

The rate of metabolism is the speed at which organisms use energy, an integration of energy transformations within the body; it governs biological processes that influence rates of growth and reproduction. Progress at understanding functional linkages between whole organism metabolic rate and underlying mechanisms that influence its magnitude has been slow despite the central role this issue plays in evolutionary and physiological ecology. Previous studies that have attempted to relate how cellular processes translate into whole-organism physiology have done so over a range of body masses of subjects. However, the data still remains controversial when observing metabolic rates at the cellular level. To bridge the gap between these ideas, we examined cellular metabolic rate of primary dermal fibroblasts isolated from 49 species of birds representing a 32,000-fold range in body masses to test the hypothesis that metabolic rate of cultured cells scales with body size. We used a Seahorse XF-96 Extracellular flux analyzer to measure cellular respiration in fibroblasts. Additionally, we measured fibroblast size and mitochondrial content. We found no significant correlation between cellular metabolic rate, cell size, or mitochondrial content and body mass. Additionally, there was a significant relationship between cellular basal metabolic rate and proton leak in these cells. We conclude that metabolic rate of cells isolated in culture does not scale with body mass, but cellular metabolic rate is correlated to growth rate in birds. Copyright © 2014 Elsevier Inc. All rights reserved.

Spent UO{sub 2} TRISO coated particles. Instant release fraction and microstructure evolution

Energy Technology Data Exchange (ETDEWEB)

Curtius, Hildegard; Kaiser, Gabriele; Lieck, Norman; Guengoer, Murat; Klinkenberg, Martina; Bosbach, Dirk [Research Center Juelich (Germany). Inst. of Energy and Climate Research IEK-6: Nuclear Waste Management and Reactor Safety

2015-09-01

The impact of burn-up on the instant release fraction (IRF) from spent fuel was studied using very high burn-up UO{sub 2} fuel (∝ 100 GWd/t) from a prototype high temperature reactor (HTR). TRISO (TRi-structural-ISO-tropic) particles from the spherical fuel elements contain UO{sub 2} fuel kernels (500 μm diameter) which are coated by three tight layers ensuring the encapsulation of fission products during reactor operation. After cracking of the tight coatings {sup 85}Kr and {sup 14}C as {sup 14}CO{sub 2} were detected in the gas fraction. Xe was not detected in the gas fraction, although ESEM (Environmental Scanning Electron Microscope) investigations revealed an accumulation in the buffer. UO{sub 2} fuel kernels were exposed to synthetic groundwater under oxic and anoxic/reducing conditions. U concentration in the leachate was below the detection limit, indicating an extremely low matrix dissolution. Within the leach period of 276 d {sup 90}Sr and {sup 134/137}Cs fractions located at grain boundaries were released and contribution to IRF up to max. 0.2% respectively 8%. Depending on the environmental conditions, different release functions were observed. Second relevant release steps occurred in air after ∝ 120 d, indicating the formation of new accessible leaching sites. ESEM investigations were performed to study the impact of leaching on the microstructure. In oxic environment, numerous intragranular open pores acting as new accessible leaching sites were formed and white spherical spots containing Mo and Zr were identified. Under anoxic/reducing conditions numerous metallic precipitates (Mo, Tc and Ru) filling the intragranular pores and white spherical spots containing Mo and Zr, were detected. In conclusion, leaching in different geochemical environments influenced the speciation of radionuclides and in consequence the stability of neoformed phases, which has an impact on IRF.

Optically-controlled platforms for transfection and single- and sub-cellular surgery

DEFF Research Database (Denmark)

Villangca, Mark Jayson; Casey, Duncan; Glückstad, Jesper

2015-01-01

and specificity of optical trapping in conjunction with other modalities to perform single and sub-cellular surgery. These tools form highly tuneable platforms for the delivery or removal of material from cells of interest, but can simultaneously excite fluorescent probes for imaging purposes or plasmonic...... structures for very local heating. We discuss both the history and recent applications of the field, highlighting the key findings and developments over the last 40 years of biophotonics research....

Microfluidic Devices for Blood Fractionation

Directory of Open Access Journals (Sweden)

Chwee Teck Lim

2011-07-01

Full Text Available Blood, a complex biological fluid, comprises 45% cellular components suspended in protein rich plasma. These different hematologic components perform distinct functions in vivo and thus the ability to efficiently fractionate blood into its individual components has innumerable applications in both clinical diagnosis and biological research. Yet, processing blood is not trivial. In the past decade, a flurry of new microfluidic based technologies has emerged to address this compelling problem. Microfluidics is an attractive solution for this application leveraging its numerous advantages to process clinical blood samples. This paper reviews the various microfluidic approaches realized to successfully fractionate one or more blood components. Techniques to separate plasma from hematologic cellular components as well as isolating blood cells of interest including certain rare cells are discussed. Comparisons based on common separation metrics including efficiency (sensitivity, purity (selectivity, and throughput will be presented. Finally, we will provide insights into the challenges associated with blood-based separation systems towards realizing true point-of-care (POC devices and provide future perspectives.

The Antioxidant Properties of Pectin Fractions Isolated from Vegetables Using a Simulated Gastric Fluid

Directory of Open Access Journals (Sweden)

Vasily V. Smirnov

2017-01-01

Full Text Available The antioxidant properties of vegetable pectin fractions against intraluminal reactive oxygen species were elucidated in vitro in conjunction with their structural features. The pectin fractions were isolated using a simulated gastric fluid (pH 1.5, pepsin 0.5 g/L, 37°C, 4 h from fresh white cabbage, carrot, onion, and sweet pepper. The fraction from onion was found to inhibit the production of superoxide radicals by inhibiting the xanthine oxidase. The high molecular weight of onion pectin and a large number of galactose residues in its side chains appeared to participate in interaction with xanthine oxidase. All the isolated pectic polysaccharides were found to be associated with protein (2–9% and phenolics (0.5–0.7% as contaminants; these contaminants were shown to be responsible for the antioxidant effect of vegetable pectin fractions against the hydroxyl and 1,1-diphenyl-2-picrylhydrazyl radicals.

Determination of ABA-binding proteins contents in subcellular fractions isolated from cotton seedlings using radioimmunoanalysis

International Nuclear Information System (INIS)

Tursunkhodjayeva, F.M.

2004-01-01

Full text: Knowledge of plants' hormone receptor sites is essential to understanding of the principles of phytohormone action in cells and tissues. The hormone abscisic acid (ABA) takes part in many important physiological processes of plants, including water balance and resistance to salt stress. The detection of salt tolerance in the early stages of ontogenesis is desirable for effective cultivation of cotton. Usually such characteristics are determined visually after genetic analysis of hybrids over several generations. This classic method of genetics requires a long time to grow several generations of cotton plants. In this connection we study ABA-binding protein contents in subcellular fractions isolated from seedlings of several kinds of cotton with different tolerance to salt stress. The contents of ABA-binding protein in nuclei and chloroplasts fractions isolated from cotton seedlings were determined using radioimmunoanalysis. The subcellular fractions were prepared by ultracentrifugation in 0,25 - 2,2 M sucrose gradient. ABA-binding protein was isolated from cotton seedlings by affinity chromatography. The antibodies against ABA-binding protein of cotton were developed in rabbits according standard protocols. Than the antibodies were labelled by radioisotope J 125 according Greenwood et al. It was shown, that the nuclei and chloroplasts fractions isolated from cotton with high tolerance to salt stress contain ABA-binding protein up to 1,5-1,8 times more, than the same fractions from cotton with low tolerance to salt stress. So, the ABA-binding protein contents in cotton seedlings may be considered as a marker for screening of cotton kinds, which may potentially have high tolerance to salt stress

Isolation of an enriched plasma membrame subpellicular microtubule fraction of Leishmania mexicana amazonensis

Directory of Open Access Journals (Sweden)

Solange L. Timm

1980-01-01

Full Text Available A cell fractionation procedure previously developed for Trypanosoma cruzi was applied to isolated the plasma membrane of promastigotes of Leishania mexicana amazonensis. The cell, swollen in an hypotonic mediun, were disrupted in the presence of a nonionic detergent and the membrane fraction isolated by differencial centrifugation. Electron microscopy showed that the fraction consisted of pieces of the plasma membrane associated with subpellicular microtubules. It was also shown that this fraction is able to induce cell-mediated immune response in mice.Um método de fracionamento subcelular, previamente desenvolvido para Trypanosoma cruzi, foi aplicado para isolar a membrana plasmática de promastigotas de Leishmania mexicana amazonensis. As células, após turgimento em meio hipotônico, foram rompidas na presença de um detergente não iônico e a fração de membrana isolada por centrifugação diferencial. A microscopia eletrônica mostrou consistir a fração de fragmentos de membrana plasmática associados com microtúbulos subpeliculares. Foi também mostrado que esta fração era capaz de induzir resposta celular em camundongos.

Effects of sub-culturing on genetic and physiological parameters in different Beauveria bassiana isolates.

Science.gov (United States)

Eivazian Kary, Naser; Alizadeh, Zhila

2017-05-01

Beauveria bassiana is a fungus which is widely used as a biological insecticide to control a number of economically important insect pests. Knowledge of the genetic diversity of the isolates, understanding the underlying nature of these evolutionary phenomena and finding appropriate and simple screening tools play an important role in developing effective biocontrol agents. Here, we monitored changes of electrophoretic karyotype of small molecules of extrachromosomal DNAs, presumably mitochondrial DNA or plasmids in several individual isolates of B. bassiana during the forced in vitro evolution by continual subculture on artificial media and then we evaluated these changes on the virulence of the isolates. Through agarose gel electrophoresis of the small extrachromosomal DNAs molecules, we found that mutations accumulate quickly and obvious changes take place in extrachromosomal DNAs of some isolates, although this did not always occur. This plasticity in response to culturing pressure suggests that buffering capacity of fungal genome against mutations is isolate dependent. Following the forced evolution by sub-culturing, five discriminable electrophoretic karyotype of extrachromosomal DNAs was observed among isolates. The results showed that some isolates are prone to deep mutations, but during enforced sub-culturing some others have efficiently conserved genome. These differences are influensive in screening appropriate isolates for mass production as a keystone in biocontrol program. To determine the effects of these changes on isolate traits, virulence, germination rate and spore-bound Pr1 activity were assessed parallel to sub-culturing. The results clearly revealed that parallel to sub-culturing and in correlation with karyotypic changes, isolates significantly suffered from virulence, germination rate and spore-bound Pr1 activity deficiencies. Copyright © 2017 Elsevier Inc. All rights reserved.

Antidermatophytic and Toxicological Evaluations of Dichloromethane-Methanol Extract, Fractions and Compounds Isolated from Coula edulis

Directory of Open Access Journals (Sweden)

Jean De Dieu Tamokou

2011-06-01

Full Text Available Background: Coula edulis Bail (Olacaceae, is an evergreen tree growing to a height of 25-38 m. This study aimed at evaluating the antidermatophytic and toxicological properties of the stem bark of C. edulis extract as well as fractions and compounds isolated from it. Methods: The plant extract was prepared by maceration in CH2Cl2-MeOH (1:1 v/v. The fractionation of this extract was done by silica gel column chromatography. Antidermatophytic activities were assayed using agar dilution method. The acute and sub-acute toxicities of oral administrations of the extract were studied in rodents. Results: The crude extract of C. edulis displayed antidermatophytic activity against the tested microorganisms with highest activity against Microsporum audouinii and Trichophyton mentagrophytes. The fractionation enhanced the antidermatophytic activity in fraction F3 (MIC=0.62-1.25 mg/ml compared to the crude extract (MIC=1.25-5 mg/ml. Further fractionation and purification of the fractions F2 and F3 gave respectively 3-O-β-D-glucopyranoside of sitosterol (MIC=0.20-0.40 mg/ml and a mixture of β-sitosterol, stigmasterol and n-hexadecanoid acid (MIC=0.80 mg/ml. The median lethal doses (LD50 of the crude extract were 16.8 and 19.6 g/kg body weight (BW in male and female mice, respectively. At 200 mg/kg BW, there was a decrease in body weight gain, food and water consumptions. Gross anatomical analysis revealed white vesicles on the liver of the rats treated with the extract at 200 mg/kg BW. This dose also induced significant (P<0.05 changes on hematological and biochemical parameters in rats after 28 days of treatment. Conclusion: These data suggest that the CH2Cl2-MeOH (1:1 v/v extract of C. edulis stem bark possesses antidermatophytic properties. They also show that at high doses (≥ 200 mg/kg BW, the extract has significant hepatotoxic and nephrotoxic activities

Fractionation of whey protein isolate with supercritical carbon dioxide – process modeling and cost estimation

Science.gov (United States)

An economical and environmentally friendly whey protein fractionation process was developed using supercritical carbon dioxide (sCO2) as an acid to produce enriched fractions of alpha-lactalbumin (alpha-La) and beta-lactoglobulin (beta-Lg) from a commercial whey protein isolate (WPI) containing 55% ...

Grain boundary transport properties in YBa{sub 2}Cu{sub 3}O{sub x} coated conductors.

Energy Technology Data Exchange (ETDEWEB)

Berghuis, P.; Miller, D. J.; Kim, D. H.; Gray, K. E.; Feenstra, R.; Christen, D. K.

2000-11-02

Critical current data obtained as a function of magnetic field on an isolated grain boundary (GB) of a coated conductor and two other types of bicrystal GBs of YBa{sub 2}Cu{sub 3}O{sub x} show a peak in the critical current and an unusual hysteresis. These results provide support for a new mechanism for enhanced GB critical currents, arising from interactions of GB vortices with pinned Abrikosov vortices in the banks of a GB, as suggested by Gurevich and Cooley. A substantial fraction of this enhancement, which can exceed a factor of ten, also occurs upon surpassing the critical current of the grains after zero field cooling. A bulk GB and thin film GBs show qualitatively identical results.

AN ANALYSIS OF THE DEUTERIUM FRACTIONATION OF STAR-FORMING CORES IN THE PERSEUS MOLECULAR CLOUD

Energy Technology Data Exchange (ETDEWEB)

Friesen, R. K. [National Radio Astronomy Observatory, 520 Edgemont Rd., Charlottesville, VA 22903 (United States); Kirk, H. M. [Origins Institute, McMaster University, 1280 Main Street West, Hamilton, ON L8S 4M1 (Canada); Shirley, Y. L., E-mail: friesen@di.utoronto.ca [Steward Observatory, University of Arizona, 933 N. Cherry Ave., Tucson, AZ 85721 (United States)

2013-03-01

We have performed a pointed survey of N{sub 2}D{sup +} 2-1 and N{sub 2}D{sup +} 3-2 emission toward 64 N{sub 2}H{sup +}-bright starless and protostellar cores in the Perseus molecular cloud using the Arizona Radio Observatory Submillimeter Telescope and Kitt Peak 12 m telescope. We find a mean deuterium fractionation in N{sub 2}H{sup +}, R{sub D} = N(N{sub 2}D{sup +})/N(N{sub 2}H{sup +}), of 0.08, with a maximum R{sub D} = 0.2. In detected sources, we find no significant difference in the deuterium fractionation between starless and protostellar cores, nor between cores in clustered or isolated environments. We compare the deuterium fraction in N{sub 2}H{sup +} with parameters linked to advanced core evolution. We only find significant correlations between the deuterium fraction and increased H{sub 2} column density, as well as with increased central core density, for all cores. Toward protostellar sources, we additionally find a significant anticorrelation between R{sub D} and bolometric temperature. We show that the Perseus cores are characterized by low CO depletion values relative to previous studies of star-forming cores, similar to recent results in the Ophiuchus molecular cloud. We suggest that the low average CO depletion is the dominant mechanism that constrains the average deuterium fractionation in the Perseus cores to small values. While current equilibrium and dynamic chemical models are able to reproduce the range of deuterium fractionation values we find in Perseus, reproducing the scatter across the cores requires variation in parameters such as the ionization fraction or the ortho-to-para-H{sub 2} ratio across the cloud, or a range in core evolution timescales.

H{sub 2} Ortho-to-para Conversion on Grains: A Route to Fast Deuterium Fractionation in Dense Cloud Cores?

Energy Technology Data Exchange (ETDEWEB)

Bovino, S. [Hamburger Sternwarte, Universität Hamburg, Gojenbergsweg 112, D-21029 Hamburg (Germany); Grassi, T. [Centre for Star and Planet Formation, Niels Bohr Institute and Natural History Museum of Denmark, University of Copenhagen, Øster Voldgade 5-7, DK-1350 Copenhagen (Denmark); Schleicher, D. R. G. [Departamento de Astronomía, Facultad Ciencias Físicas y Matemáticas, Universidad de Concepción, Av. Esteban Iturra s/n Barrio Universitario, Casilla 160, Concepción (Chile); Caselli, P., E-mail: stefano.bovino@uni-hamburg.de [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany)

2017-11-10

Deuterium fractionation, i.e., the enhancement of deuterated species with respect to non-deuterated ones, is considered to be a reliable chemical clock of star-forming regions. This process is strongly affected by the ortho-to-para H{sub 2} ratio. In this Letter we explore the effect of the ortho–para (o–p) H{sub 2} conversion on grains on the deuteration timescale in fully-depleted dense cores, including the most relevant uncertainties that affect this complex process. We show that (i) the o–p H{sub 2} conversion on grains is not strongly influenced by the uncertainties on the conversion time and the sticking coefficient, and (ii) that the process is controlled by the temperature and the residence time of ortho-H{sub 2} on the surface, i.e., by the binding energy. We find that for binding energies between 330 and 550 K, depending on the temperature, the o–p H{sub 2} conversion on grains can shorten the deuterium fractionation timescale by orders of magnitude, opening a new route for explaining the large observed deuteration fraction D {sub frac} in dense molecular cloud cores. Our results suggest that the star formation timescale, when estimated through the timescale to reach the observed deuteration fractions, might be shorter than previously proposed. However, more accurate measurements of the binding energy are needed in order to better assess the overall role of this process.

A celiac cellular phenotype, with altered LPP sub-cellular distribution, is inducible in controls by the toxic gliadin peptide P31-43.

Directory of Open Access Journals (Sweden)

Merlin Nanayakkara

Full Text Available Celiac disease (CD is a frequent inflammatory intestinal disease, with a genetic background, caused by gliadin-containing food. Undigested gliadin peptides P31-43 and P57-68 induce innate and adaptive T cell-mediated immune responses, respectively. Alterations in the cell shape and actin cytoskeleton are present in celiac enterocytes, and gliadin peptides induce actin rearrangements in both the CD mucosa and cell lines. Cell shape is maintained by the actin cytoskeleton and focal adhesions, sites of membrane attachment to the extracellular matrix. The locus of the human Lipoma Preferred Partner (LPP gene was identified as strongly associated with CD using genome-wide association studies (GWAS. The LPP protein plays an important role in focal adhesion architecture and acts as a transcription factor in the nucleus. In this study, we examined the hypothesis that a constitutive alteration of the cell shape and the cytoskeleton, involving LPP, occurs in a cell compartment far from the main inflammation site in CD fibroblasts from skin explants. We analyzed the cell shape, actin organization, focal adhesion number, focal adhesion proteins, LPP sub-cellular distribution and adhesion to fibronectin of fibroblasts obtained from CD patients on a Gluten-Free Diet (GFD and controls, without and with treatment with A-gliadin peptide P31-43. We observed a "CD cellular phenotype" in these fibroblasts, characterized by an altered cell shape and actin organization, increased number of focal adhesions, and altered intracellular LPP protein distribution. The treatment of controls fibroblasts with gliadin peptide P31-43 mimics the CD cellular phenotype regarding the cell shape, adhesion capacity, focal adhesion number and LPP sub-cellular distribution, suggesting a close association between these alterations and CD pathogenesis.

Submicron and nano formulations of titanium dioxide and zinc oxide stimulate unique cellular toxicological responses in the green microalga Chlamydomonas reinhardtii

Energy Technology Data Exchange (ETDEWEB)

Gunawan, Cindy, E-mail: c.gunawan@unsw.edu.au [ARC Centre of Excellence for Functional Nanomaterials, School of Chemical Engineering, The University of New South Wales, Sydney, NSW (Australia); Sirimanoonphan, Aunchisa [ARC Centre of Excellence for Functional Nanomaterials, School of Chemical Engineering, The University of New South Wales, Sydney, NSW (Australia); Teoh, Wey Yang [Clean Energy and Nanotechnology (CLEAN) Laboratory, School of Energy and Environment, City University of Hong Kong, Kowloon, Hong Kong Special Administrative Region (Hong Kong); Marquis, Christopher P., E-mail: c.marquis@unsw.edu.au [School of Biotechnology and Biomolecular Sciences, The University of New South Wales, Sydney, NSW (Australia); Amal, Rose [ARC Centre of Excellence for Functional Nanomaterials, School of Chemical Engineering, The University of New South Wales, Sydney, NSW (Australia)

2013-09-15

Highlights: • Uptake of TiO{sub 2} solids by C. reinhardtii generates ROS as an early stress response. • Submicron and nanoTiO{sub 2} exhibit benign effect on cell proliferation. • Uptake of ZnO solids and leached zinc by C. reinhardtii inhibit the alga growth. • No cellular oxidative stress is detected with submicron and nano ZnO exposure. • The toxicity of particles is not necessarily mediated by cellular oxidative stress. -- Abstract: The work investigates the eco-cytoxicity of submicron and nano TiO{sub 2} and ZnO, arising from the unique interactions of freshwater microalga Chlamydomonas reinhardtii to soluble and undissolved components of the metal oxides. In a freshwater medium, submicron and nano TiO{sub 2} exist as suspended aggregates with no-observable leaching. Submicron and nano ZnO undergo comparable concentration-dependent fractional leaching, and exist as dissolved zinc and aggregates of undissolved ZnO. Cellular internalisation of solid TiO{sub 2} stimulates cellular ROS generation as an early stress response. The cellular redox imbalance was observed for both submicron and nano TiO{sub 2} exposure, despite exhibiting benign effects on the alga proliferation (8-day EC50 > 100 mg TiO{sub 2}/L). Parallel exposure of C. reinhardtii to submicron and nano ZnO saw cellular uptake of both the leached zinc and solid ZnO and resulting in inhibition of the alga growth (8-day EC50 ≥ 0.01 mg ZnO/L). Despite the sensitivity, no zinc-induced cellular ROS generation was detected, even at 100 mg ZnO/L exposure. Taken together, the observations confront the generally accepted paradigm of cellular oxidative stress-mediated cytotoxicity of particles. The knowledge of speciation of particles and the corresponding stimulation of unique cellular responses and cytotoxicity is vital for assessment of the environmental implications of these materials.

Influence of TiO{sub 2} nanoparticles on cellular antioxidant defense and its involvement in genotoxicity in HepG2 cells

Energy Technology Data Exchange (ETDEWEB)

Petkovic, Jana; Zegura, Bojana; Filipic, Metka, E-mail: metka.filipic@nib.si [Department of Genetic Toxicology and Cancer Biology, National Institute of Biology, SI-1000 Ljubljana (Slovenia)

2011-07-06

We investigated the effects of two types of TiO{sub 2} nanoparticles (<25 nm anatase, TiO{sub 2}-An; <100 nm rutile, TiO{sub 2}-Ru) on cellular antioxidant defense in HepG2 cells. We previously showed that in HepG2 cells, TiO{sub 2} nanoparticles are not toxic, although they induce oxidative DNA damage, production of intracellular reactive oxygen species, and up-regulation of mRNA expression of DNA-damage-responsive genes (p53, p21, gadd45{alpha} and mdm2). In the present study, we measured changes in mRNA expression of several antioxidant enzymes: catalase, superoxide dismutase, glutathione peroxidase, nitric oxide synthase, glutathione reductase and glutamate-cysteine ligase. As reduced glutathione has a central role in cellular antioxidant defense, we determined the effects of TiO{sub 2} nanoparticles on changes in the intracellular glutathione content. To confirm a role for glutathione in protection against TiO{sub 2}-nanoparticle-induced DNA damage, we compared the extent of TiO{sub 2}-nanoparticle-induced DNA damage in HepG2 cells that were glutathione depleted with buthionine-(S,R)-sulfoximine pretreatment and in nonglutathione-depleted cells. Our data show that both types of TiO{sub 2} nanoparticles up-regulate mRNA expression of oxidative-stress-related genes, with TiO{sub 2}-Ru being a stronger inducer than TiO{sub 2}-An. Both types of TiO{sub 2} nanoparticles also induce dose-dependent increases in intracellular glutathione levels, and in glutathione-depleted cells, TiO{sub 2}-nanoparticle-induced DNA damage was significantly greater than in nonglutathione-depleted cells. Interestingly, the glutathione content and the extent of DNA damage were significantly higher in TiO{sub 2}-An- than TiO{sub 2}-Ru-exposed cells. Thus, we show that TiO{sub 2} nanoparticles cause activation of cellular antioxidant processes, and that intracellular glutathione has a critical role in defense against this TiO{sub 2}-nanoparticle-induced DNA damage.

Antioxidant activity of cod (Gadus morhua) protein hydrolysates: Fractionation and characterisation of peptide fractions

DEFF Research Database (Denmark)

Farvin Habebullah, Sabeena; Andersen, Lisa Lystbæk; Otte, Jeanette

2016-01-01

This study aimed to characterise peptide fractions (>5 kDa, 3–5 kDa and fractions were dominated by Ala, Gly, Glu and Ser. The total amino acid composition had high proportions of Lys, Ala...... and Glu. The 3–5 kDa and fractions were further fractionated by size exclusion chromatography. All sub-fractions showed high Fe2+ chelating activity. The DPPH radical-scavenging activity of the 3–5 kDa fraction was exerted mainly by one sub-fraction dominated by peptides with masses below 600 Da....... The DPPH radical-scavenging activity of the fraction was exerted by sub-fractions with low molecular weight. The highest reducing power was found in a sub-fraction containing peptides rich in Arg, Tyr and Phe. Both free amino acids and low molecular weight peptides thus seemed to contribute...

Isolation and Characterization of Lactic Acid Bacteria (LAB) Produced Exo cellular Polysaccharide

International Nuclear Information System (INIS)

Meleigy, S.A.; Hendawy, W.S.

2009-01-01

Isolation and characterization of exo cellular polysaccharide was studied in order to evaluate some parameters in the synthesis of exo polysaccharide (EPS) and improve their production through submerged fermentation processes. Isolation strains Lactobacillus delbrueckii ssp bulgaricus (IS 1 ), Lactococcus lactis ssp cremoris (IS 2 ) and Lactobacillus delbrueckii ssp bulgaricus (IS 3 ) were studied in shake flasks using yeast extract, surfactants and different exposure doses of gamma irradiation.The optimum concentration of (EPS) formation (0.762 g/l) by Lactococcus lactis ssp cremoris (IS 2 ), 3.0 (g/l) yeast extract, 1.72 (g/l) at 0.5 (%) surfactant Triton X-100. Also, EPS (1.842 g/l) was produced when Lactococcus lactis ssp cremoris (IS 2 ) exposed to 0.2 kGy dose level.

Amplification of the uvrA gene product of Escherichia coli to 7% of cellular protein by linkage to the p/sub L/ promoter of pKC30

International Nuclear Information System (INIS)

Yoakum, G.H.; Yeung, A.T.; Mattes, W.B.; Grossman, L.

1982-01-01

Researchers have constructed a hybrid pKC30-uvrA plasmid (pGHY5003) in which transcription of the uvrA gene can be induced under p/sub L/ control to amplify the uvrA gene product to 7% of cellular protein. To construct pGHY5003, researchers developed a genetic selection using the basal level of expression (30 0 C) from p/sub L/ in thermosensitive cI857 lysogens to isolate appropriately tailored repair genes inserted at the Hpa I site of pKC30 from recombinant DNA mixtures with a variety of products. In addition, a post-uv-irradiation radiolabeling method was adapted to screen inserts for temperature-inducible polypeptide synthesis directed by transcription under p/sub L/ control rapidly. This should prove generally useful for isolating genes inserted at the Hpa I site of plasmid pKC30 with the following characteristics: (1) genetically functional hybrid plasmids selected from a large population of exonucleolytically tailored fragments ligated into Hpa I of pKC30 and (2) production of high-level amplification for the gene product of interest by screening for post-uv-irradiation temperature inducibility of polypeptides synthesized from hybrid plasmids. The level of amplification obtained for the uvrA gene product from pGHY5003 is approximately 10,000-fold higher than estimates of the level of uvrA protein in logarithmic phase Escherichia coli

High resolution of heterogeneity among human neutrophil granules: physical, biochemical, and ultrastructural properties of isolated fractions.

Science.gov (United States)

Rice, W G; Kinkade, J M; Parmley, R T

1986-08-01

Previous studies on the fractionation of human neutrophil granules have identified two major populations: myeloperoxidase (MPO)-containing azurophil, or primary, granules and MPO-deficient specific, or secondary, granules. Peripheral blood neutrophils from individual donors were lysed in sucrose-free media by either hypotonic shock or nitrogen cavitation. Using a novel two-gradient Percoll density centrifugation system, the granule-rich postnuclear supernatant was rapidly (ten minutes) and reproducibly resolved into 13 granule fractions (L1 through L8 and H1 through H5). Granule flotation and recentrifugation experiments on both continuous, self-generated and multiple-step gradients using individual and mixed isolated fractions demonstrated that the banding patterns were isopycnic and nonartifactual. Isolated granules were intact based on the findings that biochemical latency of several granule enzymes was greater than 95%, and thin-sectioned electron micrographs demonstrated intact granule profiles. Biochemical analyses of the granule marker proteins MPO, beta-glucuronidase, lysozyme, and lactoferrin indicated that a number of the fractions were related to the major azurophil and specific granule populations. Lactoferrin was found in ten of 13 fractions (L1 through L8, H1 to H2), whereas MPO was found in every fraction. Consistent with these biochemical data, all fractions exhibited varying degrees of heterogeneity based on ultrastructural morphology and cytochemistry, including diaminobenzidine (DAB) reactivity for peroxidase and periodate-thiocarbohydrazide-silver proteinate (PA-TCH-SP) staining for complex glycoconjugates. A variable but significant percentage (23% to 70%) of the granules in fractions L1 through L8 and H1 and H2 showed DAB reactivity, while about 90% of the granules in fractions H3 through H5 were peroxidase positive. These results demonstrated that DAB-reactive granules spanned the entire range of granule size and density. Ultrastructural PA

Structural characterization of phenolic compounds and antioxidant activity of the phenolic-rich fraction from defatted adlay (Coix lachryma-jobi L. var. ma-yuen Stapf) seed meal.

Science.gov (United States)

Wang, Lifeng; Chen, Chao; Su, Anxiang; Zhang, Yiyi; Yuan, Jian; Ju, Xingrong

2016-04-01

The current study aims to investigate the antioxidant activities of various extracts from defatted adlay seed meal (DASM) based on the oxygen radical absorbance capacity (ORAC) assay, peroxyl radical scavenging capacity (PSC) assay and cellular antioxidant activity (CAA) assay. Of all the fractions, the n-butanol fraction exhibited the highest antioxidant activity, followed by crude acetone extract and aqueous fractions. Of the three sub-fractions obtained by Sephadex LH-20 chromatography, sub-fraction 3 possessed the highest antioxidant activity and total phenolic content. There was a strong positive correlation between the total phenolic content and the antioxidant activity. Based on HPLC-DAD-ESI-MS/MS analysis, the most abundant phenolic acid in sub-fraction 3 of DASM was ferulic acid at 67.28 mg/g, whereas the predominant flavonoid was rutin at 41.11 mg/g. Of the major individual compounds in sub-fraction 3, p-coumaric acid exhibited the highest ORAC values, and quercetin exhibited the highest PSC values and CAA values. Copyright © 2015 Elsevier Ltd. All rights reserved.

Reduced Sleep During Social Isolation Leads to Cellular Stress and Induction of the Unfolded Protein Response.

Science.gov (United States)

Brown, Marishka K; Strus, Ewa; Naidoo, Nirinjini

2017-07-01

Social isolation has a multitude of negative consequences on human health including the ability to endure challenges to the immune system, sleep amount and efficiency, and general morbidity and mortality. These adverse health outcomes are conserved in other social species. In the fruit fly Drosophila melanogaster, social isolation leads to increased aggression, impaired memory, and reduced amounts of daytime sleep. There is a correlation between molecules affected by social isolation and those implicated in sleep in Drosophila. We previously demonstrated that acute sleep loss in flies and mice induced the unfolded protein response (UPR), an adaptive signaling pathway. One mechanism indicating UPR upregulation is elevated levels of the endoplasmic reticular chaperone BiP/GRP78. We previously showed that BiP overexpression in Drosophila led to increased sleep rebound. Increased rebound sleep has also been demonstrated in socially isolated (SI) flies. D. melanogaster were used to study the effect of social isolation on cellular stress. SI flies displayed an increase in UPR markers; there were higher BiP levels, increased phosphorylation of the translation initiation factor eIF2α, and increased splicing of xbp1. These are all indicators of UPR activation. In addition, the effects of isolation on the UPR were reversible; pharmacologically and genetically altering sleep in the flies modulated the UPR. The reduction in sleep observed in SI flies is a cellular stressor that results in UPR induction. © Sleep Research Society 2017. Published by Oxford University Press [on behalf of the Sleep Research Society]. All rights reserved. For permissions, please email: journals.permissions@oup.com

Measurement of the B -> X sub s (ell) sup + (ell) sup - Branching Fraction Using a Sum Over Exclusive Modes

CERN Document Server

Willocq, S

2003-01-01

We present a measurement of the branching fraction for the flavor-changing neutral current process B -> X sub s (ell) sup + (ell) sup - based on a sample of 88.9 x 10 sup 6 UPSILON(4S) -> B(bar B) events recorded with the BABAR detector at the PEP-II e sup + e sup - storage ring. The final state is reconstructed from pairs of electrons or muons and a hadronic system consisting of one K sup+- or K sub s sup 0 and up to two pions, with at most one pi sup 0. Summing over both lepton flavors, we observe a signal of 41 +- 10(stat) +- 2(syst) events with a statistical significance of 4.6 sigma. The inclusive branching fraction is determined to be BETA(B -> X sub s (ell) sup + (ell) sup -) = (6.3 +- 1.6(stat) sub - sub 1 sub . sub 5 sup + sup 1 sup . sup 8 (syst)) x 10 sup - sup 6 for m((ell) sup + (ell) sup -) > 0.2 GeV/c sup 2. All results are preliminary.

Quantifying the Sub-Cellular Distributions of Gold Nanospheres Uptaken by Cells through Stepwise, Site-Selective Etching.

Science.gov (United States)

Xia, Younan; Huo, Da

2018-04-10

A quantitative understanding of the sub-cellular distributions of nanoparticles uptaken by cells is important to the development of nanomedicine. With Au nanospheres as a model system, here we demonstrate, for the first time, how to quantify the numbers of nanoparticles bound to plasma membrane, accumulated in cytosol, and entrapped in lysosomes, respectively, through stepwise, site-selective etching. Our results indicate that the chance for nanoparticles to escape from lysosomes is insensitive to the presence of targeting ligand although ligand-receptor binding has been documented as a critical factor in triggering internalization. Furthermore, the presence of serum proteins is shown to facilitate the binding of nanoparticles to plasma membrane lacking the specific receptor. Collectively, these findings confirm the potential of stepwise etching in quantitatively analyzing the sub-cellular distributions of nanoparticles uptaken by cells in an effort to optimize the therapeutic effect. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Sub-cellular mRNA localization modulates the regulation of gene expression by small RNAs in bacteria

Science.gov (United States)

Teimouri, Hamid; Korkmazhan, Elgin; Stavans, Joel; Levine, Erel

2017-10-01

Small non-coding RNAs can exert significant regulatory activity on gene expression in bacteria. In recent years, substantial progress has been made in understanding bacterial gene expression by sRNAs. However, recent findings that demonstrate that families of mRNAs show non-trivial sub-cellular distributions raise the question of how localization may affect the regulatory activity of sRNAs. Here we address this question within a simple mathematical model. We show that the non-uniform spatial distributions of mRNA can alter the threshold-linear response that characterizes sRNAs that act stoichiometrically, and modulate the hierarchy among targets co-regulated by the same sRNA. We also identify conditions where the sub-cellular organization of cofactors in the sRNA pathway can induce spatial heterogeneity on sRNA targets. Our results suggest that under certain conditions, interpretation and modeling of natural and synthetic gene regulatory circuits need to take into account the spatial organization of the transcripts of participating genes.

Fractionation of whey protein isolate with supercritical carbon dioxide to produce enriched alpha-lactalbumin and beta-lactoglobulin food ingredients

Science.gov (United States)

A potentially economical and environmentally friendly whey protein fractionation process was developed using supercritical carbon dioxide (SCO2) as an acid to produce enriched fractions of alpha-lactalbumin (a-LA) and beta-lactoglobulin (b-LG) from whey protein isolate. To prepare the fractions, so...

A comparison of the compositional differences between humic fractions isolated by the IHSS and exhaustive extraction procedures

Science.gov (United States)

Chang, R. R.; Mylotte, R.; Hayes, M. H. B.; Mclnerney, R.; Tzou, Y. M.

2014-03-01

Humic substances (HSs), consisting, on the basis of solubilities in aqueous acid and basic media, of humic acids (HAs), fulvic acids (FAs), and humin (Hu), are the major components of soil organic matter (SOM). Most studies of soil/natural organic matter (SOM/NOM) have been carried out on extracts of soils in dilute sodium hydroxide solutions, the solvent used to extract the Standards of the International Humic Substances Society (IHSS). However, Hu, the major component in the classical definition of HSs, is insoluble in aqueous base and is not isolated by the traditional IHSS method. Recently, a sequential exhaustive extraction (SEE) process has been shown to be capable of isolating and separating the major components of the classically defined HSs from the soils of the temperate and tropical regions. The SEE system was used in the present study to isolate the HA/FA and Hu fractions from a subtropical volcanic Taiwanese soil. Chemical and compositional properties of these extracts were then compared with similarly obtained isolates from soils from the different climatic regions. Increases in the aliphatic relative to aromatic carbon contents were observed for both the HA and FA fractions when the pH values of the extraction media were increased. HAs and FAs isolated using the SEE method have spectroscopic profiles similar to those from the IHSS isolate; however, the cumulative extraction efficiency (%) of the SEE method (65 %) for the volcanic soil was much higher than for the traditional IHSS method (33 %). When the residual volcanic soil, following extractions once, three, and eight times with 0.1 M NaOH were then extracted with dimethyl sulphoxide (DMSO) plus concentrated sulphuric acid (the final solvent in the SEE sequence) it was seen that the content of crystalline polymethylene hydrocarbon (33 ppm 13C-NMR resonance in the Hu (or DMSO/acid)) extract increased relative to the amorphous methylene (30 ppm). That highlights the difficulty in dissolving the more

Nonlinear $q$-fractional differential equations with nonlocal and sub-strip type boundary conditions

Directory of Open Access Journals (Sweden)

Bashir Ahmad

2014-06-01

Full Text Available This paper is concerned with new boundary value problems of nonlinear $q$-fractional differential equations with nonlocal and sub-strip type boundary conditions. Our results are new in the present setting and rely on the contraction mapping principle and a fixed point theorem due to O'Regan. Some illustrative examples are also presented.

Cellular and molecular responses of E. fetida coelomocytes exposed to TiO{sub 2} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Bigorgne, Emilie, E-mail: emilie.bigorgne@univ-lorraine.fr; Foucaud, Laurent [Universite de Lorraine-Laboratoire des Interactions Ecotoxicologique Biodiversite Ecosystemes (LIEBE) (France); Caillet, Celine [Universite de Lorraine-Laboratoire Environnement et Mineralurgie (LEM) CNRS UMR7569 (France); Giamberini, Laure; Nahmani, Johanne [Universite de Lorraine-Laboratoire des Interactions Ecotoxicologique Biodiversite Ecosystemes (LIEBE) (France); Thomas, Fabien [Universite de Lorraine-Laboratoire Environnement et Mineralurgie (LEM) CNRS UMR7569 (France); Rodius, Francois [Universite de Lorraine-Laboratoire des Interactions Ecotoxicologique Biodiversite Ecosystemes (LIEBE) (France)

2012-07-15

An in vitro approach using coelomocytes of Eisenia fetida was investigated to evaluate toxicity of TiO{sub 2} nanoparticles. Coelomocytes were exposed to well-dispersed suspension of small aggregates (130 nm) of TiO{sub 2} nanoparticles (1-25 {mu}g/ml) during 4, 12 and 24 h. Intracellular localisation suggested that the main route of uptake was endocytosis. Cellular responses showed that TiO{sub 2} nanoparticles were not cytotoxic and had no effect on phagocytosis at any of the four concentrations for each time tested. Concerning molecular responses, an increase of fetidin and metallothionein mRNA expression was observed starting from 4 h of exposure. In contrast, expression of coelomic cytolytic factor mRNA decreased for 10 and 25 {mu}g/ml after 4 h. Superoxide dismutase, catalase and glutathione-S-transferase expression were not modified suggesting that oxidative stress was not induced by TiO{sub 2} in our experimental conditions. This in vitro approach showed that TiO{sub 2} nanoparticles were taken up by coelomocytes and they could modify the molecular response of immune and detoxification system.

Measurement of the differential branching fraction of the decay Λ{sub b}{sup 0}→Λμ{sup +}μ{sup −}

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Université, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andrews, J.E. [University of Maryland, College Park, MD (United States); and others

2013-08-09

The differential branching fraction of the decay Λ{sub b}{sup 0}→Λμ{sup +}μ{sup −} is measured as a function of the square of the dimuon invariant mass, q{sup 2}. A yield of 78±12Λ{sub b}{sup 0}→Λμ{sup +}μ{sup −} decays is observed using data, corresponding to an integrated luminosity of 1.0 fb{sup −1}, collected by the LHCb experiment at a centre-of-mass energy of 7 TeV. A significant signal is found in the q{sup 2} region above the square of the J/ψ mass, while at lower-q{sup 2} values upper limits are set on the differential branching fraction. Integrating the differential branching fraction over q{sup 2}, while excluding the J/ψ and ψ(2S) regions, gives a branching fraction of B(Λ{sub b}{sup 0}→Λμ{sup +}μ{sup −})=(0.96±0.16(stat)±0.13(syst)±0.21(norm))×10{sup −6}, where the uncertainties are statistical, systematic and due to the normalisation mode, Λ{sub b}{sup 0}→J/ψΛ, respectively.

Crystal structure of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O with isolated boron triangles

Energy Technology Data Exchange (ETDEWEB)

Topnikova, A. P.; Belokoneva, E. L., E-mail: elbel@geol.msu.ru; Dimitrova, O. V.; Volkov, A. S. [Moscow State University, Faculty of Geology (Russian Federation)

2016-11-15

Crystals of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O were prepared by hydrothermal synthesis. The crystals are orthorhombic, a = 7.2295(7) Å, b = 11.2523(8) Å, c = 5.1285(6) Å, Z = 2, sp. gr. C2mm (Amm2), R = 0.0253. The formula of the compound was derived from the structure determination. The Ce and Na atoms are coordinated by nine and six O atoms, respectively. The Ce position is split, and a small amount of Ce is incorporated into the Na1 site with the isomorphous substitution for Na. The anionic moieties exist as isolated BO{sub 3} and BO{sub 2}(OH) triangles. The planes of the BO{sub 2}(OH) triangles with mm2 symmetry are parallel to the ab plane. The planes of the BO{sub 3} triangles with m symmetry are perpendicular to the ab plane and are rotated in a diagonal way. The splitting of the Ce positions and the polar arrangement of the BO{sub 2}(OH) triangles, water molecules, and Na atoms are observed along the polar a axis. The new structure is most similar to the new borate NaCa{sub 4}[BO{sub 3}]{sub 3} (sp. gr. Ama2), in which triangles of one type are arranged in a polar fashion along the c axis. Weak nonlinear-optical properties of both polar borates are attributed to the quenching of the second-harmonic generation due to the mutually opposite orientation of two-thirds of B triangles in the unit cell.

Comparative studies on mitochondria isolated from neuron-enriched and glia-enriched fractions of rabbit and beef brain.

Science.gov (United States)

Hamberger, A; Blomstrand, C; Lehninger, A L

1970-05-01

Fractions enriched in neuronal and glial cells were obtained from dispersions of whole beef brain and rabbit cerebral cortex by large-scale density gradient centrifugation procedures. The fractions were characterized by appropriate microscopic observation. Mitochondria were then isolated from these fractions by differential centrifugation of their homogenates. The two different types of mitochondria were characterized with respect to certain enzyme activities, respiratory rate, rate of protein synthesis, and their buoyant density in sucrose gradients. The mitochondria from the neuron-enriched fraction were distinguished by a higher rate of incorporation of amino acids into protein, higher cytochrome oxidase activity, and a higher buoyant density in sucrose density gradients. Mitochondria from the glia-enriched fraction showed relatively high monoamine oxidase and Na(+)- and K(+)-stimulated ATPase activities. The rates of oxidation of various substrates and the acceptor control ratios did not differ appreciably between the two types of mitochondria. The difference in the buoyant density of mitochondria isolated from the neuron-enriched and glia-enriched cell fractions was utilized in attempts to separate neuronal and glial mitochondria from the mixed mitochondria obtained from whole brain homogenates in shallow sucrose gradients. The appearance of two peaks of cytochrome oxidase, monoamine oxidase, and protein concentration in such gradients shows the potential feasibility of such an approach.

Measurement of BETA(B sup 0 -> D* sub s sup + D* sup -) and Determination of the D sub s sup + -> phi pi sup + Branching Fraction with a Partial-Reconstruction Method

CERN Document Server

Covarelli, R

2003-01-01

The present model-independent measurements of the branching fractions BETA(B sup 0 -> D* sub s sup + D* sup -) and BETA(D sub s sup + -> phi pi sup +) based on 19.3 fb sup - sup 1 of data collected by the BABAR detector at the PEP-II e sup + e sup - B Factory. Neutral B-meson decays to the D* sub s sup + D* sup - final state are selected with a partial reconstruction of the D* sub s sup +; that is, only the D* sup - and the soft photon from the decay D* sub s sup + -> D sub s sup +gamma are reconstructed. The branching fraction BETA(B sup 0 -> D* sub s sup + D* sup -) is extracted from these event yields, while BETA(D sub s sup + -> phi pi sup +) is determined by combining this result with a previous measurement of the product BETA(B sup 0 -> D* sub s sup + D* sup -) x BETA(D sub s sup + -> phi pi sup +) with partial reconstruction of the D* sup -. They obtain the following preliminary results: BETA(B sup 0 -> D* sub s sup + D* sup -) = (1.50 +- 0.16 +- 0.12)%, BETA(D sub s sup + -> phi pi sup +) = (4.7 +- 0....

Stomatal responses to carbon dioxide of isolated epidermis from a C/sub 3/ plant, the Argenteum mutant of Pisum sativum L. , and a crassulacean-acid-metabolism plant Kalanchoe daigremontiana Hamet et Perr

Energy Technology Data Exchange (ETDEWEB)

Jewer, P.C.; Neales, T.F.; Incoll, L.D.

1985-01-01

The response of stomata in isolated epidermis to the concentration of CO/sub 2/ in the gaseous phase was examined in a C/sub 3/ species, the Argenteum mutant of Pisum sativum, and a crassulacean-acid-metabolism (CAM) species, Kalanchoe daigremontiana. Epidermis from leaves of both species was incubated on buffer solutions in the presence of air containing various volume fractions of CO/sub 2/ (0 to 10,000 x 10/sup -6/). In both species and in the light and in darkness, the effect of CO/sub 2/ was to inhibit stomatal opening, the maximum inhibition of opening occurring in the range 0 to 360 x 10/sup -6/. The inhibition of opening per unit change in concentration was greatest between volume fractions of 0 and 240 x 10/sup -6/. There was little further closure above the volume fraction of 360 x 10/sup -6/, i.e. approximately ambient concentration of CO/sub 2/. Thus, although leaves of CAM species may experience much higher internal concentrations of CO/sub 2/ in the light than those of C/sub 3/ plants, this does not affect the sensitivity of their stomata to CO/sub 2/ concentration or the range over which they respond. Stomatal responses to CO/sub 2/ were similar in both the light and the dark, indicating that effects of CO/sub 2/ on stomata occur via mechanisms which are independent of light. The responses of stomata to CO/sub 2/ in the gaseous phase took place without the treatments changing the pH of the buffered solutions. Thus, it is unlikely that CO/sub 2/ elicited stomatal movement by changing either the pH or the HCO/sub 3//sup -//CO/sub 3//sup 2 -/ equilibria. It is suggested that the concentration of dissolved unhydrated CO/sub 2/ may be the effector of stomatal movement and that its activity is related to its reactivity with amines.

In Silico and In Vitro Anticancer Activity of Isolated Novel Marker Compound from Chemically Modified Bioactive Fraction from Curcuma longa (NCCL).

Science.gov (United States)

Naqvi, Arshi; Malasoni, Richa; Gupta, Swati; Srivastava, Akansha; Pandey, Rishi R; Dwivedi, Anil Kumar

2017-10-01

Turmeric ( Curcuma longa ) is reported to possess wide array of biological activities. Herbal Medicament (HM) is a standardized hexane-soluble fraction of C. longa and is well known for its neuroprotective effect. In this study, we attempted to synthesize a novel chemically modified bioactive fraction from HM (NCCL) along with isolation and characterization of a novel marker compound (I). NCCL was prepared from HM. The chemical structure of the marker compound isolated from NCCL was determined from 1D/2D nuclear magnetic resonance, mass spectroscopy, and Fourier transform infrared. The compound so isolated was subjected to in silico and in vitro screenings to test its inhibitory effect on estrogen receptors. Molecular docking studies revealed that the binding poses of the compound I was energetically favorable. Among NCCL and compound I taken for in vitro studies, NCCL had exhibited good anti-cancer activity over compound I against MCF-7, MDA-MB-231, DU-145, and PC-3 cells. This is the first study about the synthesis of a chemically modified bioactive fraction which used a standardized extract since the preparation of the HM. It may be concluded that NCCL fraction having residual components induce more cell death than compound I alone. Thus, NCCL may be used as a potent therapeutic drug. In the present paper, a standardized hexane soluble fraction of Curcuma longa (HM) was chemically modified to give a novel bioactive fraction (NCCL). A novel marker compound was isolated from NCCL and was characerized using various spectral techniques. The compound so isolated was investigated for in-silico screenings. NCCL and isolated compound was subjected to in-vitro anti-cancer screenings against MCF 7, MDA MB 231 (breast adenocarcinoma) and DU 145 and PC 3 cell lines (androgen independent human prostate cancer cells). The virtual screenings reveals that isolated compound has shown favourable drug like properties. NCCL fraction having residual components induces more cell

Search for Wh Production Using High-P<sub>T> Isolated Like-Sign Dilepton Events in 1.96-TeV Proton-Antiproton Collisions

Energy Technology Data Exchange (ETDEWEB)

Wakisaka, Takayuki [Osaka City Univ. (Japan)

2009-04-01

The thesis describes search for the neutral Higgs production associated with the W boson using high-P<sub>T> isolated like-sign (LS) dilepton events in proton-antiproton collisions at a center-of-mass energy of 1.96 TeV.

The UL24 protein of herpes simplex virus 1 affects the sub-cellular distribution of viral glycoproteins involved in fusion

Energy Technology Data Exchange (ETDEWEB)

Ben Abdeljelil, Nawel; Rochette, Pierre-Alexandre; Pearson, Angela, E-mail: angela.pearson@iaf.inrs.ca

2013-09-15

Mutations in UL24 of herpes simplex virus type 1 can lead to a syncytial phenotype. We hypothesized that UL24 affects the sub-cellular distribution of viral glycoproteins involved in fusion. In non-immortalized human foreskin fibroblasts (HFFs) we detected viral glycoproteins B (gB), gD, gH and gL present in extended blotches throughout the cytoplasm with limited nuclear membrane staining; however, in HFFs infected with a UL24-deficient virus (UL24X), staining for the viral glycoproteins appeared as long, thin streaks running across the cell. Interestingly, there was a decrease in co-localized staining of gB and gD with F-actin at late times in UL24X-infected HFFs. Treatment with chemical agents that perturbed the actin cytoskeleton hindered the formation of UL24X-induced syncytia in these cells. These data support a model whereby the UL24 syncytial phenotype results from a mislocalization of viral glycoproteins late in infection. - Highlights: • UL24 affects the sub-cellular distribution of viral glycoproteins required for fusion. • Sub-cellular distribution of viral glycoproteins varies in cell-type dependent manner. • Drugs targeting actin microfilaments affect formation of UL24-related syncytia in HFFs.

Isolation of Kupffer Cells and Hepatocytes from a Single Mouse Liver

DEFF Research Database (Denmark)

Aparicio-Vergara, Marcela; Tencerova, Michaela; Morgantini, Cecilia

2017-01-01

Liver perfusion is a common technique used to isolate parenchymal and non-parenchymal liver cells for in vitro experiments. This method allows hepatic cells to be separated based on their size and weight, by centrifugation using a density gradient. To date, other methods allow the isolation of only...... one viable hepatic cellular fraction from a single mouse; either parenchymal (hepatocytes) or non-parenchymal cells (i.e., Kupffer cells or hepatic stellate cells). Here, we describe a method to isolate both hepatocytes and Kupffer cells from a single mouse liver, thereby providing the unique...... advantage of studying different liver cell types that have been isolated from the same organism....

HERSCHEL SURVEY OF GALACTIC OH{sup +}, H{sub 2}O{sup +}, AND H{sub 3}O{sup +}: PROBING THE MOLECULAR HYDROGEN FRACTION AND COSMIC-RAY IONIZATION RATE

Energy Technology Data Exchange (ETDEWEB)

Indriolo, Nick; Neufeld, D. A. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Gerin, M.; Falgarone, E. [LERMA, Observatoire de Paris, Ecole Normale Supérieure, PSL Research University, CNRS, UMR8112, F-75014 Paris (France); Schilke, P.; Chambers, E. T.; Ossenkopf, V. [I. Physikalisches Institut der Universität zu Köln, Zülpicher Str. 77, 50937 Köln (Germany); Benz, A. O. [Institute of Astronomy, ETH Zürich (Switzerland); Winkel, B.; Menten, K. M. [MPI für Radioastronomie, Bonn (Germany); Black, John H.; Persson, C. M. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-43992 Onsala (Sweden); Bruderer, S.; Van Dishoeck, E. F. [Max Planck Institut für Extraterrestrische Physik, Garching (Germany); Godard, B.; Lis, D. C. [Sorbonne Universités, UPMC Univ. Paris 06, UMR8112, LERMA, F-75005 Paris (France); Goicoechea, J. R. [Instituto de Ciencias de Materiales de Madrid (CSIC), E-28049 Cantoblanco, Madrid (Spain); Gupta, H. [California Institute of Technology, Pasadena, CA 91125 (United States); Sonnentrucker, P. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Van der Tak, F. F. S. [SRON Netherlands Institute for Space Research, Landleven 12, 9747 AD Groningen (Netherlands); and others

2015-02-10

In diffuse interstellar clouds the chemistry that leads to the formation of the oxygen-bearing ions OH{sup +}, H{sub 2}O{sup +}, and H{sub 3}O{sup +} begins with the ionization of atomic hydrogen by cosmic rays, and continues through subsequent hydrogen abstraction reactions involving H{sub 2}. Given these reaction pathways, the observed abundances of these molecules are useful in constraining both the total cosmic-ray ionization rate of atomic hydrogen (ζ{sub H}) and molecular hydrogen fraction (f{sub H{sub 2}}). We present observations targeting transitions of OH{sup +}, H{sub 2}O{sup +}, and H{sub 3}O{sup +} made with the Herschel Space Observatory along 20 Galactic sight lines toward bright submillimeter continuum sources. Both OH{sup +} and H{sub 2}O{sup +} are detected in absorption in multiple velocity components along every sight line, but H{sub 3}O{sup +} is only detected along 7 sight lines. From the molecular abundances we compute f{sub H{sub 2}} in multiple distinct components along each line of sight, and find a Gaussian distribution with mean and standard deviation 0.042 ± 0.018. This confirms previous findings that OH{sup +} and H{sub 2}O{sup +} primarily reside in gas with low H{sub 2} fractions. We also infer ζ{sub H} throughout our sample, and find a lognormal distribution with mean log (ζ{sub H}) = –15.75 (ζ{sub H} = 1.78 × 10{sup –16} s{sup –1}) and standard deviation 0.29 for gas within the Galactic disk, but outside of the Galactic center. This is in good agreement with the mean and distribution of cosmic-ray ionization rates previously inferred from H{sub 3}{sup +} observations. Ionization rates in the Galactic center tend to be 10-100 times larger than found in the Galactic disk, also in accord with prior studies.

Role of photophosphorylation in SO/sub 2/ and SO/sub 3//sup 2 -/ inhibition of photosynthesis in isolated chloroplasts

Energy Technology Data Exchange (ETDEWEB)

Cerovic, Z G; Kalezic, R; Plesnicar, M

1982-01-01

Sulphur dioxide inhibits noncyclic photophosphorylation in isolated envelope-free chloroplasts. This inhibition was shown to be reversible and competitive with phosphate, with an inhibitor constant of K/sub i/ = 0.8 mM. The same inhibition characteristics were observed when phosphoglycerate (PGA)- or ribulose-1,5-bisphosphate (RuBP)- dependent oxygen evolution was examined in a reconstituted chloroplast system in the presence of SO/sub 3//sup 2 -/. Using an ATP-regenerating system (phosphocreatine-creatine kinase), it was demonstrated that the inhibition of PGA-dependent oxygen evolution is solely the result of inhibited photophosphorylation. It is concluded that at low SO/sub 2/ and SO/sub 3//sup 2 -/ concentrations the inhibition of photophosphorylation is responsible for the inhibition of photosynthetic oxygen evolution.

Branching fraction and CP asymmetry of the decays B{sup +}→K{sub S}{sup 0}π{sup +} and B{sup +}→K{sub S}{sup 0}K{sup +}

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Université, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andrews, J.E. [University of Maryland, College Park, MD (United States); and others

2013-11-04

An analysis of B{sup +}→K{sub S}{sup 0}π{sup +} and B{sup +}→K{sub S}{sup 0}K{sup +} decays is performed with the LHCb experiment. The pp collision data used correspond to integrated luminosities of 1 fb{sup −1} and 2 fb{sup −1} collected at centre-of-mass energies of √(s)=7 TeV and √(s)=8 TeV, respectively. The ratio of branching fractions and the direct CP asymmetries are measured to be B(B{sup +}→K{sub S}{sup 0}K{sup +})/B(B{sup +}→K{sub S}{sup 0}π{sup +})=0.064±0.009 (stat.)±0.004 (syst.), A{sup CP}(B{sup +}→K{sub S}{sup 0}π{sup +})=−0.022±0.025 (stat.)±0.010 (syst.) and A{sup CP}(B{sup +}→K{sub S}{sup 0}K{sup +})=−0.21±0.14 (stat.)±0.01 (syst.). The data sample taken at √(s)=7 TeV is used to search for B{sub c}{sup +}→K{sub S}{sup 0}K{sup +} decays and results in the upper limit (f{sub c}⋅B(B{sub c}{sup +}→K{sub S}{sup 0}K{sup +}))/(f{sub u}⋅B(B{sup +}→K{sub S}{sup 0}π{sup +}))<5.8×10{sup −2} at 90% confidence level, where f{sub c} and f{sub u} denote the hadronisation fractions of a b{sup ¯} quark into a B{sub c}{sup +} or a B{sup +} meson, respectively.

Sub-cellular localisation of a 15N-labelled peptide vector using NanoSIMS imaging

Science.gov (United States)

Römer, Winfried; Wu, Ting-Di; Duchambon, Patricia; Amessou, Mohamed; Carrez, Danièle; Johannes, Ludger; Guerquin-Kern, Jean-Luc

2006-07-01

Dynamic SIMS imaging is proposed to map sub-cellular distributions of isotopically labelled, exogenous compounds. NanoSIMS imaging allows the characterisation of the intracellular transport pathways of exogenous molecules, including peptide vectors employed in innovative therapies, using stable isotopes as molecular markers to detect the compound of interest. Shiga toxin B-subunit (STxB) was chosen as a representative peptide vector. The recombinant protein ( 15N-STxB) was synthesised in Escherichia coli using 15NH 4Cl as sole nitrogen source resulting in 15N enrichment in the molecule. Using the NanoSIMS 50 ion microprobe (Cameca), different ion species ( 12C 14N -, 12C 15N -, 31P -) originating from the same sputtered micro volume were simultaneously detected. High mass resolving power enabled the discrimination of 12C 15N - from its polyatomic isobars of mass 27. We imaged the membrane binding and internalisation of 15N-STxB in HeLa cells at spatial resolutions of less than 100 nm. Thus, the use of rare stable isotopes like 15N with dynamic SIMS imaging permits sub-cellular detection of isotopically labelled, exogenous molecules and imaging of their transport pathways at high mass and spatial resolution. Application of stable isotopes as markers can replace the large and chemically complex tags used for fluorescence microscopy, without altering the chemical and physical properties of the molecule.

Isolation and characterization of biochar-derived organic matter fractions and their phenanthrene sorption.

Science.gov (United States)

Jin, Jie; Sun, Ke; Liu, Wei; Li, Shiwei; Peng, Xianqiang; Yang, Yan; Han, Lanfang; Du, Ziwen; Wang, Xiangke

2018-05-01

Chemical composition and pollutant sorption of biochar-derived organic matter fractions (BDOMs) are critical for understanding the long-term environmental significance of biochar. Phenanthrene (PHE) sorption by the humic acid-like (HAL) fractions isolated from plant straw- (PLABs) and animal manure-based (ANIBs) biochars, and the residue materials (RES) after HAL extraction was investigated. The HAL fraction comprised approximately 50% of organic carbon (OC) of the original biochars. Results of XPS and 13 C NMR demonstrated that the biochar-derived HAL fractions mainly consisted of aromatic clusters substituted by carboxylic groups. The CO 2 cumulative surface area of BDOMs excluding PLAB-derived RES fractions was obviously lower than that of corresponding biochars. The sorption nonlinearity of PHE by the fresh biochars was significantly stronger than that of the BDOM fractions, implying that the BDOM fractions were more chemically homogeneous. The BDOMs generally exhibited comparable or higher OC-normalized distribution coefficients (K oc ) of PHE than the original biochars. The PHE logK oc values of the fresh biochars correlated negatively with the micropore volumes due to steric hindrance effect. In contrast, a positive relationship between the sorption coefficients (K d ) of BDOMs and the micropore volumes was observed in this study, suggesting that pore filling could dominate PHE sorption by the BDOMs. The positive correlation between the PHE logK oc values of the HAL fractions and the aromatic C contents indicates that PHE sorption by the HAL fractions was regulated by aromatic domains. The findings of this study improve our knowledge of the evolution of biochar properties after application and its potential environmental impacts. Copyright © 2018 Elsevier Ltd. All rights reserved.

Anticonvulsant Effects of Fractions Isolated from Dinoponera quadriceps (Kempt Ant Venom (Formicidae: Ponerinae

Directory of Open Access Journals (Sweden)

Diana Aline Morais Ferreira Nôga

2016-12-01

Full Text Available Natural products, sources of new pharmacological substances, have large chemical diversity and architectural complexity. In this context, some toxins obtained from invertebrate venoms have anticonvulsant effects. Epilepsy is a neurological disorder that affects about 65 million people worldwide, and approximately 30% of cases are resistant to pharmacological treatment. Previous studies from our group show that the denatured venom of the ant Dinoponera quadriceps (Kempt protects mice against bicuculline (BIC-induced seizures and death. The aim of this study was to investigate the anticonvulsant activity of compounds isolated from D. quadriceps venom against seizures induced by BIC in mice. Crude venom was fractionated by high-performance liquid chromatography (HPLC resulting in six fractions referred to as DqTx1–DqTx6. A liquid chromatography-mass spectrometry (LC/MS analysis revealed a major 431 Da compound in fractions DqTx1 and DqTx2. Fractions DqTx3 and DqTx4 showed a compound of 2451 Da and DqTx5 revealed a 2436 Da compound. Furthermore, the DqTx6 fraction exhibited a major component with a molecular weight of 13,196 Da. Each fraction (1 mg/mL was microinjected into the lateral ventricle of mice, and the animals were observed in an open field. We did not observe behavioral alterations when the fractions were given alone. Conversely, when the fractions were microinjected 20 min prior to the administration of BIC (21.6 nM, DqTx1, DqTx4, and DqTx6 fractions increased the latency for onset of tonic-clonic seizures. Moreover, all fractions, except DqTx5, increased latency to death. The more relevant result was obtained with the DqTx6 fraction, which protected 62.5% of the animals against tonic-clonic seizures. Furthermore, this fraction protected 100% of the animals from seizure episodes followed by death. Taken together, these findings indicate that compounds from ant venom might be a potential source of new anticonvulsants molecules.

Visualizing Escherichia coli sub-cellular structure using sparse deconvolution Spatial Light Interference Tomography.

Directory of Open Access Journals (Sweden)

Mustafa Mir

Full Text Available Studying the 3D sub-cellular structure of living cells is essential to our understanding of biological function. However, tomographic imaging of live cells is challenging mainly because they are transparent, i.e., weakly scattering structures. Therefore, this type of imaging has been implemented largely using fluorescence techniques. While confocal fluorescence imaging is a common approach to achieve sectioning, it requires fluorescence probes that are often harmful to the living specimen. On the other hand, by using the intrinsic contrast of the structures it is possible to study living cells in a non-invasive manner. One method that provides high-resolution quantitative information about nanoscale structures is a broadband interferometric technique known as Spatial Light Interference Microscopy (SLIM. In addition to rendering quantitative phase information, when combined with a high numerical aperture objective, SLIM also provides excellent depth sectioning capabilities. However, like in all linear optical systems, SLIM's resolution is limited by diffraction. Here we present a novel 3D field deconvolution algorithm that exploits the sparsity of phase images and renders images with resolution beyond the diffraction limit. We employ this label-free method, called deconvolution Spatial Light Interference Tomography (dSLIT, to visualize coiled sub-cellular structures in E. coli cells which are most likely the cytoskeletal MreB protein and the division site regulating MinCDE proteins. Previously these structures have only been observed using specialized strains and plasmids and fluorescence techniques. Our results indicate that dSLIT can be employed to study such structures in a practical and non-invasive manner.

Matrix isolation and theoretical study of the photochemical reactions of C{sub 2}H{sub 3}Br and 1,2-C{sub 2}H{sub 2}Br{sub 2} with CrO{sub 2}Cl{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Lemon, Christine E. [Department of Chemistry, University of Cincinnati, P.O. Box 210172, Cincinnati, OH 45221 (United States); Goldberg, Nicola [Department of Chemistry, University of Cincinnati, P.O. Box 210172, Cincinnati, OH 45221 (United States); Klein-Riffle, Evan T. [Department of Chemistry, University of Cincinnati, P.O. Box 210172, Cincinnati, OH 45221 (United States); Kronberg, Jon K. [Department of Chemistry, University of Cincinnati, P.O. Box 210172, Cincinnati, OH 45221 (United States); Ault, Bruce S. [Department of Chemistry, University of Cincinnati, P.O. Box 210172, Cincinnati, OH 45221 (United States)], E-mail: bruce.ault@uc.edu

2006-08-01

The matrix-isolation technique has been combined with infrared spectroscopy and theoretical calculations to characterize the products of the photochemical reactions of C{sub 2}H{sub 3}Br and 1,2-C{sub 2}H{sub 2}Br{sub 2} with CrO{sub 2}Cl{sub 2}. For these systems, oxygen-atom transfer occurred upon visible-near ultraviolet irradiation, yielding bromoacetaldehyde and CrOCl{sub 2} in the former case and bromoacetyl bromide and CrCl{sub 2}O in the latter. For each system, the products were formed in the same matrix cage and strongly interacted to form a distinct molecular complex. No evidence was obtained for the acetyl bromide derivative in the C{sub 2}H{sub 3}Br system, indicating the occurrence of oxygen-atom attack at the less substituted carbon of vinyl bromide, nor was any evidence obtained for the formation of a possible five-membered metallocycle. Two different modes of interaction were explored computationally: {eta}{sup 1} (end-on) to the oxygen atom and {eta}{sup 2} (side-on) to the C=O bond. Theoretical calculations indicated that the {eta}{sup 1} complex of CH{sub 2}BrCHO-CrCl{sub 2}O was 13 kcal mol{sup -1} more stable than the {eta}{sup 2} complex at the B3LYP/6-311++G(d,2p) level of theory. The binding energy of the {eta}{sup 1} complex was found to be 21 kcal mol{sup -1}, compared to 8 kcal mol{sup -1} for the {eta}{sup 2} complex at this level of theory.

Contribution of effluent organic matter (EfOM) to ultrafiltration (UF) membrane fouling: Isolation, characterization, and fouling effect of EfOM fractions

KAUST Repository

Zheng, Xing

2014-11-01

EfOM has been regarded as a major organic foulant resulting in UF membrane fouling in wastewater reclamation. To investigate fouling potential of different EfOM fractions, the present study isolated EfOM into hydrophobic neutrals (HPO-N), colloids, hydrophobic acids (HPO-A), transphilic neutrals and acids (TPI), and hydrophilics (HPI), and tested their fouling effect in both salt solution and pure water during ultrafiltration (UF). Major functional groups and chemical structure of the isolates were identified using Fourier transform infrared spectroscopy (FT-IR) and solid-state carbon nuclear magnetic resonance (13C NMR) analysis. The influence of the isolation process on the properties of EfOM fractions was minor because the raw and reconstituted secondary effluents were found similar with respect to UV absorbance, molecular size distribution, and fluorescence character. In membrane filtration tests, unified membrane fouling index (UMFI) and hydraulic resistance were used to quantify irreversible fouling potential of different water samples. Results show that under similar DOC level in feed water, colloids present much more irreversible fouling than other fractions. The fouling effect of the isolates is related to their size, chemical properties, and solution chemistry. Further investigations have identified that the interaction between colloids and other fractions also influences the performance of colloids in fouling phenomena. © 2014 Elsevier Ltd.

Sub-cellular partitioning of Zn, Cu, Cd and Pb in the digestive gland of native Octopus vulgaris exposed to different metal concentrations (Portugal)

Energy Technology Data Exchange (ETDEWEB)

Raimundo, J. [National Institute for Agronomy and Fisheries Research - IPIMAR, Av. Brasilia, 1449-006 Lisbon (Portugal)], E-mail: jraimundo@ipimar.pt; Vale, C. [National Institute for Agronomy and Fisheries Research - IPIMAR, Av. Brasilia, 1449-006 Lisbon (Portugal); Duarte, R.; Moura, I. [REQUIMTE - CQFB, Department of Chemistry, Faculty of Sciences and Technology, New University of Lisbon, Qta Torre, 2829-516 Monte da Caparica (Portugal)

2008-02-15

Concentrations of Zn, Cu, Cd and Pb and their sub-cellular distributions were determined in composite samples of digestive glands of the common octopus, Octopus vulgaris caught from two areas of the Portuguese coast characterised by contrasting metal contamination. Minor contents of Zn (1%), Cu (2%), Cd (6%) and Pb (7%) were found in the insoluble fraction, consisting of nuclei, mitochondria, lysosomes and microsome operationally separated from the whole digestive gland through a sequential centrifugation. A tendency for linear relationships between metal concentrations in nuclei, mitochondria, lysosomes and whole digestive gland was observed. These relationships suggest that despite low metal content organelles responded to the increasing accumulated metals, which means that detoxifying mechanism in cytosol was incomplete. Poorer correlations between microsome and whole digestive gland did not point to metal toxicity in the analysed compartments. However, the high accumulated Cd indicated that O. vulgaris is an important vehicle of this element to its predators in the coastal environment.

Sub-cellular partitioning of Zn, Cu, Cd and Pb in the digestive gland of native Octopus vulgaris exposed to different metal concentrations (Portugal)

International Nuclear Information System (INIS)

Raimundo, J.; Vale, C.; Duarte, R.; Moura, I.

2008-01-01

Concentrations of Zn, Cu, Cd and Pb and their sub-cellular distributions were determined in composite samples of digestive glands of the common octopus, Octopus vulgaris caught from two areas of the Portuguese coast characterised by contrasting metal contamination. Minor contents of Zn (1%), Cu (2%), Cd (6%) and Pb (7%) were found in the insoluble fraction, consisting of nuclei, mitochondria, lysosomes and microsome operationally separated from the whole digestive gland through a sequential centrifugation. A tendency for linear relationships between metal concentrations in nuclei, mitochondria, lysosomes and whole digestive gland was observed. These relationships suggest that despite low metal content organelles responded to the increasing accumulated metals, which means that detoxifying mechanism in cytosol was incomplete. Poorer correlations between microsome and whole digestive gland did not point to metal toxicity in the analysed compartments. However, the high accumulated Cd indicated that O. vulgaris is an important vehicle of this element to its predators in the coastal environment

Two-Photon Irradiation of an Intracellular Singlet Oxygen Photosensitizer: Achieving Localized Sub-Cellular Excitation in Spatially-Resolved Experiments

DEFF Research Database (Denmark)

Pedersen, Brian Wett; Breitenbach, Thomas; Redmond, Robert W.

2010-01-01

The response of a given cell to spatially-resolved sub-cellular irradiation of a singlet oxygen photosensitizer (protoporphyrin IX, PpIX) using a focused laser was assessed. In these experiments, incident light was scattered over a volume greater than that defi ned by the dimensions of the laser...

Measurement of branching fractions of B decays to K<sub>1sub>(1270)π and K<sub>1sub>(1400)π and determination of the CKM angle α from B⁰→ a<sub>1sub>(1260)^± π^∓

Energy Technology Data Exchange (ETDEWEB)

Stracka, Simone [Univ. of Milan (Italy)

2011-02-01

In the Standard Model, CP violation in weak interactions involving quarks is parameterized by an irreducible complex phase in the Cabibbo-Kobayashi-Maskawa (CKM) quark-mixing-matrix. The precise determination of the CKM elements is a necessary ingredient for a stringent test of the Standard Model predictions, and is a crucial input for reducing the theoretical error in many New Physics searches with flavor, e.g., in the kaon sector. The unitarity of the CKM matrix is typically expressed as a triangle relationship among its parameters, where the area of the so-called Unitarity Triangle visually depicts the amount of asymmetry between the decays of B particles and their antimatter counterparts. In the past few years, the BABAR and Belle experiments have been able to measure all three angles of the triangle from CP asymmetry measurements. The first asymmetry measurements in B particle decays, about ten years ago, allowed to determine β, which is now known to better than 5% precision. The angles α and γ, measured in much rarer processes, required several years of data taking before analyses could yield reliable answers. A remarkable feature is that the direct measurement of the angles of the Unitarity Triangle generates an area that is consistent with the area predicted by measurement of the sides. In this thesis we have presented the branching fraction measurements of charged and neutral B meson decays to K<sub>1sub>(1270)π and K<sub>1sub>(1400)π, obtained from a data sample of 454 million Υ(4S) → B$\\bar{B}$ events. This analysis is particularly challenging from the experimental side since the branching fractions involved are very low, at the level of 10^-6 - 10^-7, and the signal is characterized by the simultaneous presence of two overlapping resonances, which exhibit sizeable interference effects. The combined K<sub>1sub>(1270)π and K<sub>1sub>(1400)π signal is therefore modeled with a K-matrix formalism, which accounts for

Synthesis, structural characterization and fluctuation conductivity of HoBa{sub 2}Cu{sub 3}O{sub 7-{delta}-}SrTiO{sub 3} composites

Energy Technology Data Exchange (ETDEWEB)

Uribe Laverde, M.A., E-mail: mauribel@bt.unal.edu.c [Grupo de Fisica de Nuevos Materiales, Departamento de Fisica, Universidad Nacional de Colombia, Bogota (Colombia); Landinez Tellez, D.A.; Roa-Rojas, J. [Grupo de Fisica de Nuevos Materiales, Departamento de Fisica, Universidad Nacional de Colombia, Bogota (Colombia)

2010-12-15

Single-phase polycrystalline samples of HoBa{sub 2}Cu{sub 3}O{sub 7-{delta}} superconductor and SrTiO{sub 3} isolator were produced by means of the solid state reaction technique. After structural characterization of both materials, superconductor-isolator composites were produced with nominal isolator volume percentages between 0% and 10%. Resistivity measurements for the composites and the HoBa{sub 2}Cu{sub 3}O{sub 7-{delta}} sample with different currents evidenced a superconducting transition with critical temperature T{sub C} = 92 K, with wider transitions with increasing either isolator content or measurement current. Fluctuation conductivity analyses were carried out to obtain the exponents characterizing the conductivity divergence. Above T{sub C}, apart from the typical Gaussian and critical fluctuations an atypical regime with critical exponent about 0.14 is observed as a precursor of the transition. Below T{sub C}, it is observed that the coherence transition characteristic exponent increases rapidly with increasing isolator percentage in the composites and does not show important changes when modifying the current in the pure superconductor sample.

A Sub-Hertz, Low-Frequency Vibration Isolation Platform

Science.gov (United States)

Ortiz, Gerardo, G.; Farr, William H.; Sannibale, Virginio

2011-01-01

One of the major technical problems deep-space optical communication (DSOC) systems need to solve is the isolation of the optical terminal from vibrations produced by the spacecraft navigational control system and by the moving parts of onboard instruments. Even under these vibration perturbations, the DSOC transceivers (telescopes) need to be pointed l000 fs of times more accurately than an RF communication system (parabolic antennas). Mechanical resonators have been extensively used to provide vibration isolation for groundbased, airborne, and spaceborne payloads. The effectiveness of these isolation systems is determined mainly by the ability of designing a mechanical oscillator with the lowest possible resonant frequency. The Low-Frequency Vibration Isolation Platform (LFVIP), developed during this effort, aims to reduce the resonant frequency of the mechanical oscillators into the sub-Hertz region in order to maximize the passive isolation afforded by the 40 dB/decade roll-off response of the resonator. The LFVIP also provides tip/tilt functionality for acquisition and tracking of a beacon signal. An active control system is used for platform positioning and for dampening of the mechanical oscillator. The basic idea in the design of the isolation platform is to use a passive isolation strut with an approximately equal to 100-mHz resonance frequency. This will extend the isolation range to lower frequencies. The harmonic oscillator is a second-order lowpass filter for mechanical disturbances. The resonance quality depends on the dissipation mechanisms, which are mainly hysteretic because of the low resonant frequency and the absence of any viscous medium. The LFVIP system is configured using the well-established Stewart Platform, which consists of a top platform connected to a base with six extensible struts (see figure). The struts are attached to the base and to the platform via universal joints, which permit the extension and contraction of the struts. The

Human Milk MicroRNA and Total RNA Differ Depending on Milk Fractionation.

Science.gov (United States)

Alsaweed, Mohammed; Hepworth, Anna R; Lefèvre, Christophe; Hartmann, Peter E; Geddes, Donna T; Hassiotou, Foteini

2015-10-01

MicroRNA have been recently discovered in human milk signifying potentially important functions for both the lactating breast and the infant. Whilst human milk microRNA have started to be explored, little data exist on the evaluation of sample processing, and analysis to ensure that a full spectrum of microRNA can be obtained. Human milk comprises three main fractions: cells, skim milk, and lipids. Typically, the skim milk fraction has been measured in isolation despite evidence that the lipid fraction may contain more microRNA. This study aimed to standardize isolation of microRNA and total RNA from all three fractions of human milk to determine the most appropriate sampling and analysis procedure for future studies. Three different methods from eight commercially available kits were tested for their efficacy in extracting total RNA and microRNA from the lipid, skim, and cell fractions of human milk. Each fraction yielded different concentrations of RNA and microRNA, with the highest quantities found in the cell and lipid fractions, and the lowest in skim milk. The column-based phenol-free method was the most efficient extraction method for all three milk fractions. Two microRNAs were expressed and validated in the three milk fractions by qPCR using the three recommended extraction kits for each fraction. High expression levels were identified in the skim and lipid milk factions for these microRNAs. These results suggest that careful consideration of both the human milk sample preparation and extraction protocols should be made prior to embarking upon research in this area. © 2015 The Authors. Journal of Cellular Biochemistry Published by Wiley Periodicals, Inc.

X-ray and NQR studies of bromoindate(III) complexes. [C{sub 2}H{sub 5}NH{sub 3}]{sub 4}InBr{sub 7}, [C(NH{sub 2}){sub 3}]{sub 3}InBr{sub 6}, and [H{sub 3}NCH{sub 2}C(CH{sub 3}){sub 2}CH{sub 2}NH{sub 3}]InBr{sub 5}

Energy Technology Data Exchange (ETDEWEB)

Iwakiri, Takeharu; Ishihara, Hideta [Saga Univ. (Japan). Faculty of Culture and Education; Terao, Hiromitsu [Tokushima Univ. (Japan). Faculty of Integrated Arts and Sciences; Lork, Enno; Gesing, Thorsten M. [Bremen Univ. (Germany). Inst. of Inorganic Chemistry and Crystallography

2017-03-01

The crystal structures of [C{sub 2}H{sub 5}NH{sub 3}]{sub 4}InBr{sub 7}(1), [C(NH{sub 2}){sub 3}]{sub 3}InBr{sub 6}(2), and [H{sub 3}NCH{sub 2}C(CH{sub 3}){sub 2}CH{sub 2}NH{sub 3}]InBr{sub 5}(3) were determined at 100(2) K: monoclinic, P2{sub 1}/n, a=1061.94(3), b=1186.40(4), c=2007.88(7) pm, β= 104.575(1) , Z=4 for 1; monoclinic, C2/c, a=3128.81(12), b=878.42(3), c=2816.50(10) pm, β=92.1320(10) , Z=16 for 2; orthorhombic, P2{sub 1}2{sub 1}2{sub 1}, a=1250.33(5), b=1391.46(6), c=2503.22(9) pm, Z=4 for 3. The structure of 1 contains an isolated octahedral [InBr{sub 6}]{sup 3-} ion and a Br{sup -} ion. The structure of 2 contains three different isolated octahedral [InBr{sub 6}]{sup 3-} ions. The structure of 3 has a corner-shared double-octahedral [In{sub 2}Br{sub 11}]{sup 5-} ion and an isolated tetrahedral [InBr{sub 4}]{sup -} ion. The {sup 81}Br nuclear quadrupole resonance (NQR) lines of the terminal Br atoms of the compounds are widely spread in frequency, and some of them show unusual positive temperature dependence. These observations manifest the N-H..Br-In hydrogen bond networks developed between the cations and anions to stabilize the crystal structures. The {sup 81}Br NQR and differential thermal analysis (DTA) measurements have revealed the occurrence of unique phase transitions in 1 and 3. When the bond angles were estimated from the electric field gradient (EFG) directions calculated by the molecular orbital (MO) methods, accurate values were obtained for [InBr{sub 6}]{sup 3-} of 1 and for [In{sub 2}Br{sub 11}]{sup 5-} and [InBr{sub 4}]{sup -} of 3, except for several exceptions in those for the latter two ions. On the other hand, the calculations of {sup 81}Br NQR frequencies have produced up to 1.4 times higher values than the observed ones.

Isolation of plasmodesmata from Arabidopsis suspension culture cells.

Science.gov (United States)

Grison, Magali S; Fernandez-Calvino, Lourdes; Mongrand, Sébastien; Bayer, Emmanuelle M F

2015-01-01

Due to their position firmly anchored within the plant cell wall, plasmodesmata (PD) are notoriously difficult to isolate from plant tissue. Yet, getting access to isolated PD represents the most straightforward strategy for the identification of their molecular components. Proteomic and lipidomic analyses of such PD fractions have provided and will continue to provide critical information on the functional and structural elements that define these membranous nano-pores. Here, we describe a two-step simple purification procedure that allows isolation of pure PD-derived membranes from Arabidopsis suspension cells. The first step of this procedure consists in isolating cell wall fragments containing intact PD while free of contamination from other cellular compartments. The second step relies on an enzymatic degradation of the wall matrix and the subsequent release of "free" PD. Isolated PD membranes provide a suitable starting material for the analysis of PD-associated proteins and lipids.

Measurement of the B{sub s}{sup 0}→ϕϕ branching fraction and search for the decay B{sup 0}→ϕϕ

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Collaboration: The LHCb collaboration; and others

2015-10-08

Using a dataset corresponding to an integrated luminosity of 3.0 fb{sup −1} collected in pp collisions at centre-of-mass energies of 7 and 8 TeV, the B{sub s}{sup 0}→ϕϕ branching fraction is measured to be B(B{sub s}{sup 0}→ϕϕ)=(1.84±0.05(stat)±0.07(syst)±0.11 (f{sub s}/f{sub d})±0.12 (norm) )×10{sup −5}, where f{sub s}/f{sub d} represents the ratio of the B{sub s}{sup 0} to B{sup 0} production cross-sections, and the B{sup 0}→ϕK{sup ∗}(892){sup 0} decay mode is used for normalization. This is the most precise measurement of this branching fraction to date, representing a factor five reduction in the statistical uncertainty compared with the previous best measurement. A search for the decay B{sup 0}→ϕϕ is also made. No signal is observed, and an upper limit on the branching fraction is set as B(B{sup 0}→ϕϕ)<2.8×10{sup −8} at 90% confidence level. This is a factor of seven improvement compared to the previous best limit.

Effects-driven chemical fractionation of heavy fuel oil to isolate compounds toxic to trout embryos.

Science.gov (United States)

Bornstein, Jason M; Adams, Julie; Hollebone, Bruce; King, Thomas; Hodson, Peter V; Brown, R Stephen

2014-04-01

Heavy fuel oil (HFO) spills account for approximately 60% of ship-source oil spills and are up to 50 times more toxic than medium and light crude oils. Heavy fuel oils contain elevated concentrations of polycyclic aromatic hydrocarbons (PAHs) and alkyl-PAHs, known to be toxic to fish; however, little direct characterization of HFO toxicity has been reported. An effects-driven chemical fractionation was conducted on HFO 7102 to separate compounds with similar chemical and physical properties, including toxicity, to isolate the groups of compounds most toxic to trout embryos. After each separation, toxicity tests directed the next phase of fractionation, and gas chromatography-mass spectrometry analysis correlated composition with toxicity, with a focus on PAHs. Low-temperature vacuum distillation permitted the separation of HFO into 3 fractions based on boiling point ranges. The most toxic of these fractions underwent wax precipitation to remove long-chain n-alkanes. The remaining PAH-rich extract was further separated using open column chromatography, which provided distinct fractions that were grouped according to increasing aromatic ring count. The most toxic of these fractions was richest in PAHs and alkyl-PAHs. The results of the present study were consistent with previous crude oil studies that identified PAH-rich fractions as the most toxic. © 2013 SETAC.

Antibacterial activity of vacuum liquid chromatography (VLC) isolated fractions of chloroform extracts of seeds of achyranthes aspera

International Nuclear Information System (INIS)

Noor-ul-Amin; Qadir, M.I.; Khan, T.J.; Abbas, G.; Ahmad, B.; Janbaz, K.H.; Ali, M.

2012-01-01

Antibacterial activities of locally occurring weed Achyranthes aspera were studied. Three solvents (Hexane, Chloroform, and Ethanol) were used successively for the extraction of active principles from the seeds of this plant. The extracts were concentrated on vacuum rotary evaporator. The concentrated extracts were tested for their antibacterial activities after making their solution in gum acacia. The six bacterial strains used in the antibacterial studies were Bacillus subtilis, Micrococcus luteus, Staphylococcus aureus, Escherichia coli, Pseudomonas aeuroginosa, and Salmonella chloerasuis. Antibacterial activities of the extracts were compared with streptomycin and ampicillin in terms of zones of inhibition. Chloroform and ethanol extracts demonstrated antibacterial activity. Hexane extract did not demonstrate antibacterial activity. Chloroform extract was more potent than alcohol extract in terms of antibacterial activity. An attempt was made to identify the nature of compound by isolation through vacuum liquid chromatography (VLC). The fractions isolated by VLC were subjected to thin layer chromatography (TLC). TLC showed the presence of alkaloids and terpenoids. The active fractions were tested for their antibacterial activity. One of the fractions exhibited antibacterial activity. (author)

Finite-time stability and synchronization of memristor-based fractional-order fuzzy cellular neural networks

Science.gov (United States)

Zheng, Mingwen; Li, Lixiang; Peng, Haipeng; Xiao, Jinghua; Yang, Yixian; Zhang, Yanping; Zhao, Hui

2018-06-01

This paper mainly studies the finite-time stability and synchronization problems of memristor-based fractional-order fuzzy cellular neural network (MFFCNN). Firstly, we discuss the existence and uniqueness of the Filippov solution of the MFFCNN according to the Banach fixed point theorem and give a sufficient condition for the existence and uniqueness of the solution. Secondly, a sufficient condition to ensure the finite-time stability of the MFFCNN is obtained based on the definition of finite-time stability of the MFFCNN and Gronwall-Bellman inequality. Thirdly, by designing a simple linear feedback controller, the finite-time synchronization criterion for drive-response MFFCNN systems is derived according to the definition of finite-time synchronization. These sufficient conditions are easy to verify. Finally, two examples are given to show the effectiveness of the proposed results.

Acid-base and copper-binding properties of three organic matter fractions isolated from a forest floor soil solution

Science.gov (United States)

van Schaik, Joris W. J.; Kleja, Dan B.; Gustafsson, Jon Petter

2010-02-01

Vast amounts of knowledge about the proton- and metal-binding properties of dissolved organic matter (DOM) in natural waters have been obtained in studies on isolated humic and fulvic (hydrophobic) acids. Although macromolecular hydrophilic acids normally make up about one-third of DOM, their proton- and metal-binding properties are poorly known. Here, we investigated the acid-base and Cu-binding properties of the hydrophobic (fulvic) acid fraction and two hydrophilic fractions isolated from a soil solution. Proton titrations revealed a higher total charge for the hydrophilic acid fractions than for the hydrophobic acid fraction. The most hydrophilic fraction appeared to be dominated by weak acid sites, as evidenced by increased slope of the curve of surface charge versus pH at pH values above 6. The titration curves were poorly predicted by both Stockholm Humic Model (SHM) and NICA-Donnan model calculations using generic parameter values, but could be modelled accurately after optimisation of the proton-binding parameters (pH ⩽ 9). Cu-binding isotherms for the three fractions were determined at pH values of 4, 6 and 9. With the optimised proton-binding parameters, the SHM model predictions for Cu binding improved, whereas the NICA-Donnan predictions deteriorated. After optimisation of Cu-binding parameters, both models described the experimental data satisfactorily. Iron(III) and aluminium competed strongly with Cu for binding sites at both pH 4 and pH 6. The SHM model predicted this competition reasonably well, but the NICA-Donnan model underestimated the effects significantly at pH 6. Overall, the Cu-binding behaviour of the two hydrophilic acid fractions was very similar to that of the hydrophobic acid fraction, despite the differences observed in proton-binding characteristics. These results show that for modelling purposes, it is essential to include the hydrophilic acid fraction in the pool of 'active' humic substances.

Antioxidant activities and functional properties of protein and peptide fractions isolated from salted herring brine

DEFF Research Database (Denmark)

Taheri, Ali; Farvin, Sabeena; Jacobsen, Charlotte

2014-01-01

In the present study proteins isolated from herring brine, which is a by-product of marinated herring production were evaluated for their functional properties and antioxidant activity. Herring brine was collected from the local herring industry and proteins were precipitated by adjusting the p...... to delay iron catalyzed lipid oxidation in 5% fish oil in water emulsions and the 10–50kDa fraction was the best. These results show the potential of proteins and peptide fractions recovered from waste water from the herring industry as source of natural antioxidants for use in food products....

Cellular location of rat muscle ferritins and their preferential loss during cell isolation.

Science.gov (United States)

Linder, M C; Roboz, M; McKown, M J; Pardridge, W M; Zak, R

1984-04-10

Heart and other muscles of the rat contain two forms of ferritin separable in polyacrylamide gel electrophoresis. The cellular location of the fast- and slow-migrating ferritins was investigated using primary cultures of hindlimb skeletal muscle, and isolated myocardial cell populations. Muscle and non-muscle cells were isolated in good yield from hearts of adult rats pretreated with large doses of iron to increase their ferritin content. In virtually all cases, the isolated muscle cells contained traces only of the fast-migrating species and the non-muscle cells contained small amounts of the slow-migrating ferritin. During cell isolation, 90-100% of both ferritins was lost and could be recovered in the perfusates and solutions employed, while one third of the total tissue protein, and a larger percentage of creatine phosphokinase, was recovered in the isolated cells. Primary cultures of thigh muscle from adult rats which had differentiated into multi-nucleated myotubes, were incubated for 1-3 days with chelated iron. These cells contained substantial amounts of the electrophoretically fast migrating ferritin, with its characteristic larger Stokes' radius (determined by quantitative polyacrylamide gel electrophoresis). None of the slow-migrating ferritin species was detected, although hindlimb muscle from iron-treated rats contained both forms. It is concluded that the fast-migrating ferritin of muscle, which is much larger and more asymmetric than other ferritins, is confined to the muscle cell population, while the other form is predominantly or exclusively in the non-muscle cells. Both ferritins are lost preferentially over other proteins during procedures which injure muscle tissue.

Two-photon excited autofluorescence imaging of freshly isolated frog retinas.

Science.gov (United States)

Lu, Rong-Wen; Li, Yi-Chao; Ye, Tong; Strang, Christianne; Keyser, Kent; Curcio, Christine A; Yao, Xin-Cheng

2011-06-01

The purpose of this study was to investigate cellular sources of autofluorescence signals in freshly isolated frog (Rana pipiens) retinas. Equipped with an ultrafast laser, a laser scanning two-photon excitation fluorescence microscope was employed for sub-cellular resolution examination of both sliced and flat-mounted retinas. Two-photon imaging of retinal slices revealed autofluorescence signals over multiple functional layers, including the photoreceptor layer (PRL), outer nuclear layer (ONL), outer plexiform layer (OPL), inner nuclear layer (INL), inner plexiform layer (IPL), and ganglion cell layer (GCL). Using flat-mounted retinas, depth-resolved imaging of individual retinal layers further confirmed multiple sources of autofluorescence signals. Cellular structures were clearly observed at the PRL, ONL, INL, and GCL. At the PRL, the autofluorescence was dominantly recorded from the intracellular compartment of the photoreceptors; while mixed intracellular and extracellular autofluorescence signals were observed at the ONL, INL, and GCL. High resolution autofluorescence imaging clearly revealed mosaic organization of rod and cone photoreceptors; and sub-cellular bright autofluorescence spots, which might relate to connecting cilium, was observed in the cone photoreceptors only. Moreover, single-cone and double-cone outer segments could be directly differentiated.

High-resolution sub-cellular imaging by correlative NanoSIMS and electron microscopy of amiodarone internalisation by lung macrophages as evidence for drug-induced phospholipidosis.

Science.gov (United States)

Jiang, Haibo; Passarelli, Melissa K; Munro, Peter M G; Kilburn, Matt R; West, Andrew; Dollery, Colin T; Gilmore, Ian S; Rakowska, Paulina D

2017-01-26

Correlative NanoSIMS and EM imaging of amiodarone-treated macrophages shows the internalisation of the drug at a sub-cellular level and reveals its accumulation within the lysosomes, providing direct evidence for amiodarone-induced phospholipidosis. Chemical fixation using tannic acid effectively seals cellular membranes aiding intracellular retention of diffusible drugs.

Intracellular Cadmium Isotope Fractionation

Science.gov (United States)

Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.

2011-12-01

Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

Cellular chain formation in Escherichia coli biofilms

DEFF Research Database (Denmark)

Vejborg, Rebecca Munk; Klemm, Per

2009-01-01

; type I fimbriae expression significantly reduced cellular chain formation, presumably by steric hindrance. Cellular chain formation did not appear to be specific to E coli K-12. Although many urinary tract infection (UTI) isolates were found to form rather homogeneous, flat biofilms, three isolates...

Improved limit on the branching fraction of the rare decay K{sup 0}{sub S} → μ{sup +}μ{sup -}

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Adeva, B. [Santiago de Compostela Univ. (Spain); Adinolfi, M. [Bristol Univ. (United Kingdom). H.H. Wills Physics Lab.; Collaboration: LHCb Collaboration; and others

2017-10-15

A search for the decay K{sup 0}{sub S} → μ{sup +}μ{sup -} is performed, based on a data sample of proton-proton collisions corresponding to an integrated luminosity of 3 fb{sup -1}, collected by the LHCb experiment at centre-of-mass energies of 7 and 8 TeV. The observed yield is consistent with the background-only hypothesis, yielding a limit on the branching fraction of B(K{sup 0}{sub S} → μ{sup +}μ{sup -}) < 0.8 (1.0) x 10{sup -9} at 90% (95%) confidence level. This result improves the previous upper limit on the branching fraction by an order of magnitude. (orig.)

Analysis of Cellular DNA Content by Flow Cytometry.

Science.gov (United States)

Darzynkiewicz, Zbigniew; Huang, Xuan; Zhao, Hong

2017-11-01

Cellular DNA content can be measured by flow cytometry with the aim of : (1) revealing cell distribution within the major phases of the cell cycle, (2) estimating frequency of apoptotic cells with fractional DNA content, and/or (3) disclosing DNA ploidy of the measured cell population. In this unit, simple and universally applicable methods for staining fixed cells are presented, as are methods that utilize detergents and/or proteolytic treatment to permeabilize cells and make DNA accessible to fluorochrome. Additionally, supravital cell staining with Hoechst 33342, which is primarily used for sorting live cells based on DNA-content differences for their subsequent culturing, is described. Also presented are methods for staining cell nuclei isolated from paraffin-embedded tissues. Available algorithms are listed for deconvolution of DNA-content-frequency histograms to estimate percentage of cells in major phases of the cell cycle and frequency of apoptotic cells with fractional DNA content. © 2017 by John Wiley & Sons, Inc. Copyright © 2017 John Wiley and Sons, Inc.

n Vitro Immunomodulatory Effect of R10 Fraction of Garlic on Viability and Production of TNF-? in CD8+ T Cells

Directory of Open Access Journals (Sweden)

T. Ghazanfari

2014-01-01

Full Text Available Introduction & Objective: -cells, especially CD8+ T lymphocytes are the most important cells in anti-tumor response. Previously R10 fraction of garlic extract was reported as an immuno-modulator which induced an effective cellular immunity and Th1 responses. In this study the in vitro immunomodulatory effect of R10 on CD8+ T cells viability and production of TNF-? were evaluated. Materials & Methods: In this experimental study, using monoclonal antibodies attached to magnetic beads with isolating columns by magnetic bead method, CD8+ T cells from spleen cells of Balb/C mice were isolated. R10 fraction based on molecular weight was prepared using Ultra filtration. MTT assay was used to evaluate cell viability. TNF-? level was meas-ured in the supernatant of culture of CD8+ T cells by ELISA. Obtained data was compared and analyzed using Nonparametric Test and Keraskel & Wanny's Test tests.. Results: The findings indicate that all dilutions of R10 fraction increased cell viability of CD8+ T cells in comparison with the negative control group and in the presence of ConA with dilution of 1:50 of R10 fraction significantly increased cell viability of CD8+ T Cells com-pared to ConA alone. Secretion of TNF-? significantly increased by all dilutions of R10 frac-tion. Conclusion: These findings suggest that R10 fraction of garlic can be used as an Immuno-modulator drug candidate for induction of cellular Immunity in tumor therapy. Sci J Hamadan Univ Med Sci 2014; 20 (4:273-279

Growth and electrical characterization of Al{sub 0.24}Ga{sub 0.76}As/Al{sub x}Ga{sub 1-x}As/Al{sub 0.24}Ga{sub 0.76}As modulation-doped quantum wells with extremely low x

Energy Technology Data Exchange (ETDEWEB)

Gardner, Geoffrey C. [Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Watson, John D.; Mondal, Sumit [Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); Department of Physics, Purdue University, West Lafayette, Indiana 47907 (United States); Deng, Nianpei; Csathy, Gabor A. [Department of Physics, Purdue University, West Lafayette, Indiana 47907 (United States); Manfra, Michael J. [Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Department of Physics, Purdue University, West Lafayette, Indiana 47907 (United States); School of Electrical and Computer Engineering, Purdue University, West Lafayette, Indiana 47907 (United States)

2013-06-24

We report on the growth and electrical characterization of modulation-doped Al{sub 0.24}Ga{sub 0.76}As/Al{sub x}Ga{sub 1-x}As/Al{sub 0.24}Ga{sub 0.76}As quantum wells with mole fractions as low as x = 0.00057. Such structures will permit detailed studies of the impact of alloy disorder in the fractional quantum Hall regime. At zero magnetic field, we extract an alloy scattering rate of 24 ns{sup -1} per%Al. Additionally, we find that for x as low as 0.00057 in the quantum well, alloy scattering becomes the dominant mobility-limiting scattering mechanism in ultra-high purity two-dimensional electron gases typically used to study the fragile {nu} = 5/2 and {nu} = 12/5 fractional quantum Hall states.

In vitro assessment of Tribulus terrestris aqueous extract and Benzoxacin fraction against Helicobacter pylori isolates from biopsy samples of Iranian patients

Directory of Open Access Journals (Sweden)

Mojdeh Hakemi vala

2014-02-01

Full Text Available Background & Objectives:  Helicobacter pylori (Hp is related to gastritis, gastric ulcer, duodenal ulcer, and mucosal carcinoma. Emergence of multidrug resistant Hp strains encouraged the researchers to find new effective drugs. Especially medicinal herbs and plants which usually shows less side effects. The aim of this study was in vitro assessment of anti Hp activity of total extract of Tribulus terrestris (T. terrestris Benzoxacin, a local Iranian medicinal plant and its fraction Benzoxacin.Methods: total aqueous extract of aerial parts of the plant was prepared and liquid extraction with petroleum ether was used to separate its components. LC/MS system proved the existence of Benzoxazine derivative in the water fraction and the third's fraction. Anti (Hp effects of total extract and its third fraction were examined by cup plate method and using standard MacFarland. 50 biopsy samples of antrum were detected from patients who were endoscopic candidates in Milad and Fayazbakhsh  hospitals of Tehran during 2011. All samples were isolated, diagnosed based on standard methods and biochemical tests and confirmed by PCR method for ureC gene, too.  Different dilutions (250, 500,750 and 1000 mg/ml of total extract were prepared. Clarythromycin (Clr E-test strips and an identified Hp OC1096 was used, simultaneously.Results: Of 50 biopsy samples, 12 Hp strains were isolated. Rapid urease test were positive in all expect one biopsy sample. Existence of ureC gene in all isolates were confirmed expect one strain by PCR. By cup plate method, resistant to concentrations of 1000 and 750mg/ml were detected in 50% of Hp isolates and 66.6% of them were resistant to concentrations 250 and 500 mg/ml .Also, 83.3% of Hp strains were resistant to Benzoxacin fraction. Clarythromycin sensitivity detected in 83% of Hp isolates, simultaneously.Conclusion: This study was done as a pilot study for in vitro evaluation of antibacterial effect of total extract of T

Different Candida parapsilosis clinical isolates and lipase deficient strain trigger an altered cellular immune response

Directory of Open Access Journals (Sweden)

Renata eToth

2015-10-01

Full Text Available Numerous human diseases can be associated with fungal infections either as potential causative agents or as a result of changed immune status due to a primary disease. Fungal infections caused by Candida species can vary from mild to severe dependent upon the site of infection, length of exposure and past medical history. Patients with impaired immune status are at increased risk for chronic fungal infections. Recent epidemiologic studies have revealed the increasing incidence of candidiasis caused by non-albicans species such as C. parapsilosis. Due to its increasing relevance we chose two distinct C. parapsilosis strains, to describe the cellular innate immune response towards this species. In the first section of our study we compared the interaction of CLIB 214 and GA1 cells with murine and human macrophages. Both strains are commonly used to investigate C. parapsilosis virulence properties. CLIB 214 is a rapidly pseudohyphae-forming strain and GA1 is an isolate that mainly exists in a yeast form. Our results showed, that the phagocyte response was similar in terms of overall uptake, however differences were observed in macrophage migration and engulfment of fungal cells. As C. parapsilosis releases extracellular lipases in order to promote host invasion we further investigated the role of these secreted components during the distinct stages of the phagocytic process. Using a secreted lipase deficient mutant strain and the parental strain GA1 individually and simultaneously, we confirmed that fungal secreted lipases influence the fungi’s virulence by detecting altered innate cellular responses.In this study we report that two isolates of a single species can trigger markedly distinct host responses and that lipase secretion plays a role on the cellular level of host pathogen interactions.

Plasma fractionation for blood products: isolation and purification of coagulating factors, albumin and immunoglobulin

International Nuclear Information System (INIS)

Siti Najila Mohd Janib; Shaharuddin Mohd; Wan Hamirul Bahrin Wan Kamal

2005-01-01

Approximately 12 million liters of human plasma are fractionated world-wide annually. However, with the market for clotting factors and other haemoderivatives steadily increasing from year to year, the amount processed will also increase correspondingly to keep up with the demand. In Malaysia, part of the need for the blood products are obtained commercially but a major portion of the requirement involves sending the plasma collected by the National Blood Centre to Australia for processing. Following purification and isolation of the blood products, they are sent back to Malaysia for local consumption. As yet there are no plasma fractionation plants in the South East Asia region, it would be advantageous to establish a local fractionation plant as it would be able to cater for local demands of the haemoderivatives and thus reduces the cost of importing these products. Besides, this facility will be able to provide contract fractionation services to the surrounding region. Early work in MINT has started in trying to purify plasma obtained from rats. Purification of the plasma was performed by using Sephadex G-25 column. Short term objective of this project is to develop the technique of extraction, fractionation and purification of blood products such as albumin, globulin and clotting factors (Factor VIII and Factor IX). The long term emphasis will be to scale up the production facility to a pilot plant stage and eventually to a national fractionation and purification plant. (Author)

Antibacterial potential of Al{sub 2}O{sub 3} nanoparticles against multidrug resistance strains of Staphylococcusaureus isolated from skin exudates

Energy Technology Data Exchange (ETDEWEB)

Ansari, Mohammad Azam, E-mail: azammicro@gmail.com; Khan, Haris M. [Aligarh Muslim University, Nanotechnology and Antimicrobial Drug Resistance Research Laboratory, Department of Microbiology, Jawaharlal Nehru Medical College and Hospital (India); Khan, Aijaz A. [Aligarh Muslim University, Department of Anatomy, Jawaharlal Nehru Medical College and Hospital (India); Pal, Ruchita [Jawaharlal Nehru University, Advanced Instrumentation Research Facility (India); Cameotra, Swaranjit Singh [CSIR, Institute of Microbial Technology (IMTECH) (India)

2013-10-15

To date very little studies are available in the literature on the interaction of Al{sub 2}O{sub 3} nanoparticles with multidrug-resistant strains of Staphylococcusaureus. Considering the paucity of earlier reports the objective of present study was to investigate the antibacterial activity of Al{sub 2}O{sub 3} NPs (<50 nm) against methicillin-resistant S. aureus and methicillin-resistant coagulase negative staphylococci by various methods. Al{sub 2}O{sub 3} NPs were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, and X-ray diffraction. The MIC was found to be in the range of 1,700-3,400 {mu}g/ml. Almost no growth was observed at 2,000 {mu}g/ml for up to 10 h. SEM micrograph revealed that the treated cells were significantly damaged, showed indentation on cell surface and clusters of NPs on bacterial cell wall. HR-TEM micrograph shows disruption and disorganization of cell membrane and cell wall. The cell membrane was extensively damaged and, most probably, the intracellular content has leaked out. Al{sub 2}O{sub 3} NPs not only adhered at the surface of cell membrane, but also penetrated inside the bacterial cells, cause formation of irregular-shaped pits and perforation on their surfaces and may also interact with the cellular macromolecules causing adverse effect including cell death. The data presented here are novel in that Al{sub 2}O{sub 3} NPs are effective bactericidal agents regardless of the drug resistance mechanisms that confer importance to these bacteria as an emergent pathogen. Therefore, in depth studies regarding the interaction of Al{sub 2}O{sub 3} NPs with cells, tissues, and organs as well as the optimum dose required to produce therapeutic effects need to be ascertained before we can expect a more meaningful role of the Al{sub 2}O{sub 3} NPs in medical application.

Biodegradation of Maya crude oil fractions by bacterial strains and a defined mixed culture isolated from Cyperus laxus rhizosphere soil in a contaminated site

Energy Technology Data Exchange (ETDEWEB)

Diaz-Ramirez, I. J.; Gutierrez-Rojas, M.; Favela-Torres, E. [Autonomous Metropolitan University (UAM)- Iztapalapa, Dept. of Biotechnology, Federal District (Mexico); Ramirez-Sada, H. [Autonomous Metropolitan University (UAM)-Xochimilco, Dept. of Biological Systems, Federal District (Mexico)

2003-12-01

Biodegradation of aliphatic, aromatic, and polar constituents of Maya crude oil by a set of isolated bacterial strains and a defined mixed culture made up with all isolated strains, was evaluated. The bacterial strains were obtained from the rhizosphere of Cyperus laxus, a native plant on a highly hydrocarbon-polluted site. Oxygen uptake rate was used to determine the culture transfer timing during the enrichment culture. Results showed that five of the isolated strains were able to degrade 50 per cent of the aliphatic fractions of Maya crude oil. With the defined mixed culture the level of biodegradation was 47 per cent for aliphatics and 6 per cent of the aromatic-polar mixture. When grown in the presence of total hydrocarbons, the defined mixed culture was able to degrade 40 per cent of the aliphatic fraction and 26 per cent of the aromatic fraction. By combining enrichment cultures with oxygen uptake rate to determine the culture transfer timing during the enrichment cultures allowed the isolation of bacterial strains that are able to degrade specific hydrocarbon fractions at high consumption rates. 28 refs., 4 tabs., 1 fig.

Stromal vascular fraction isolated from lipo-aspirates using an automated processing system: bench and bed analysis.

Science.gov (United States)

Doi, Kentaro; Tanaka, Shinsuke; Iida, Hideo; Eto, Hitomi; Kato, Harunosuke; Aoi, Noriyuki; Kuno, Shinichiro; Hirohi, Toshitsugu; Yoshimura, Kotaro

2013-11-01

The heterogeneous stromal vascular fraction (SVF), containing adipose-derived stem/progenitor cells (ASCs), can be easily isolated through enzymatic digestion of aspirated adipose tissue. In clinical settings, however, strict control of technical procedures according to standard operating procedures and validation of cell-processing conditions are required. Therefore, we evaluated the efficiency and reliability of an automated system for SVF isolation from adipose tissue. SVF cells, freshly isolated using the automated procedure, showed comparable number and viability to those from manual isolation. Flow cytometric analysis confirmed an SVF cell composition profile similar to that after manual isolation. In addition, the ASC yield after 1 week in culture was also not significantly different between the two groups. Our clinical study, in which SVF cells isolated with the automated system were transplanted with aspirated fat tissue for soft tissue augmentation/reconstruction in 42 patients, showed satisfactory outcomes with no serious side-effects. Taken together, our results suggested that the automated isolation system is as reliable a method as manual isolation and may also be useful in clinical settings. Automated isolation is expected to enable cell-based clinical trials in small facilities with an aseptic room, without the necessity of a good manufacturing practice-level cell processing area. Copyright © 2012 John Wiley & Sons, Ltd.

Enrichment of measles virus-like RNA in the nucleocapsid fraction isolated from subacute sclerosing panencephalitis brains

International Nuclear Information System (INIS)

Bedows, E.; Payne, F.E.; Kohne, D.E.; Tourtellotte, W.W.

1982-01-01

A procedure has been developed which facilitates the detection of measles virus RNA sequences in human brains. The procedure involves isolating subviral components (nucleocapsids) from brain tissues prior to RNA purification, followed by hybridization of these RNAs to cDNA synthesized from measles virus 50 S RNA template. Using these techniques we were able to obtain an RNA fraction which was manyfold enriched in measles virus-specific RNA, relative to unfractionated subacute sclerosing panencephalitis (SSPE) brain RNAs. 70-100% of the measles virus-specific RNA present in these SSPE brain samples were recovered in this enriched fraction. (Auth.)

Enrichment of measles virus-like RNA in the nucleocapsid fraction isolated from subacute sclerosing panencephalitis brains

Energy Technology Data Exchange (ETDEWEB)

Bedows, E; Payne, F E [Michigan Univ., Ann Arbor (USA). School of Public Health; Kohne, D E [Center for Neurologic Study, San Diego, CA, USA; Tourtellotte, W W [Neurology Service, V.A. Wadsworth Hospital Center, Los Angeles, CA, USA

1982-02-01

A procedure has been developed which facilitates the detection of measles virus RNA sequences in human brains. The procedure involves isolating subviral components (nucleocapsids) from brain tissues prior to RNA purification, followed by hybridization of these RNAs to cDNA synthesized from measles virus 50 S RNA template. Using these techniques we were able to obtain an RNA fraction which was manyfold enriched in measles virus-specific RNA, relative to unfractionated subacute sclerosing panencephalitis (SSPE) brain RNAs. 70-100% of the measles virus-specific RNA present in these SSPE brain samples were recovered in this enriched fraction.

On the influence of cloud fraction diurnal cycle and sub-grid cloud optical thickness variability on all-sky direct aerosol radiative forcing

International Nuclear Information System (INIS)

Min, Min; Zhang, Zhibo

2014-01-01

The objective of this study is to understand how cloud fraction diurnal cycle and sub-grid cloud optical thickness variability influence the all-sky direct aerosol radiative forcing (DARF). We focus on the southeast Atlantic region where transported smoke is often observed above low-level water clouds during burning seasons. We use the CALIOP observations to derive the optical properties of aerosols. We developed two diurnal cloud fraction variation models. One is based on sinusoidal fitting of MODIS observations from Terra and Aqua satellites. The other is based on high-temporal frequency diurnal cloud fraction observations from SEVIRI on board of geostationary satellite. Both models indicate a strong cloud fraction diurnal cycle over the southeast Atlantic region. Sensitivity studies indicate that using a constant cloud fraction corresponding to Aqua local equatorial crossing time (1:30 PM) generally leads to an underestimated (less positive) diurnal mean DARF even if solar diurnal variation is considered. Using cloud fraction corresponding to Terra local equatorial crossing time (10:30 AM) generally leads overestimation. The biases are a typically around 10–20%, but up to more than 50%. The influence of sub-grid cloud optical thickness variability on DARF is studied utilizing the cloud optical thickness histogram available in MODIS Level-3 daily data. Similar to previous studies, we found the above-cloud smoke in the southeast Atlantic region has a strong warming effect at the top of the atmosphere. However, because of the plane-parallel albedo bias the warming effect of above-cloud smoke could be significantly overestimated if the grid-mean, instead of the full histogram, of cloud optical thickness is used in the computation. This bias generally increases with increasing above-cloud aerosol optical thickness and sub-grid cloud optical thickness inhomogeneity. Our results suggest that the cloud diurnal cycle and sub-grid cloud variability are important factors

Interaction of HSP20 with a viral RdRp changes its sub-cellular localization and distribution pattern in plants.

Science.gov (United States)

Li, Jing; Xiang, Cong-Ying; Yang, Jian; Chen, Jian-Ping; Zhang, Heng-Mu

2015-09-11

Small heat shock proteins (sHSPs) perform a fundamental role in protecting cells against a wide array of stresses but their biological function during viral infection remains unknown. Rice stripe virus (RSV) causes a severe disease of rice in Eastern Asia. OsHSP20 and its homologue (NbHSP20) were used as baits in yeast two-hybrid (YTH) assays to screen an RSV cDNA library and were found to interact with the viral RNA-dependent RNA polymerase (RdRp) of RSV. Interactions were confirmed by pull-down and BiFC assays. Further analysis showed that the N-terminus (residues 1-296) of the RdRp was crucial for the interaction between the HSP20s and viral RdRp and responsible for the alteration of the sub-cellular localization and distribution pattern of HSP20s in protoplasts of rice and epidermal cells of Nicotiana benthamiana. This is the first report that a plant virus or a viral protein alters the expression pattern or sub-cellular distribution of sHSPs.

Carbon and hydrogen metabolism of green algae in light and dark

Energy Technology Data Exchange (ETDEWEB)

1990-01-01

After adaptation to a hydrogen metabolism, Chlamydomonas reinhardtii can photoanaerobically metabolize acetate with the evolution of H{sub 2} and CO{sub 2}. An enzyme profile of the chloroplastic, cytoplasmic, and mitochondrial fractions were obtained with a cellular fractionation procedure that incorporated cell wall removal by autolysine, digestion of the plasmalemma with digitonin and fractionation by differential centrifugation on a Percoll step gradient. The sequence of events leading to the photo-evolution of H{sub 2} from acetate includes the conversion of acetate into succinate via the extraplastidic glyoxylate cycle, the oxidation of succinate to fumarate by chloroplastic succinic dehydrogenase and the oxidation of malate to oxaloacetate in the chloroplast by NAD dependent malate dehydrogenase. The level of potential activity of the enzymes was sufficient to accommodate the observed rate of gas evolution. The isolated darkened chloroplast evolves aerobically CO{sub 2} from glucose indicating a chloroplastic respiratory pathway. Evolution of CO{sub 2} is blocked by mitochondrial inhibitors.

Measurement of CP violation parameters and polarisation fractions in B{sub s}{sup 0}→J / ψ K̄ {sup ∗0} decays

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Collaboration: The LHCb collaboration; and others

2015-11-12

The first measurement of C P asymmetries in the decay B{sub s}{sup 0}→J / ψ ( K)-bar  {sup ∗}(892){sup 0} and an updated measurement of its branching fraction and polarisation fractions are presented. The results are obtained using data corresponding to an integrated luminosity of 3.0 fb{sup −1} of proton-proton collisions recorded with the LHCb detector at centre-of-mass energies of 7 and 8 TeV. Together with constraints from B{sup 0}→J / ψ ρ{sup 0}, the results are used to constrain additional contributions due to penguin diagrams in the C P-violating phase ϕ{sub s}, measured through B{sub s}{sup 0} decays to charmonium.

Sub-cellular localisation studies may spuriously detect the Yes-associated protein, YAP, in nucleoli leading to potentially invalid conclusions of its function.

Science.gov (United States)

Finch, Megan L; Passman, Adam M; Strauss, Robyn P; Yeoh, George C; Callus, Bernard A

2015-01-01

The Yes-associated protein (YAP) is a potent transcriptional co-activator that functions as a nuclear effector of the Hippo signaling pathway. YAP is oncogenic and its activity is linked to its cellular abundance and nuclear localisation. Activation of the Hippo pathway restricts YAP nuclear entry via its phosphorylation by Lats kinases and consequent cytoplasmic retention bound to 14-3-3 proteins. We examined YAP expression in liver progenitor cells (LPCs) and surprisingly found that transformed LPCs did not show an increase in YAP abundance compared to the non-transformed LPCs from which they were derived. We then sought to ascertain whether nuclear YAP was more abundant in transformed LPCs. We used an antibody that we confirmed was specific for YAP by immunoblotting to determine YAP's sub-cellular localisation by immunofluorescence. This antibody showed diffuse staining for YAP within the cytosol and nuclei, but, noticeably, it showed intense staining of the nucleoli of LPCs. This staining was non-specific, as shRNA treatment of cells abolished YAP expression to undetectable levels by Western blot yet the nucleolar staining remained. Similar spurious YAP nucleolar staining was also seen in mouse embryonic fibroblasts and mouse liver tissue, indicating that this antibody is unsuitable for immunological applications to determine YAP sub-cellular localisation in mouse cells or tissues. Interestingly nucleolar staining was not evident in D645 cells suggesting the antibody may be suitable for use in human cells. Given the large body of published work on YAP in recent years, many of which utilise this antibody, this study raises concerns regarding its use for determining sub-cellular localisation. From a broader perspective, it serves as a timely reminder of the need to perform appropriate controls to ensure the validity of published data.

Isolation and fractionation of soil humin using alkaline urea and dimethylsulphoxide plus sulphuric acid

Science.gov (United States)

Song, Guixue; Hayes, Michael H. B.; Novotny, Etelvino H.; Simpson, Andre J.

2011-01-01

Humin, the most recalcitrant and abundant organic fraction of soils and of sediments, is a significant contributor to the stable carbon pool in soils and is important for the global carbon budget. It has significant resistance to transformations by microorganisms. Based on the classical operational definition, humin can include any humic-type substance that is not soluble in water at any pH. We demonstrate in this study how sequential exhaustive extractions with 0.1 M sodium hydroxide (NaOH) + 6 M urea, followed by dimethylsulphoxide (DMSO) + 6% ( v/ v) sulphuric acid (H2SO4) solvent systems, can extract 70-80% of the residual materials remaining after prior exhaustive extractions in neutral and aqueous basic media. Solid-state 13C NMR spectra have shown that the components isolated in the base + urea system were compositionally similar to the humic and fulvic acid fractions isolated at pH 12.6 in the aqueous media. The NMR spectra indicated that the major components isolated in the DMSO + H2SO4 medium had aliphatic hydrocarbon associated with carboxyl functionalities and with lesser amounts of carbohydrate and peptide and minor amounts of lignin-derived components. The major components will have significant contributions from long-chain fatty acids, waxes, to cuticular materials. The isolates in the DMSO + H2SO4 medium were compositionally similar to the organic components that resisted solvation and remained associated with the soil clays. It is concluded that the base + urea system released humic and fulvic acids held by hydrogen bonding or by entrapment within the humin matrix. The recalcitrant humin materials extracted in DMSO + H2SO4 are largely biological molecules (from plants and the soil microbial population) that are likely to be protected from degradation by their hydrophobic moieties and by sorption on the soil clays. Thus, the major components of humin do not satisfy the classical definitions for humic substances which emphasise that these arise from

Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

Science.gov (United States)

Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

2009-02-01

Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

Baryon axial charges and momentum fractions with N{sub f}=2+1 dynamical fermions

Energy Technology Data Exchange (ETDEWEB)

Goeckeler, M.; Haegler, P. [Regensburg Univ. (Germany). Inst. fuer Theoretische Physik; Horsley, R. [Edinburgh Univ. (GB). School of Physics and Astronomy] (and others)

2011-02-15

We report on recent results of the QCDSF/UKQCD Collaboration on investigations of baryon structure using configurations generated with N{sub f}=2+1 dynamical flavours of O(a) improved Wilson fermions. With the strange quark mass as an additional dynamical degree of freedom in our simulations we avoid the need for a partially quenched approximation when investigating the properties of particles containing a strange quark, e.g. the hyperons. In particular, we focus on the nucleon and hyperon axial coupling constants and quark momentum fractions. (orig.)

Temperature and magnetic field dependence of the coexistent phases in La sub 1 sub - sub x Ca sub x MnO sub 3 sub + subdelta (x=0.47, 0.49)

CERN Document Server

Watanabe, Y; Awaji, S; Watanabe, K; Fujishiro, H; Ikebe, M

2003-01-01

X-ray diffraction measurements under high and low temperature, and magnetic field have been performed for the doped La sub 1 sub - sub x Ca sub x MnO sub 3 sub + subdelta polycrystals to clarify the coexistent phases and their structures around the composition of x - 0.5. By measurements at high temperature, the transition from a Pnma to an Imma space group symmetry phase has been firstly observed in this system at the temperature between 500degC and 600degC. At low temperature, the importance of the measurement of (131) reflection is noticed and the phase fraction of two similar Pnma phases with ferromagnetic and anti-ferromagnetic states is determined. It is found that the application of the magnetic field by 5 T and the slight change of the composition x by 0.02 remarkably affect this phase fraction. (author)

Scalable fractionation of iron oxide nanoparticles using a CO{sub 2} gas-expanded liquid system

Energy Technology Data Exchange (ETDEWEB)

Vengsarkar, Pranav S.; Xu, Rui; Roberts, Christopher B., E-mail: croberts@eng.auburn.edu [Auburn University, Department of Chemical Engineering (United States)

2015-10-15

Iron oxide nanoparticles exhibit highly size-dependent physicochemical properties that are important in applications such as catalysis and environmental remediation. In order for these size-dependent properties to be effectively harnessed for industrial applications scalable and cost-effective techniques for size-controlled synthesis or size separation must be developed. The synthesis of monodisperse iron oxide nanoparticles can be a prohibitively expensive process on a large scale. An alternative involves the use of inexpensive synthesis procedures followed by a size-selective processing technique. While there are many techniques available to fractionate nanoparticles, many of the techniques are unable to efficiently fractionate iron oxide nanoparticles in a scalable and inexpensive manner. A scalable apparatus capable of fractionating large quantities of iron oxide nanoparticles into distinct fractions of different sizes and size distributions has been developed. Polydisperse iron oxide nanoparticles (2–20 nm) coated with oleic acid used in this study were synthesized using a simple and inexpensive version of the popular coprecipitation technique. This apparatus uses hexane as a CO{sub 2} gas-expanded liquid to controllably precipitate nanoparticles inside a 1L high-pressure reactor. This paper demonstrates the operation of this new apparatus and for the first time shows the successful fractionation results on a system of metal oxide nanoparticles, with initial nanoparticle concentrations in the gram-scale. The analysis of the obtained fractions was performed using transmission electron microscopy and dynamic light scattering. The use of this simple apparatus provides a pathway to separate large quantities of iron oxide nanoparticles based upon their size for use in various industrial applications.

Monovalent cations transfer through isolated human amnion: a new pharmacological model

Energy Technology Data Exchange (ETDEWEB)

Bara, M.; Guiet-Bara, A.; Durlach, J.

1985-04-01

Transfer of monovalent cations through the isolated human amnion consists of different factors: paracellular, coupling, ATPase dependent cellular transfer, leak cellular transfer. Understanding this transfer permits testing of the action of various substances. Physiological substances (Mg, taurine) increase ionic transfer and there is a vicarious effect between Mg and taurine. The tocolytic agents MgSO/sub 4/ and ethanol do not exhibit a good effect on the transfer: decrease with ethanol; equality between entry and exit fluxes with MgSO/sub 4/. On the other hand, amphotericin B increases mother-to-fetus transfer. Polluting metals (Pb, Cd, Hg, As) dramatically reduce exchanges and almost completely inhibit amnion permeability. Ingestion of ethanol also exhibits a dramatic effect on the exchange between mother and fetus through the amnion. Study of ionic transfer in vitro can be considered a pharmacological model to investigate the modifications of mother-fetus exchanges by various substances.

Nano/micro Sr{sub 2}Bi{sub 4}Ti{sub 5}O{sub 18} crystallites: Size dependent structural, second harmonic and piezoelectric properties

Energy Technology Data Exchange (ETDEWEB)

Tukaram, Shet; Bhimireddi, Rajasekhar; Varma, K.B.R., E-mail: kbrvarma@mrc.iisc.ernet.in

2016-09-15

Graphical abstract: Synthesis of Sr{sub 2}Bi{sub 4}Ti{sub 5}O{sub 18} nano/micro crystallites and their size dependent non-linear optical and piezoelectric responses. - Highlights: • Nano/microcrystallites of Sr{sub 2}Bi{sub 4}Ti{sub 5}O{sub 18} were synthesized via sol-gel route. • Crystallite size dependent structural and physical properties were studied. • SHG intensity (1.4 times that of KDP powder) from these crystallites was recorded. • PFM studies on isolated crystallite of 480 nm exhibited d{sub 33} as high as 27 pm/V. • Single domain nature of the crystallites below 160 nm was observed. - Abstract: Strontium bismuth titanate (Sr{sub 2}Bi{sub 4}Ti{sub 5}O{sub 18}) powders comprising crystallites of average sizes in the range of 94–1400 nm were prepared via citrate-assisted sol-gel route. With an increase in the average crystallite size there was a change in the lattice parameters and shift in the Raman vibration modes. Second harmonic signal (532 nm) intensity of the Sr{sub 2}Bi{sub 4}Ti{sub 5}O{sub 18} powders increased with the increase in the average crystallite size and the maximum intensity obtained in the reflection mode was 1.4 times as high as that of the powdered KH{sub 2}PO{sub 4}. Piezo Force Microscopic analyses carried out on isolated crystallite of size 74 nm, established a single domain nature with the coercive field as high as 347 kV/cm. There was a systematic increase in the d{sub 33} value with an increase in the size of the isolated crystallites and a high piezoelectric coefficient of ∼27 pm/V was obtained from an isolated crystallite of size 480 nm.

Separation of UO{sub 2} powder; Separacija praha UO{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Ristic, M M [Institute of Nuclear Sciences Vinca, Laboratorija za reaktorske materijale, Beograd (Serbia and Montenegro)

1962-10-15

This report deals with theoretical approach to separation process and describes the constructed separator with liquid medium. The separator was calibrated and tested with Al{sub 3}O{sub 3} and UO{sub 2}. it has been concluded that it can be used for separation of powders with sufficient accuracy if the separation is performed for a longer period of time. The separated fractions were characterised by microscopic method and the UO{sub 2} fraction additionally by sedimentation method.

Metal-induced stress in bivalves living along a gradient of Cd contamination: relating sub-cellular metal distribution to population-level responses

International Nuclear Information System (INIS)

Perceval, Olivier; Couillard, Yves; Pinel-Alloul, Bernadette; Giguere, Anik; Campbell, Peter G.C.

2004-01-01

frequently and most strongly correlated with the population variables (Pearson's r ranging from -0.58 to -0.80). Our findings demonstrate, however, the difficulty of currently assigning to sub-cellular metal partitioning measurements (mainly Cd bound to the HMW fraction) any predictive role for population health, notably because of the influence of ecological confounding variables (e.g., the cumulative number of degree-days in the littoral zone, as is the case here). Metal contamination of our lakes has decreased markedly in the past 10 years and consequently we believe that the toxic effects of metals may have been replaced by some natural factors as the main agent for structuring the clam populations in these lakes

Comparative effect of Piper betle, Chlorella vulgaris and tocotrienol-rich fraction on antioxidant enzymes activity in cellular ageing of human diploid fibroblasts.

Science.gov (United States)

Makpol, Suzana; Yeoh, Thong Wei; Ruslam, Farah Adilah Che; Arifin, Khaizurin Tajul; Yusof, Yasmin Anum Mohd

2013-08-16

Human diploid fibroblasts (HDFs) undergo a limited number of cellular divisions in culture and progressively reach a state of irreversible growth arrest, a process termed cellular ageing. Even though beneficial effects of Piper betle, Chlorella vulgaris and tocotrienol-rich fraction (TRF) have been reported, ongoing studies in relation to ageing is of interest to determine possible protective effects that may reverse the effect of ageing. The aim of this study was to evaluate the effect of P. betle, C. vulgaris and TRF in preventing cellular ageing of HDFs by determining the activity of antioxidant enzymes viz.; catalase, superoxide dismutase (SOD) and glutathione peroxidase. Different passages of HDFs were treated with P. betle, C. vulgaris and TRF for 24 h prior to enzymes activity determination. Senescence-associated beta-galactosidase (SA β-gal) expression was assayed to validate cellular ageing. In cellular ageing of HDFs, catalase and glutathione peroxidase activities were reduced, but SOD activity was heightened during pre-senescence. P. betle exhibited the strongest antioxidant activity by reducing SA β-gal expression, catalase activities in all age groups, and SOD activity. TRF exhibited a strong antioxidant activity by reducing SA β-gal expression, and SOD activity in senescent HDFs. C. vulgaris extract managed to reduce SOD activity in senescent HDFs. P. betle, C. vulgaris, and TRF have the potential as anti-ageing entities which compensated the role of antioxidant enzymes in cellular ageing of HDFs.

Comparative effect of Piper betle, Chlorella vulgaris and tocotrienol-rich fraction on antioxidant enzymes activity in cellular ageing of human diploid fibroblasts

Science.gov (United States)

2013-01-01

Background Human diploid fibroblasts (HDFs) undergo a limited number of cellular divisions in culture and progressively reach a state of irreversible growth arrest, a process termed cellular ageing. Even though beneficial effects of Piper betle, Chlorella vulgaris and tocotrienol-rich fraction (TRF) have been reported, ongoing studies in relation to ageing is of interest to determine possible protective effects that may reverse the effect of ageing. The aim of this study was to evaluate the effect of P. betle, C. vulgaris and TRF in preventing cellular ageing of HDFs by determining the activity of antioxidant enzymes viz.; catalase, superoxide dismutase (SOD) and glutathione peroxidase. Methods Different passages of HDFs were treated with P. betle, C. vulgaris and TRF for 24 h prior to enzymes activity determination. Senescence-associated beta-galactosidase (SA β-gal) expression was assayed to validate cellular ageing. Results In cellular ageing of HDFs, catalase and glutathione peroxidase activities were reduced, but SOD activity was heightened during pre-senescence. P. betle exhibited the strongest antioxidant activity by reducing SA β-gal expression, catalase activities in all age groups, and SOD activity. TRF exhibited a strong antioxidant activity by reducing SA β-gal expression, and SOD activity in senescent HDFs. C. vulgaris extract managed to reduce SOD activity in senescent HDFs. Conclusion P. betle, C. vulgaris, and TRF have the potential as anti-ageing entities which compensated the role of antioxidant enzymes in cellular ageing of HDFs. PMID:23948056

Fractional-moment CAPM with loss aversion

Energy Technology Data Exchange (ETDEWEB)

Wu Yahao [Dep. of Math., South China University of Technology, Guangzhou 510640 (China); Wang Xiaotian [Dep. of Math., South China University of Technology, Guangzhou 510640 (China)], E-mail: swa001@126.com; Wu Min [Dep. of Math., South China University of Technology, Guangzhou 510640 (China)

2009-11-15

In this paper, we present a new fractional-order value function which generalizes the value function of Kahneman and Tversky [Kahneman D, Tversky A. Prospect theory: an analysis of decision under risk. Econometrica 1979;47:263-91; Tversky A, Kahneman D. Advances in prospect theory: cumulative representation of uncertainty. J. Risk Uncertainty 1992;4:297-323], and give the corresponding fractional-moment versions of CAPM in the cases of both the prospect theory [Kahneman D, Tversky A. Prospect theory: an analysis of decision under risk. Econometrica 1979;47:263-91; Tversky A, Kahneman D. Advances in prospect theory: cumulative representation of uncertainty. J. Risk Uncertainty 1992;4:297-323] and the expected utility model. The models that we obtain can be used to price assets when asset return distributions are likely to be asymmetric stable Levy distribution during panics and stampedes in worldwide security markets in 2008. In particular, from the prospect theory we get the following fractional-moment CAPM with loss aversion: E(R{sub i}-R{sub 0})=(E[(W-W{sub 0}){sub +}{sup -0.12}(R{sub i}-R{sub 0})]+2.25E[(W{sub 0}-W){sub +}{sup -0.12}(R{sub i}-R{sub 0})])/ (E[(W-W{sub 0}){sub +}{sup -0.12} (W-R{sub 0})]+2.25E[(W{sub 0}-W){sub +}{sup -0.12}(W-R{sub 0})]) .E(W-R{sub 0}), where W{sub 0} is a fixed reference point distinguishing between losses and gains.

Measurement of Tau Lepton Branching Fractions

Energy Technology Data Exchange (ETDEWEB)

Nicol, N.

2003-12-19

We present {tau}{sup -} lepton branching fraction measurements based on data from the TPC/Two-Gamma detector at PEP. Using a sample of {tau}{sup -} {yields} {nu}{sub {tau}}K{sup -}{pi}{sup +}{pi}{sup -} events, we examine the resonance structure of the K{sup -}{pi}{sup +}{pi}{sup -} system and obtain the first measurements of branching fractions for {tau}{sup -} {yields} {nu}{sub {tau}}K{sub 1}{sup -}(1270) and {tau}{sup -} {yields} {nu}{sub {tau}}K{sub 1}{sup -}(1400). We also describe a complete set of branching fraction measurements in which all the decays of the {tau}{sup -} lepton are separated into classes defined by the identities of the charged particles and an estimate of the number of neutrals. This is the first such global measurement with decay classes defined by the four possible charged particle species, e, {mu}, {pi}, and K.

Neonatal isolation augments social dominance by altering actin dynamics in the medial prefrontal cortex.

Science.gov (United States)

Tada, Hirobumi; Miyazaki, Tomoyuki; Takemoto, Kiwamu; Takase, Kenkichi; Jitsuki, Susumu; Nakajima, Waki; Koide, Mayu; Yamamoto, Naoko; Komiya, Kasane; Suyama, Kumiko; Sano, Akane; Taguchi, Akiko; Takahashi, Takuya

2016-10-25

Social separation early in life can lead to the development of impaired interpersonal relationships and profound social disorders. However, the underlying cellular and molecular mechanisms involved are largely unknown. Here, we found that isolation of neonatal rats induced glucocorticoid-dependent social dominance over nonisolated control rats in juveniles from the same litter. Furthermore, neonatal isolation inactivated the actin-depolymerizing factor (ADF)/cofilin in the juvenile medial prefrontal cortex (mPFC). Isolation-induced inactivation of ADF/cofilin increased stable actin fractions at dendritic spines in the juvenile mPFC, decreasing glutamate synaptic AMPA receptors. Expression of constitutively active ADF/cofilin in the mPFC rescued the effect of isolation on social dominance. Thus, neonatal isolation affects spines in the mPFC by reducing actin dynamics, leading to altered social behavior later in life.

Neonatal isolation augments social dominance by altering actin dynamics in the medial prefrontal cortex

Science.gov (United States)

Tada, Hirobumi; Miyazaki, Tomoyuki; Takemoto, Kiwamu; Takase, Kenkichi; Jitsuki, Susumu; Nakajima, Waki; Koide, Mayu; Yamamoto, Naoko; Komiya, Kasane; Suyama, Kumiko; Sano, Akane; Taguchi, Akiko; Takahashi, Takuya

2016-01-01

Social separation early in life can lead to the development of impaired interpersonal relationships and profound social disorders. However, the underlying cellular and molecular mechanisms involved are largely unknown. Here, we found that isolation of neonatal rats induced glucocorticoid-dependent social dominance over nonisolated control rats in juveniles from the same litter. Furthermore, neonatal isolation inactivated the actin-depolymerizing factor (ADF)/cofilin in the juvenile medial prefrontal cortex (mPFC). Isolation-induced inactivation of ADF/cofilin increased stable actin fractions at dendritic spines in the juvenile mPFC, decreasing glutamate synaptic AMPA receptors. Expression of constitutively active ADF/cofilin in the mPFC rescued the effect of isolation on social dominance. Thus, neonatal isolation affects spines in the mPFC by reducing actin dynamics, leading to altered social behavior later in life. PMID:27791080

Comparison of trout hepatocytes and liver S9 fractions as in ...

Science.gov (United States)

Isolated hepatocytes and liver S9 fractions have been used to collect in vitro biotransformation data for fish as a means of improving modeled estimates of chemical bioaccumulation. To date, however, there have been few direct comparisons of these two methods. In the present study, cryopreserved trout hepatocytes were used to measure in vitro intrinsic clearance rates for 6 polycyclic aromatic hydrocarbons (PAHs). These rates were extrapolated to estimates of in vivo intrinsic clearance and used as inputs to a well-stirred liver model to predict hepatic clearance. Predicted rates of hepatic clearance were then evaluated by comparison to measured rates determined previously using isolated perfused livers. Hepatic clearance rates predicted using hepatocytes were in good agreement with measured values (fractions. For one compound (benzo[a]pyrene), the in vivo intrinsic clearance rate calculated using S9 data was 10-fold higher than that determined using hepatocytes, possibly due to a diffusion limitation on cellular uptake. Generally, however, there was good agreement between calculated in vivo intrinsic clearance rates obtained using either in vitro test system. These results suggest that both systems can be used to improve

The in vitro sub-cellular localization and in vivo efficacy of novel chitosan/GMO nanostructures containing paclitaxel.

Science.gov (United States)

Trickler, W J; Nagvekar, A A; Dash, A K

2009-08-01

To determine the in vitro sub-cellular localization and in vivo efficacy of chitosan/GMO nanostructures containing paclitaxel (PTX) compared to a conventional PTX treatment (Taxol). The sub-cellular localization of coumarin-6 labeled chitosan/GMO nanostructures was determined by confocal microscopy in MDA-MB-231 cells. The antitumor efficacy was evaluated in two separate studies using FOX-Chase (CB17) SCID Female-Mice MDA-MB-231 xenograph model. Treatments consisted of intravenous Taxol or chitosan/GMO nanostructures with or without PTX, local intra-tumor bolus of Taxol or chitosan/GMO nanostructures with or without PTX. The tumor diameter and animal weight was monitored at various intervals. Histopathological changes were evaluated in end-point tumors. The tumor diameter increased at a constant rate for all the groups between days 7-14. After a single intratumoral bolus dose of chitosan/GMO containing PTX showed significant reduction in tumor diameter on day 15 when compared to control, placebo and intravenous PTX administration. The tumor diameter reached a maximal decrease (4-fold) by day 18, and the difference was reduced to approximately 2-fold by day 21. Qualitatively similar results were observed in a separate study containing PTX when administered intravenously. Chitosan/GMO nanostructures containing PTX are safe and effective administered locally or intravenously. Partially supported by DOD Award BC045664.

Lactobacillus plantarum (VR1 isolated from an Ayurvedic medicine (Kutajarista ameliorates in vitro cellular damage caused by Aeromonas veronii

Directory of Open Access Journals (Sweden)

Patole Milind S

2011-06-01

Full Text Available Abstract Background Lactobacillus plantarum is considered as a safe and effective probiotic microorganism. Among various sources of isolation, traditionally fermented foods are considered to be rich in Lactobacillus spp., which can be exploited for their probiotic attribute. Antibacterial property of L. plantarum has been demonstrated against various enteric pathogens in both in vitro and in vivo systems. This study was aimed at characterizing L. plantarum isolated from Kutajarista, an ayurvedic fermented biomedicine, and assessing its antagonistic property against a common enteropathogen Aeromonas veronii. Results We report the isolation of L. plantarum (VR1 from Kutajarista, and efficacy of its cell free supernatant (CFS in amelioration of cytotoxicity caused by Aeromonas veronii. On the part of probiotic attributes, VR1 was tolerant to pH 2, 0.3% bile salts and simulated gastric juice. Additionally, VR1 also exhibited adhesive property to human intestinal HT-29 cell line. Furthermore, CFS of VR1 was antibacterial to enteric pathogens like Pseudomonas aeruginosa, Staphylococcus aureus, Escherichia coli, Aeromonas veronii and clinical isolates of P. aeruginosa and E. coli. Detailed study regarding the effect of VR1 CFS on A. veronii cytotoxicity showed a significant decrease in vacuole formation and detrimental cellular changes in Vero cells. On the other hand, A. veronii CFS caused disruption of tight junction proteins ZO-1 and actin in MDCK cell line, which was prevented by pre-incubation with CFS of VR1. Conclusions This is the first study to report isolation of L. plantarum (VR1 from Kutajarista and characterisation for its probiotic attributes. Our study demonstrates the antagonistic property of VR1 to A. veronii and effect of VR1 CFS in reduction of cellular damage caused by A. veronii in both Vero and MDCK cell lines.

Evaluation of the Toxicity of Virola sebifera Crude Extracts, Fractions and Isolated Compounds on the Nest of Leaf-Cutting Ants

Directory of Open Access Journals (Sweden)

Keylla Utherdyany Bicalho

2012-01-01

Full Text Available The phytochemical study of Virola sebifera leaves led to the isolation of three lignans: (+-sesamin, (−-hinokinin, and (−-kusunokinin and three flavonoids: quercetin-3-O-α-L-rhamnoside, quercetin-3-O-β-D-glucoside, and quercetin-3-methoxy-7-O-β-D-glucoside by using techniques as high-speed counter-current chromatography and high-performance liquid chromatography. The crude extracts, fractions, and isolated compounds were evaluated for their insecticidal and fungicidal potential against Atta sexdens rubropilosa and its symbiotic fungus Leucoagaricus gongylophorus. The bioassay results showed a high insecticidal activity for the methanol crude extract of the leaves of V. sebifera and its n-hexane, dichloromethane and ethyl acetate fractions. The fungicidal bioassay revealed high toxicity of the lignans against L. gongylophorus.

Determination of NAD⁺ and NADH level in a Single Cell Under H<sub>2sub>O>2sub> Stress by Capillary Electrophoresis

Energy Technology Data Exchange (ETDEWEB)

Xi, Wenjun [Iowa State Univ., Ames, IA (United States)

2008-01-01

A capillary electrophoresis (CE) method is developed to determine both NAD⁺ and NADH levels in a single cell, based on an enzymatic cycling reaction. The detection limit can reach down to 0.2 amol NAD⁺ and 1 amol NADH on a home-made CE-LIF setup. The method showed good reproducibility and specificity. After an intact cell was injected into the inlet of a capillary and lysed using a Tesla coil, intracellular NAD⁺ and NADH were separated, incubated with the cycling buffer, and quantified by the amount of fluorescent product generated. NADH and NAD⁺ levels of single cells of three cell lines and primary astrocyte culture were determined using this method. Comparing cellular NAD⁺ and NADH levels with and without exposure to oxidative stress induced by H<sub>2sub>O>2sub>, it was found that H9c2 cells respond to the stress by reducing both cellular NAD⁺ and NADH levels, while astrocytes respond by increasing cellular NADH/NAD⁺ ratio.

Cellular reflectarray antenna and method of making same

Science.gov (United States)

Romanofsky, Robert R (Inventor)

2011-01-01

A method of manufacturing a cellular reflectarray antenna arranged in an m by n matrix of radiating elements for communication with a satellite includes steps of determining a delay .phi.m,n for each of said m by n matrix of elements of said cellular reflectarray antenna using sub-steps of: determining the longitude and latitude of operation, determining elevation and azimuth angles of the reflectarray with respect to the satellite and converting theta.sub.0 (.theta..sub.0) and phi.sub.0 (.phi..sub.0), determining .DELTA..beta..sub.m,n, the pointing vector correction, for a given inter-element spacing and wavelength, determining .DELTA..phi..sub.m,n, the spherical wave front correction factor, for a given radius from the central element and/or from measured data from the feed horn; and, determining a delay .phi.m,n for each of said m by n matrix of elements as a function of .DELTA..beta..sub.m,n and .DELTA..phi..sub.m,n.

The Curative Activity of Isolated Fraction from Spathodea campanulata Beauv Stem Bark on Rat’s Exposed to Benzopyrene

Directory of Open Access Journals (Sweden)

Masruri Masruri

2014-11-01

Full Text Available This paper reports a screening results of the secondary metabolites composed in Spathodea campanulata Beauv stem bark, evaluate inhibiting activity of malondialdehyde (MDA on rat’s cancer model exposed with benzopyrene, and the histology of its lung. The secondary metabolite of the stem bark fraction consisted of alkaloids, flavonoids-phenolic, terpenoid and steroid compounds. The isolated fraction contained of these metabolites significantly indicate bioactivity by reducting of malondialdehyde (MDA level, and also histology appearance of the lung tissue prepared from the benzopyrene-exposed rat indicated a curative activity.

A [Mo{sub 2}O{sub 2}S{sub 2}]-based ring system incorporating tartrate as the bridging ligand. Synthesis, structure and catalytic activity of Cs{sub 4}[Mo{sub 2}O{sub 2}(μ-S){sub 2}]{sub 2}(μ{sub 4}-tart){sub 2} (tart=[C{sub 4}H{sub 2}O{sub 6}]{sup 4-})

Energy Technology Data Exchange (ETDEWEB)

Qian, Ting-Ting; Cui, Yu-Jie; Xin, Zhifeng; Jia, Ai-Quan; Zhang, Qian-Feng [Anhui Univ. of Technology, Anhui (China). Inst. of Molecular Engineering and Applied Chemistry and Anhui Province Key Lab. of Metallurgy Engineering and Resources Recycling

2017-08-01

Treatment of [Mo{sub 2}S{sub 2}O{sub 2}(H{sub 2}O){sub 6}]{sup 2+} with racemic tartaric acid (tartH{sub 4}) in the presence of sodium hydroxide and cesium chloride in aqueous solution led to the isolation of a new tetra-molybdenum ring cluster Cs{sub 4}[Mo{sub 2}O{sub 2}(μ-S){sub 2}]{sub 2}(μ{sub 4}-tart){sub 2}. The cyclic cluster polyanion consists of two dinuclear [Mo{sub 2}O{sub 2}(μ-S){sub 2}]{sup 2+} moieties and two bridging tart{sup 4-} ligands. The cyclic polyoxothiomolybdate cluster, supported on the mesoporous silica SBA-15, was tested for heterogenerous catalysis in thiophene hydrodesulfurization.

Magnetic field-induced elastic bending in bilayers of Tb{sub 1−x}Dy{sub x}Fe{sub 2−y} and Pb(Zr{sub 1−z}Ti{sub z})O{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Jin, Tao; Qichao, Wu; Ning, Zhang, E-mail: zhangning@njnu.edu.cn

2014-09-01

Magnetic field-induced strain in the magnetoelectric bilayers of Tb{sub 1−x}Dy{sub x}Fe{sub 2−y} and Pb(Zr{sub 1−z}Ti{sub z})O{sub 3} was studied. A butterfly shaped strain curve was observed on the surface of Pb(Zr{sub 1−z}Ti{sub z})O{sub 3}. The shape of the strain curve was found to be related to the sample thickness and the volume fraction occupied by the ferroelectrics in the bilayer. Theoretical analysis and experimental results showed that magnetoelastic bending in the bilayer composites was largely responsible for the butterfly strain curve. - Highlights: • Butterfly strain curves were observed on the PZT surface for bilayers of TDF and PZT. • The strain curve is related to the sample thickness and the volume fraction of the PZT. • A physics model depicting the field-controlled bending of the bilayers was developed. • The magnetoelastic bending was found to account for the butterfly strain curve.

The role of the isolated 6s states in BiVO{sub 4} on the electronic and atomic structures

Energy Technology Data Exchange (ETDEWEB)

Ma, Jie; Wang, Lin-Wang [Joint Center for Artificial Photosynthesis and Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)

2014-10-27

BiVO{sub 4} is one of the most promising photoanodes for water-splitting applications. Similar to many d{sup 10} materials, where the full-shell d electrons are not directly involved in the bonding, the Bi 6s electrons form isolated low-energy bands in BiVO{sub 4}. By systematically altering the energy of the Bi 6s states, we find direct evidences that the isolated s states, through the s-p coupling, affect the BiVO{sub 4} properties, including valence band maximum position, charge density, and atomic structural distortion. We find that many good properties of BiVO{sub 4} for water splitting are related to the s-p coupling due to the existence of Bi 6s states. Based on this understanding, we propose that alloying Bi with Sb can enhance these properties, and hence improve the water-splitting efficiency.

Using Electromagnetic Algorithm for Total Costs of Sub-contractor Optimization in the Cellular Manufacturing Problem

Directory of Open Access Journals (Sweden)

Mohammad Reza Shahriari

2016-12-01

Full Text Available In this paper, we present a non-linear binary programing for optimizing a specific cost in cellular manufacturing system in a controlled production condition. The system parameters are determined by the continuous distribution functions. The aim of the presented model is to optimize the total cost of imposed sub-contractors to the manufacturing system by determining how to allocate the machines and parts to each seller. In this system, DM could control the occupation level of each machine in the system. For solving the presented model, we used the electromagnetic meta-heuristic algorithm and Taguchi method for determining the optimal algorithm parameters.

Spectroscopy of fractional Josephson vortex molecules

Energy Technology Data Exchange (ETDEWEB)

Goldobin, Edward; Gaber, Tobias; Buckenmaier, Kai; Kienzle, Uta; Sickinger, Hanna; Koelle, Dieter; Kleiner, Reinhold [Physikalisches Institut - Experimentalphysik II, Center for Collective Quantum Phenomena, Universitaet Tuebingen, Auf der Morgenstelle 14, D-72076 Tuebingen (Germany)

2010-07-01

Using tiny current injectors we create {kappa} discontinuities of the Josephson phase in a long Josephson junction. The junction reacts at the discontinuities by creating fractional Josephson vortices of size {lambda}{sub J} pinned at them. Such vortices carry the flux {phi}, which is a fraction of the magnetic flux quantum {phi}{sub 0}{approx}2.07 x 10{sup -15} Wb. Being pinned, a fractional vortex has an eigenfrequency (localized mode), which depends on {kappa} and applied bias current, and which lays within the plasma gap. If one considers a molecule consisting of several coupled fractional vortices, the eigenfrequency will split into several modes. We report on spectroscopy of a fractional vortex molecule performed in the thermal regime.

Microstructure and phase morphology during thermochemical processing of {alpha}{sub 2}-based titanium aluminide castings

Energy Technology Data Exchange (ETDEWEB)

Saqib, M. [Wright State Univ., Dayton, OH (United States). Dept. of Mechanical and Materials Engineering; Apgar, L.S. [Dayton Univ., OH (United States). Graduate Materials Engineering; Eylon, D. [Dayton Univ., OH (United States). Graduate Materials Engineering; Weiss, I. [Wright State Univ., Dayton, OH (United States). Dept. of Mechanical and Materials Engineering

1995-12-31

Changes in the microstructure, volume fraction and distribution of phases during different stages of thermochemical processing of Ti-25Al-10Nb-3V-1Mo (at.%) castings were investigated. Up to 14.5 at.% (0.35 wt.%) of hydrogen was introduced into the material by gas charging at temperatures between 650 and 980 C for times up to 20 h. The material was subsequently dehydrogenated by vacuum annealing at 650 C for 48 h. Investment cast Ti-25Al-10Nb-3V-1Mo alloy, hot isostatically pressed (HIP) at 1175 C at 260 MPa for 6 h, was used as the starting material. The microstructure of the as-HIP material consists of {alpha}{sub 2}, B2 and orthorhombic phases. The {alpha}{sub 2} phase exists in equiaxed, Widmanstaeten and cellular morphologies. The B2 phase is observed mainly along {alpha}{sub 2}/{alpha}{sub 2} boundaries. Some {alpha}{sub 2} Widmanstaeten also contain very fine orthorhombic phase in a plate-like morphology. Hydrogenation of the material modified the microstructure; however, the morphology of the {alpha}{sub 2} and B2 phases did not change. Furthermore, hydride precipitation and a higher volume fraction of the orthorhombic phase were observed compared with the as-HIP material. Following dehydrogenation, the hydrogen level in the material was found to be less than 0.1 at.% (0.0025wt.%). Transmission electron microscopy of the dehydrogenated material did not reveal the presence of hydride precipitates; however, the high volume fraction of the orthorhombic phase was found to persist following dehydrogenation. (orig.)

Identification of PM{sub 10} characteristics involved in cellular responses in human bronchial epithelial cells (Beas-2B)

Energy Technology Data Exchange (ETDEWEB)

Van Den Heuvel, Rosette, E-mail: rosette.vandenheuvel@vito.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); Den Hond, Elly, E-mail: elly.denhond@wiv-isp.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); Govarts, Eva, E-mail: eva.govarts@vito.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); Colles, Ann, E-mail: ann.colles@vito.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); Koppen, Gudrun, E-mail: gudrun.koppen@vito.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); Staelens, Jeroen, E-mail: j.staelens@vmm.be [Flanders Environment Agency (VMM), Unit Air, Kronenburgstraat 45, 2000 Antwerp (Belgium); Mampaey, Maja, E-mail: maja.mampaey@lne.vlaanderen.be [LNE (Environment, Nature and Energy Department), Flemish Government, Koning Albert II-laan 20, 1000 Brussels (Belgium); Janssen, Nicole, E-mail: nicole.janssen@rivm.nl [National Institute for Public Health and the Environment (RIVM), P.O. Box, 2720 BA, Bilthoven (Netherlands); Schoeters, Greet, E-mail: greet.schoeters@vito.be [Flemish Institute for Technological Research (VITO), Environmental Risk and Health Unit, Boeretang 200, 2400 Mol (Belgium); University of Antwerp, Department of Biomedical Sciences, 2000 Antwerp (Belgium)

2016-08-15

single and multiple regression analyses. The reduction in cell viability was significantly correlated with BC, Cd and Pb. The induction of IL-8 in Beas-2B cells was significantly associated with Cu, Ni and Zn and endotoxin. Endotoxin levels explained 33% of the variance in IL-8 induction. A significant interaction between ambient temperature and endotoxin on the pro-inflammatory activity was seen. No association was found between OP and the cellular responses. This study supports the hypothesis that, on an equal mass basis, PM{sub 10} induced biological effects differ due to differences in PM{sub 10} characteristics. Metals (Cd, Cu, Ni and Zn), BC, and endotoxin were among the main determinants for the observed biological responses. - Highlights: • On an equal mass basis, PM{sub 10} sampled at an urban, rural and industrial site induced different cellular effects in Beas-2B. • Endotoxin levels and oxidative potential (OP) were analysed in the PM{sub 10} samples. • Black carbon, cadmium and lead were correlated with decreased cell viability. • Endotoxin levels explained the majority of the variance in il-8 induction. • Oxidatively damaged DNA was observed in all the samples.

Synthesis and characterisation of zinc oxide nanoparticles using terpenoid fractions of Andrographis paniculata leaves

Science.gov (United States)

Kavitha, S.; Dhamodaran, M.; Prasad, Rajendra; Ganesan, M.

2017-04-01

Zinc oxide (ZnO) nanoparticles have been widely employed for various pharmacological applications. Several approaches were tried to synthesize ZnO nanoparticles. In this study, ZnO nanoparticles were biosynthesized using terpenoid (TAP) fractions isolated from Andrographis paniculata leaves. Subsequently, the ZnNO3 (0.1 N) is treated with the isolated TAP fractions to biosynthesize zinc oxide nanoparticles (Zn-TAP NPs). This nanoparticle preparation has been confirmed by the colour change from green to cloudy-white and the peak at 300 nm by UV-Visible spectra. FTIR analysis of Zn-TAP NPs showed the presence of functional group (i.e.) C=O which has further been confirmed by H1-NMR studies. From SEM and XRD analysis, it has been found that the hexagonal nanorod particle is 20.23 nm in size and +17.6 mV of zeta potential. Hence, it can be easily absorbed by negatively charged cellular membrane to contribute for efficient intracellular distribution. Therefore, it is suggested that the synthesised Zn-TAP NPs are more suitable in drug delivery processes.

Antiulcerogenic activity of fractions and 3,15-dioxo-21alpha-hydroxy friedelane isolated from Maytenus robusta (Celastraceae).

Science.gov (United States)

de Andrade, Sérgio Faloni; Comunello, Eros; Noldin, Vânia Floriani; Monache, Franco Delle; Cechinel Filho, Valdir; Niero, Rivaldo

2008-01-01

The hexane, chloroform, ethyl acetate and aqueous-soluble fractions from leaves of Maytenus robusta (Celastraceae) were evaluated for their protective actions against ethanol-induced gastric lesions in rats. The treatment with all fractions (150 mg/kg) and omeprazol (30 mg/kg) significantly reduced the lesion index, the total lesion area, and the percentage of lesion, in comparison with the control group (p<0.05). Since the ethyl acetate-soluble fraction was found to be most active in the pylorus ligated model, this fraction was further investigated and resulted in the isolation of triterpene 3,15-dioxo-21alpha-hydroxy friedelane. The triterpene was evaluated in the HCl/ethanol-induced ulcer model in mice. In this assay, both the groups treated with 3,15-dioxo-21alpha-hydroxy friedelane and omeprazol, at a dose of 30 mg/kg, presented a significant reduction in lesion index, total lesion area, and in the percentage of the lesion, when compared with the control group (p<0.05). The result suggests that the antiulcer effect observed in the extract and fractions may be attributed, at least in part, to this compound. Further experiments are underway to determine which antiulcer mechanisms involved in gastroprotection.

Hybrid model of atmospheric pressure Ar/O{sub 2}/TiCl{sub 4} radio-frequency capacitive discharge for TiO{sub 2} deposition

Energy Technology Data Exchange (ETDEWEB)

Leblanc, A. [ENS Cachan, UPMC, Paris (France); Ding, Ke [College of Science, Donghua University, Shanghai 201620 (China); Lieberman, M. A., E-mail: lieber@eecs.berkeley.edu [Department of Electrical Engineering, University of California, Berkeley, California 94720 (United States); Wang, De Xin; Zhang, Jing; Jun Shi, Jian [College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China)

2014-05-14

A hybrid global-analytical model of an atmospheric pressure radio-frequency driven capacitive discharge is applied to determine the plasma conditions for TiO{sub 2} film deposition. The feed gas is mainly argon with a small fraction of O{sub 2} and a smaller fraction of TiCl{sub 4}. Variations of the discharge parameters and species densities with O{sub 2} concentration, discharge power, and flow rate are determined. A simplified chemistry model is developed and compared with the simulation results, showing good agreement. For a base case with Ar/O{sub 2}/TiCl{sub 4} flow rates of 203/30/0.17 sccm, the results indicate that a minimum O{sub 2} fraction of 7.3 × 10{sup −4} is required for pure (un-chlorinated) TiO{sub 2} film deposition that the active precursor species is TiO{sub 2}Cl{sub 3}, with subsequent abstraction of Cl atoms by dissociative electron attachment and that the deposition rates are around 1 nm/s.

WE-AB-204-12: Dosimetry at the Sub-Cellular Scale of Auger-Electron Emitter 99m-Tc in a Mouse Single Thyroid Follicle Model

Energy Technology Data Exchange (ETDEWEB)

Taborda, A; Benabdallah, N; Desbree, A [Institut de Radioprotection et de Surete Nucleaire, Fontenay-aux-roses (France)

2015-06-15

Purpose: To perform a dosimetry study at the sub-cellular scale of Auger-electron emitter 99m-Tc using a mouse single thyroid cellular model to investigate the contribution of the 99m-Tc Auger-electrons to the absorbed dose and possible link to the thyroid stunning in in vivo experiments in mice, recently reported in literature. Methods: The simulation of S-values for Auger-electron emitting radionuclides was performed using both the recent MCNP6 software and the Geant4-DNA extension of the Geant4 toolkit. The dosimetric calculations were validated through comparison with results from literature, using a simple model of a single cell consisting of two concentric spheres of unit density water and for six Auger-electron emitting radionuclides. Furthermore, the S-values were calculated using a single thyroid follicle model for uniformly distributed 123-I and 125-I radionuclides and compared with published S-values. After validation, the simulation of the S-values was performed for the 99m-Tc radionuclide within the several mouse thyroid follicle cellular compartments, considering the radiative and non-radiative transitions of the 99m-Tc radiation spectrum. Results: The calculated S-values using MCNP6 are in good agreement with the results from literature, validating its use for the 99m-Tc S-values calculations. The most significant absorbed dose corresponds to the case where the radionuclide is uniformly distributed in the follicular cell’s nucleus, with a S-value of 7.8 mGy/disintegration, due mainly to the absorbed Auger-electrons. The results show that, at a sub-cellular scale, the emitted X-rays and gamma particles do not contribute significantly to the absorbed dose. Conclusion: In this work, MCNP6 was validated for dosimetric studies at the sub-cellular scale. It was shown that the contribution of the Auger-electrons to the absorbed dose is important at this scale compared to the emitted photons’ contribution and can’t be neglected. The obtained S

Isolation of CYP1A inducing components in coal tar fraction (F3) of Alaska north slope crude oil : a preliminary study

Energy Technology Data Exchange (ETDEWEB)

Saravanabhavan, G.; Brown, R.S. [Queen' s Univ., Kingston, ON (Canada). Dept. of Chemistry; Khan, C.W.; Hodson, P.V. [Queen' s Univ., Kingston, ON (Canada). Dept. of Biology

2004-07-01

Recent concerns regarding the effects of weathered crude oil on the early life stage of aquatic organisms are related to reports that blue sac disease (BSD) has been linked to larval fish exposed to crude oil. Studies have shown that a relationship exists between the induction of CYP1A enzymes and the occurrence of BSD in fish species. However, the mechanism of BSD is not fully understood. This study contributed to the Toxicity Identification and Evaluation (TIE) approach by isolating the CYP1A enzyme. An improved separation and analysis method for characterizing crude oil was also developed. Earlier studies revealed that the highest CYP1A activity occurred in the coal tar fraction of crude oil, which is rich in polycyclic aromatic hydrocarbons (PAH) and which contains many classes of compounds such as waxes, asphaltenes and resins. The TIE method included separation of these compound classes as well as a detailed characterization of the PAH classes. A solvent extraction method was also developed to fractionate the coal tar fraction into compound classes with particular emphasis on isolating PAH components. The study showed that fractions rich in PAH were responsible for a significant CYP1A induction in juvenile trout, but fractions poor in PAH did not. The solid phase extraction method offered better PAH fractions for further analysis by liquid chromatography.

Effects of atmospheric pressure plasmas on isolated and cellular DNA-a review.

Science.gov (United States)

Arjunan, Krishna Priya; Sharma, Virender K; Ptasinska, Sylwia

2015-01-29

Atmospheric Pressure Plasma (APP) is being used widely in a variety of biomedical applications. Extensive research in the field of plasma medicine has shown the induction of DNA damage by APP in a dose-dependent manner in both prokaryotic and eukaryotic systems. Recent evidence suggests that APP-induced DNA damage shows potential benefits in many applications, such as sterilization and cancer therapy. However, in several other applications, such as wound healing and dentistry, DNA damage can be detrimental. This review reports on the extensive investigations devoted to APP interactions with DNA, with an emphasis on the critical role of reactive species in plasma-induced damage to DNA. The review consists of three main sections dedicated to fundamental knowledge of the interactions of reactive oxygen species (ROS)/reactive nitrogen species (RNS) with DNA and its components, as well as the effects of APP on isolated and cellular DNA in prokaryotes and eukaryotes.

Femtosecond laser nanosurgery of sub-cellular structures in HeLa cells by employing Third Harmonic Generation imaging modality as diagnostic tool.

Science.gov (United States)

Tserevelakis, George J; Psycharakis, Stylianos; Resan, Bojan; Brunner, Felix; Gavgiotaki, Evagelia; Weingarten, Kurt; Filippidis, George

2012-02-01

Femtosecond laser assisted nanosurgery of microscopic biological specimens is a relatively new technique which allows the selective disruption of sub-cellular structures without causing any undesirable damage to the surrounding regions. The targeted structures have to be stained in order to be clearly visualized for the nanosurgery procedure. However, the validation of the final nanosurgery result is difficult, since the targeted structure could be simply photobleached rather than selectively destroyed. This fact comprises a main drawback of this technique. In our study we employed a multimodal system which integrates non-linear imaging modalities with nanosurgery capabilities, for the selective disruption of sub-cellular structures in HeLa cancer cells. Third Harmonic Generation (THG) imaging modality was used as a tool for the identification of structures that were subjected to nanosurgery experiments. No staining of the biological samples was required, since THG is an intrinsic property of matter. Furthermore, cells' viability after nanosurgery processing was verified via Two Photon Excitation Fluorescence (TPEF) measurements. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Orientation selection of equiaxed dendritic growth by three-dimensional cellular automaton model

Energy Technology Data Exchange (ETDEWEB)

Wei Lei [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi' an 710072 (China); Lin Xin, E-mail: xlin@nwpu.edu.cn [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi' an 710072 (China); Wang Meng; Huang Weidong [State Key Laboratory of Solidification Processing, Northwestern Polytechnical University, Xi' an 710072 (China)

2012-07-01

A three-dimensional (3-D) adaptive mesh refinement (AMR) cellular automata (CA) model is developed to simulate the equiaxed dendritic growth of pure substance. In order to reduce the mesh induced anisotropy by CA capture rules, a limited neighbor solid fraction (LNSF) method is presented. It is shown that the LNSF method reduced the mesh induced anisotropy based on the simulated morphologies for isotropic interface free energy. An expansion description using two interface free energy anisotropy parameters ({epsilon}{sub 1}, {epsilon}{sub 2}) is used in the present 3-D CA model. It is illustrated by present 3-D CA model that the positive {epsilon}{sub 1} favors the dendritic growth with the Left-Pointing-Angle-Bracket 100 Right-Pointing-Angle-Bracket preferred directions, and negative {epsilon}{sub 2} favors dendritic growth with the Left-Pointing-Angle-Bracket 110 Right-Pointing-Angle-Bracket preferred directions, which has a good agreement with the prediction of the spherical plot of the inverse of the interfacial stiffness. The dendritic growths with the orientation selection between Left-Pointing-Angle-Bracket 100 Right-Pointing-Angle-Bracket and Left-Pointing-Angle-Bracket 110 Right-Pointing-Angle-Bracket are also discussed using the different {epsilon}{sub 1} with {epsilon}{sub 2}=-0.02. It is found that the simulated morphologies by present CA model are as expected from the minimum stiffness criterion.

On the solution of fractional evolution equations

Energy Technology Data Exchange (ETDEWEB)

Kilbas, Anatoly A [Department of Mathematics and Mechanics, Belarusian State University, 220050 Minsk (Belarus); Pierantozzi, Teresa [Departamento de Matematica Aplicada, Facultad de Informatica, Universidad Complutense, E-28040 Madrid (Spain); Trujillo, Juan J [Departamento de Analisis Matematico, Universidad de la Laguna, 38271 La Laguna-Tenerife (Spain); Vazquez, Luis [Departamento de Matematica Aplicada, Facultad de Informatica, Universidad Complutense, E-28040 Madrid (Spain)

2004-03-05

This paper is devoted to the solution of the bi-fractional differential equation ({sup C}D{sup {alpha}}{sub t}u)(t, x) = {lambda}({sup L}D{sup {beta}}{sub x}u)(t, x) (t>0, -{infinity} 0 and {lambda} {ne} 0, with the initial conditions lim{sub x{yields}}{sub {+-}}{sub {infinity}} u(t,x) = 0 u(0+,x)=g(x). Here ({sup C}D{sup {alpha}}{sub t}u)(t, x) is the partial derivative coinciding with the Caputo fractional derivative for 0 < {alpha} < 1 and with the usual derivative for {alpha} = 1, while ({sup L}D{sup {beta}}{sub x}u)(t, x)) is the Liouville partial fractional derivative ({sup L}D{sup {beta}}{sub t}u)(t, x)) of order {beta} > 0. The Laplace and Fourier transforms are applied to solve the above problem in closed form. The fundamental solution of these problems is established and its moments are calculated. The special case {alpha} = 1/2 and {beta} = 1 is presented, and its application is given to obtain the Dirac-type decomposition for the ordinary diffusion equation.

Identification of microbes from the surfaces of food-processing lines based on the flow cytometric evaluation of cellular metabolic activity combined with cell sorting.

Science.gov (United States)

Juzwa, W; Duber, A; Myszka, K; Białas, W; Czaczyk, K

2016-09-01

In this study the design of a flow cytometry-based procedure to facilitate the detection of adherent bacteria from food-processing surfaces was evaluated. The measurement of the cellular redox potential (CRP) of microbial cells was combined with cell sorting for the identification of microorganisms. The procedure enhanced live/dead cell discrimination owing to the measurement of the cell physiology. The microbial contamination of the surface of a stainless steel conveyor used to process button mushrooms was evaluated in three independent experiments. The flow cytometry procedure provided a step towards monitoring of contamination and enabled the assessment of microbial food safety hazards by the discrimination of active, mid-active and non-active bacterial sub-populations based on determination of their cellular vitality and subsequently single cell sorting to isolate microbial strains from discriminated sub-populations. There was a significant correlation (r = 0.97; p vitality and the identification of species from defined sub-populations, although the identified microbes were limited to culturable cells.

Kinetics of cellular transformation and competing precipitation mechanisms during sub-eutectoid annealing of U10Mo alloys

Energy Technology Data Exchange (ETDEWEB)

Jana, Saumyadeep; Devaraj, Arun; Kovarik, Libor; Arey, Bruce W.; Sweet, Lucas E.; Varga, Tamas; Lavender, Curt A.; Joshi, Vineet V.

2017-11-01

Transformation kinetics of metastable body-centered cubic γ-UMo phase in U-10 wt.percent Mo alloy during annealing at sub-eutectoid temperatures of 500C and 400C has been determined as a function of time using detailed microstructural characterization by scanning electron microscopy, X-ray diffraction analysis, scanning transmission electron microscopy, and atom probe tomography. Based on the results, we found that the phase transformation is initiated by cellular transformation at both the temperatures, which results in formation of a lamellar microstructure along prior γ-UMo grain boundaries.

Isolation, Fractionation, and Identification of Sucrose Esters from Various Oriental Tobaccos Employing Supercritical Fluids

Directory of Open Access Journals (Sweden)

Ashraf-Khorassani M

2014-12-01

Full Text Available Isolation, fractionation, and identification of sucrose esters from aged oriental tobacco employing supercritical fluids have been completed. Underivatized sucrose ester-rich extracts were obtained using supercritical CO2 at densities greater than 0.73 g/mL. Lower density CO2 provided extracts with notable amounts of tobacco derived material; yet, no detectable sucrose ester content. Preparative supercritical fluid chromatography (SFC provided for an additional purification of the sucrose ester-enriched fraction after column optimization. Structural assignments of the SFC fractions were facilitated using gas chromatography/mass spectrometry (GC/MS accompanied by N, O-bis(trimethylsilyltrifluoroacetamide-dimethylformamide (BSTFA-DMF derivatization of the free hydroxyl groups and high performance-liquid chromatography/mass spectrometry (HPLC/MS. From a relative quantitative perspective regardless of tobacco type, sucrose esters having an acetyl group on C6 of the glucose function (Group III were in higher concentration compared to both the concentration observed for sucrose ester of Group I (acetyl group on C3 of fructose and sucrose ester of Group II (no acetyl group on either glucose or fructose. Saturated fatty acid constituents were found to range from a maximum total of 18 carbons to a minimum total of 13 carbons. Unsaturated and isomeric fatty acid homologues were detected within the Group II sucrose ester.

Measurement of Neutral B Decay Branching Fractions to K{sub s}{sup 0}{pi}{sup +}{pi}{sup -} Final States

Energy Technology Data Exchange (ETDEWEB)

Olaiya, E

2004-08-13

The branching fractions for B{sup 0} --> K{sup 0}{pi}{sup +}{pi}{sup -}, B{sup 0} --> K*{sup +}{pi}{sup -} and B{sup 0} --> D{sup -}(--> K{sub s}{sup 0}{pi}{sup -}){pi}{sup +} decaying to a K{sub s}{sup 0}{pi}{sup +}{pi}{sup -} state have been measured and agree with previous measurements. The direct CP violating parameter A{sub K*{pi}} was measured for the decay B{sup 0} --> K*{sup +}{pi}{sup -} and is in agreement with the CLEO measurement, with no evidence of CP violation with the statistics used. Using larger datasets, one can extract amplitudes and relative phases of the resonant contributions to the Dalitz plot, with the possibility to observe new B-meson decays.

Magnetic and structural properties of the Nd{sub 2}(Fe{sub 100-x}Nb{sub x}){sub 14}B system prepared by arc melting

Energy Technology Data Exchange (ETDEWEB)

Oyola Lozano, D., E-mail: doyola@ut.edu.co [University of Tolima, Department of Physics (Colombia); Zamora, L. E.; Perez Alcazar, G. A. [University of Valle, Department of Physics (Colombia); Rojas, Y. A.; Bustos, H. [University of Tolima, Department of Physics (Colombia); Greneche, J. M. [Universite du Maine, Laboratoire de Physique de l' Etat Condense, UMR CNRS 6087 (France)

2006-04-15

In this work the magnetic and structural properties are investigated by Moessbauer spectrometry, Vibrating Sample Magnetometry and X-ray diffraction of Nd{sub 2}(Fe{sub 100-x}Nb{sub x}){sub 14}B powdered alloys with x = 0, 2 and 4 prepared by arc melting. The Moessbauer spectra of the samples were fitted with several contributions from: Nd{sub 2}Fe{sub 14}B, {alpha}-Fe and a paramagnetic phase associated with Nd{sub 1.1}Fe{sub 4}B{sub 4} for x = 0 and additionally from NbFeB and Nd{sub 2}Fe{sub 17} for x = 2 and x = 4. The relative fractions of {alpha}-Fe and Nd{sub 2}Fe{sub 14}B are smaller for x = 4 than for x = 0, indicating that the amount of these two phases is reduced with increasing Nb content, while the relative fraction of Nd{sub 2}Fe{sub 17} increases. The {alpha}-Fe grain size slightly decreases while that of the Nd{sub 2}Fe{sub 14}B phase is increasing, when the Nb content increases. The hysteresis loops indicate that these samples behave as hard ferromagnets, with a coercive field which decreases when the Nb content increases, but with rather low remanent magnetization.

Toxicity of selenite in the unicellular green alga Chlamydomonas reinhardtii: Comparison between effects at the population and sub-cellular level

International Nuclear Information System (INIS)

Morlon, Helene; Fortin, Claude; Floriani, Magali; Adam, Christelle; Garnier-Laplace, Jacqueline; Boudou, Alain

2005-01-01

The toxicity of selenium in aquatic ecosystems is mainly linked to its uptake and biotransformation by micro-organisms, and its subsequent transfer upwards into the food chain. Thus, organisms at low trophic level, such as algae, play a crucial role. The aim of our study was to investigate the biological effects of selenite on Chlamydomonas reinhardtii, both at the sub-cellular level (effect on ultrastructure) and at the population level (effect on growth). The cells were grown under batch culture conditions in well-defined media and exposed to waterborne selenite at concentrations up to 500 μM; i.e. up to lethal conditions. Based on the relationship between Se concentration and cell density achieved after a 96 h exposure period, an EC 50 of 80 μM with a 95% confidence interval ranging between 64 and 98 μM was derived. No adaptation mechanisms were observed: the same toxicity was quantified for algae pre-contaminated with Se. The inhibition of growth was linked to impairments observed at the sub-cellular level. The intensity of the ultrastructural damages caused by selenite exposure depended on the level and duration of exposure. Observations by TEM suggested chloroplasts as the first target of selenite cytotoxicity, with effects on the stroma, thylakoids and pyrenoids. At higher concentrations, we could observe an increase in the number and volume of starch grains. For cells collected at 96 h, electron-dense granules were observed. Energy-dispersive X-ray microanalysis revealed that these granules contained selenium and were also rich in calcium and phosphorus. This study confirms that the direct toxicity of selenite on the phytoplankton biomass is not likely to take place at concentrations found in the environment. At higher concentrations, the link between effects at the sub-cellular and population levels, the over-accumulation of starch, and the formation of dense granules containing selenium are reported for the first time in the literature for a

The first quinary rare earth thiophosphates. Cs{sub 5}Ln{sub 3}X{sub 3}(P{sub 2}S{sub 6}){sub 2}(PS{sub 4}) (Ln = La, Ce, X = Br, Cl) and the quasi-quaternary Cs{sub 10}Y{sub 4}Cl{sub 10}(P{sub 2}S{sub 6}){sub 3}

Energy Technology Data Exchange (ETDEWEB)

Schoop, Leslie Mareike; Eger, Roland; Nuss, Juergen; Pielnhofer, Florian [Max Planck Institute for Solid State Research, Stuttgart (Germany); Lotsch, Bettina Valeska [Max Planck Institute for Solid State Research, Stuttgart (Germany); Nanosystems Initiative Munich (NIM) and Center for Nanoscience, Muenchen (Germany)

2017-12-13

We report the first examples of quinary rare earth thiophosphates with a fully ordered cation and anion distribution, Cs{sub 5}Ln{sub 3}X{sub 3}(P{sub 2}S{sub 6}){sub 2}(PS{sub 4}), (Ln = La, Ce and X = Br, Cl) as well as the quasi-quaternary Cs{sub 10}Y{sub 4}Cl{sub 10}(P{sub 2}S{sub 6}){sub 3}. These four new compounds crystallize in three different, unknown structure types. The yellowish, transparent, brittle Cs{sub 5}Ce{sub 3}Br{sub 3}(P{sub 2}S{sub 6}){sub 2}(PS{sub 4}) crystallizes in the orthorhombic space group Pnma (no. 62) with a = 13.276(3), b = 14.891(3), c = 19.593(4) Aa, and V = 3873(1) Aa{sup 3} in a novel structure type. Colorless crystals of Cs{sub 5}La{sub 3}Br{sub 3}(P{sub 2}S{sub 6}){sub 2}(PS{sub 4}) and Cs{sub 5}La{sub 3}Cl{sub 3}(P{sub 2}S{sub 6}){sub 2}(PS{sub 4}) are isotypic and were obtained in the monoclinic space group P2{sub 1}/m (no. 11) with a = 9.715(2), b = 14.310(3), c = 13.685(3) Aa, β = 100.16(3) and V = 1873(1) Aa{sup 3} and a = 9.513(2), b = 14.182(3), c = 13.699(3) Aa, β = 99.39(3) and V = 1823(1) Aa{sup 3}, respectively. Both structures contain isolated hexathiohypodiphosphate(IV) [P{sub 2}S{sub 6}]{sup 4-} and thiophosphate [PS{sub 4}]{sup 3-} units that are arranged alternately in layers. Cs{sub 10}Y{sub 4}Cl{sub 10}(P{sub 2}S{sub 6}){sub 3} crystallizes in colorless transparent platelets in the orthorhombic space group Pnnm (no. 58) with a = 13.153(3), b = 28.964(6), c = 7.780(2) Aa, and V = 2964(1) Aa{sup 3}. The structure is composed of isolated [P{sub 4/2}S{sub 6}]{sup 4-} octahedra containing four half occupied P positions surrounded octahedrally by sulfur. We show with Raman scattering that this disordered thiophosphate anion shows a Raman spectrum that is distinct from spectra published for other literature-known thiophosphate anions. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Effects of Atmospheric Pressure Plasmas on Isolated and Cellular DNA—A Review

Directory of Open Access Journals (Sweden)

Krishna Priya Arjunan

2015-01-01

Full Text Available Atmospheric Pressure Plasma (APP is being used widely in a variety of biomedical applications. Extensive research in the field of plasma medicine has shown the induction of DNA damage by APP in a dose-dependent manner in both prokaryotic and eukaryotic systems. Recent evidence suggests that APP-induced DNA damage shows potential benefits in many applications, such as sterilization and cancer therapy. However, in several other applications, such as wound healing and dentistry, DNA damage can be detrimental. This review reports on the extensive investigations devoted to APP interactions with DNA, with an emphasis on the critical role of reactive species in plasma-induced damage to DNA. The review consists of three main sections dedicated to fundamental knowledge of the interactions of reactive oxygen species (ROS/reactive nitrogen species (RNS with DNA and its components, as well as the effects of APP on isolated and cellular DNA in prokaryotes and eukaryotes.

Effects of Atmospheric Pressure Plasmas on Isolated and Cellular DNA—A Review

Science.gov (United States)

Arjunan, Krishna Priya; Sharma, Virender K.; Ptasinska, Sylwia

2015-01-01

Atmospheric Pressure Plasma (APP) is being used widely in a variety of biomedical applications. Extensive research in the field of plasma medicine has shown the induction of DNA damage by APP in a dose-dependent manner in both prokaryotic and eukaryotic systems. Recent evidence suggests that APP-induced DNA damage shows potential benefits in many applications, such as sterilization and cancer therapy. However, in several other applications, such as wound healing and dentistry, DNA damage can be detrimental. This review reports on the extensive investigations devoted to APP interactions with DNA, with an emphasis on the critical role of reactive species in plasma-induced damage to DNA. The review consists of three main sections dedicated to fundamental knowledge of the interactions of reactive oxygen species (ROS)/reactive nitrogen species (RNS) with DNA and its components, as well as the effects of APP on isolated and cellular DNA in prokaryotes and eukaryotes. PMID:25642755

Skew scattering dominated anomalous Hall effect in Co<sub>x(MgO)>100-xsub> granular thin films

KAUST Repository

Zhang, Qiang; Wen, Yan; Zhao, Yuelei; Li, Peng; He, Xin; Zhang, Junli; He, Yao; Peng, Yong; Yu, Ronghai; Zhang, Xixiang

2017-01-01

We investigated the mechanism(s) of the anomalous Hall effect (AHE) in magnetic granular materials by fabricating 100-nm-thick thin films of Co<sub>x(MgO)>100-xsub> with a Co volume fraction of 34≤x≤100 using co

Magnetostriction of the polycrystalline Fe{sub 80}Al{sub 20} alloy doped with boron

Energy Technology Data Exchange (ETDEWEB)

Bormio-Nunes, Cristina, E-mail: cristina@demar.eel.usp.br [Escola de Engenharia de Lorena, Dep. de Eng. de Materiais, Universidade de S.Paulo, Lorena, SP (Brazil); Teodoro dos Santos, Claudio; Botani de Souza Dias, Mateus [Escola de Engenharia de Lorena, Dep. de Eng. de Materiais, Universidade de S.Paulo, Lorena, SP (Brazil); Doerr, Mathias; Granovsky, Sergey; Loewenhaupt, Michael [Institut fuer Festkoerperphysik, TU Dresden, D-01062 Dresden (Germany)

2012-10-25

Highlights: Black-Right-Pointing-Pointer Fe{sub 80}Al{sub 20} polycrystalline alloy magnetostriction 40 ppm increased to 80 ppm due to 2% of B doping. Black-Right-Pointing-Pointer B stabilizes {alpha}-FeAl phase and a coexistence of {alpha}-FeAl + Fe{sub 3}Al improves magnetostriction. Black-Right-Pointing-Pointer Presence of Fe{sub 2}B phase causes domain rearrangement revealed by the decrease of the volume magnetostriction. - Abstract: The doping of Fe{sub 80}Al{sub 20} polycrystalline alloy with 2% of boron increased the total magnetostriction twofold compared to a sample without boron. A value close to 80 ppm was achieved at 300 K. The microstructures of the boron-doped alloys show a dendritically solidified matrix with interdendritic {alpha}-FeAl and/or Fe{sub 3}Al and Fe{sub 2}B eutectic between the grains. The XRD analysis reveals an increase in the volume fraction of {alpha}-FeAl and a correspondent decrease of the Fe{sub 3}Al phase volume fraction as the boron content increases. The increase of the volume fraction of this tetragonal Fe{sub 2}B phase in the samples doped with boron causes the decrease of the strong volume magnetostriction that was observed in the alloy without boron. There is some evidence that the improvement of the magnetostriction magnitude due to the addition of boron to the Fe{sub 80}Al{sub 20} alloy could reach the maximal magnetostriction if the 1:1 optimal ratio of the volume fractions of the {alpha}-FeAl and Fe{sub 3}Al phases could be reached.

Antinociceptive effects of an extract, fraction and an isolated compound of the stem bark of Maytenus rigida

Directory of Open Access Journals (Sweden)

Marina V. Martins

2012-01-01

Full Text Available The antinociceptive activity of the Maytenus rigida Mart. (Celastraceae ethanol extract and its ethyl acetate fraction as well as of (--4'-methylepigallocatechin (1, a previously isolated compound, was demonstrated in vivo. ED50 for 1 in the writhing test was 14.14 mg/kg. The acetic acid-induced writhing was inhibited by 98.4, 84.4, and 58.3%, respectively, when mice were treated with the ethanol extract, ethyl acetate fraction, and 1. In the hot plate test, mice pretreated with 1 showed significantly increased reaction times (60-89%. Oral administration of 1 significantly inhibited first and second phases of the formalin-induced pain (50 and 26.5%, respectively, whereas indomethacin inhibited only the second phase of the test (41.2%. Ethanol extract and its fraction showed effects on inflammatory pain, while neurogenic and inflammatory pain suppression by 1 is a strong indication of the presence of both central and peripheral effects and suggests its analgesic and anti-inflammatory potential.

Antinociceptive effects of an extract, fraction and an isolated compound of the stem bark of Maytenus rigida

Directory of Open Access Journals (Sweden)

Marina V. Martins

2012-06-01

Full Text Available The antinociceptive activity of the Maytenus rigida Mart. (Celastraceae ethanol extract and its ethyl acetate fraction as well as of (--4'-methylepigallocatechin (1, a previously isolated compound, was demonstrated in vivo. ED50 for 1 in the writhing test was 14.14 mg/kg. The acetic acid-induced writhing was inhibited by 98.4, 84.4, and 58.3%, respectively, when mice were treated with the ethanol extract, ethyl acetate fraction, and 1. In the hot plate test, mice pretreated with 1 showed significantly increased reaction times (60-89%. Oral administration of 1 significantly inhibited first and second phases of the formalin-induced pain (50 and 26.5%, respectively, whereas indomethacin inhibited only the second phase of the test (41.2%. Ethanol extract and its fraction showed effects on inflammatory pain, while neurogenic and inflammatory pain suppression by 1 is a strong indication of the presence of both central and peripheral effects and suggests its analgesic and anti-inflammatory potential.

Microfluidic flow fractionation device for label-free isolation of circulating tumor cells (CTCs) from breast cancer patients.

Science.gov (United States)

Hyun, Kyung-A; Kwon, Kiho; Han, Hyunju; Kim, Seung-Il; Jung, Hyo-Il

2013-02-15

Circulating tumor cells (CTCs) are dissociated from primary tumor and circulate in peripheral blood. They are regarded as the genesis of metastasis. Isolation and enumeration of CTCs serve as valuable tools for cancer prognosis and diagnosis. However, the rarity and heterogeneity of CTCs in blood makes it difficult to separate intact CTCs without loss. In this paper, we introduce a parallel multi-orifice flow fractionation (p-MOFF) device in which a series of contraction/expansion microchannels are placed parallel on a chip forming four identical channels. CTCs were continuously isolated from the whole blood of breast cancer patients by hydrodynamic forces and cell size differences. Blood samples from 24 breast cancer patients were analyzed (half were from metastatic breast cancer patients and the rest were from adjuvant breast cancer patients). The number of isolated CTCs varied from 0 to 21 in 7.5 ml of blood. Because our devices do not require any labeling processes (e.g., EpCAM antibody), heterogeneous CTCs can be isolated regardless of EpCAM expression. Copyright © 2012 Elsevier B.V. All rights reserved.

Characteristics of Endotoxin-Altering Fractions Derived from Normal Serum III. Isolation and Properties of Horse Serum alpha(2)-Macroglobulin.

Science.gov (United States)

Yoshioka, M; Konno, S

1970-05-01

The endotoxin-altering activity of fractions isolated from normal horse serum was examined by incubation of Salmonella typhosa strain 0-901 endotoxin (Boivin) in a solution of the fraction, and subsequent quantitation of any diminution in the capacity of endotoxin to be precipitated by specific anti-endotoxin antiserum. The horse serum fraction isolated by precipitation with ammonium sulfate at a concentration between 1.6 and 2.7 m was incubated with Pronase PA and then with trypsin. When this partly digested fraction was passed twice through a Sephadex G-200 column and eluted with 0.2 m tris(hydroxymethyl)aminomethane buffer, most of the endotoxinaltering activity was found in the first protein peak designated F-1a. F-1a was found to be homogeneous and corresponded to an alpha(2)-macroglobulin by the techniques of electrophoresis, immunodiffusion, and ultracentrifugation. Approximately 100-fold more F-1a than endotoxin was needed to reduce the antigenicity of the endotoxin by one-half. Alteration was increased when F-1a was incubated with the endotoxin at acid pH or at 45 C rather than at 37 C and was lost after heating F-1a at 56 C for 30 min. N-ethylmaleimide increased the endotoxin-altering activity of horse serum, F-1a, and human plasma fraction III(0), whereas p-chloromercuribenzoate did not. On the other hand, diazonium-1-H-tetrazole, iodoacetic acid, and benzylchloride suppressed the activity of F-1a. When the interaction of endotoxin and F-1a was examined by immunodiffusion techniques, depolymerization of the endotoxin molecule was indicated. The endotoxin-altering factor of horse serum is discussed in relation to the mechanisms of other known reagents, such as deoxycholate and sodium lauryl sulfate.

Characteristics of Endotoxin-Altering Fractions Derived from Normal Serum III. Isolation and Properties of Horse Serum α2-Macroglobulin

Science.gov (United States)

Yoshioka, Morimasa; Konno, Seishi

1970-01-01

The endotoxin-altering activity of fractions isolated from normal horse serum was examined by incubation of Salmonella typhosa strain 0-901 endotoxin (Boivin) in a solution of the fraction, and subsequent quantitation of any diminution in the capacity of endotoxin to be precipitated by specific anti-endotoxin antiserum. The horse serum fraction isolated by precipitation with ammonium sulfate at a concentration between 1.6 and 2.7 m was incubated with Pronase PA and then with trypsin. When this partly digested fraction was passed twice through a Sephadex G-200 column and eluted with 0.2 m tris(hydroxymethyl)aminomethane buffer, most of the endotoxinaltering activity was found in the first protein peak designated F-1a. F-1a was found to be homogeneous and corresponded to an α2-macroglobulin by the techniques of electrophoresis, immunodiffusion, and ultracentrifugation. Approximately 100-fold more F-1a than endotoxin was needed to reduce the antigenicity of the endotoxin by one-half. Alteration was increased when F-1a was incubated with the endotoxin at acid pH or at 45 C rather than at 37 C and was lost after heating F-1a at 56 C for 30 min. N-ethylmaleimide increased the endotoxin-altering activity of horse serum, F-1a, and human plasma fraction III0, whereas p-chloromercuribenzoate did not. On the other hand, diazonium-1-H-tetrazole, iodoacetic acid, and benzylchloride suppressed the activity of F-1a. When the interaction of endotoxin and F-1a was examined by immunodiffusion techniques, depolymerization of the endotoxin molecule was indicated. The endotoxin-altering factor of horse serum is discussed in relation to the mechanisms of other known reagents, such as deoxycholate and sodium lauryl sulfate. Images PMID:16557754

In vitro kinetic studies on the mechanism of oxygen-dependent cellular uptake of copper radiopharmaceuticals

Energy Technology Data Exchange (ETDEWEB)

Holland, Jason P; Bell, Stephen G; Wong, Luet-Lok; Dilworth, Jonathan R [Department of Chemistry, University of Oxford, Chemistry Research Laboratory, 12 Mansfield Road, Oxford, OX1 3TA (United Kingdom); Giansiracusa, Jeffrey H [Department of Mathematics, Mathematical Institute, University of Oxford, 24-29 St Giles' , Oxford, OX1 3LB (United Kingdom)], E-mail: hollanj3@mskcc.org, E-mail: jasonpholland@gmail.com

2009-04-07

The development of hypoxia-selective radiopharmaceuticals for use as therapeutic and/or imaging agents is of vital importance for both early identification and treatment of cancer and in the design of new drugs. Radiotracers based on copper for use in positron emission tomography have received great attention due to the successful application of copper(II) bis(thiosemicarbazonato) complexes, such as [{sup 60/62/64}Cu(II)ATSM] and [{sup 60/62/64}Cu(II)PTSM], as markers for tumour hypoxia and blood perfusion, respectively. Recent work has led to the proposal of a revised mechanism of hypoxia-selective cellular uptake and retention of [Cu(II)ATSM]. The work presented here describes non-steady-state kinetic simulations in which the reported pO{sub 2}-dependent in vitro cellular uptake and retention of [{sup 64}Cu(II)ATSM] in EMT6 murine carcinoma cells has been modelled by using the revised mechanistic scheme. Non-steady-state (NSS) kinetic analysis reveals that the model is in very good agreement with the reported experimental data with a root-mean-squared error of less than 6% between the simulated and experimental cellular uptake profiles. Estimated rate constants are derived for the cellular uptake and washout (k{sub 1} = 9.8 {+-} 0.59 x 10{sup -4} s{sup -1} and k{sub 2} = 2.9 {+-} 0.17 x 10{sup -3} s{sup -1}), intracellular reduction (k{sub 3} = 5.2 {+-} 0.31 x 10{sup -2} s{sup -1}), reoxidation (k{sub 4} = 2.2 {+-} 0.13 mol{sup -1} dm{sup 3} s{sup -1}) and proton-mediated ligand dissociation (k{sub 5} = 9.0 {+-} 0.54 x 10{sup -5} s{sup -1}). Previous mechanisms focused on the reduction and reoxidation steps. However, the data suggest that the origins of hypoxia-selective retention may reside with the stability of the copper(I) anion with respect to protonation and ligand dissociation. In vitro kinetic studies using the nicotimamide adenine dinucleotide (NADH)-dependent ferredoxin reductase enzyme PuR isolated from the bacterium Rhodopseudomonas palustris have

B{sub c} → B{sub sJ} form factors and B{sub c} decays into B{sub sJ} in covariant light-front approach

Energy Technology Data Exchange (ETDEWEB)

Shi, Yu-Ji; Zhao, Zhen-Xing [Shanghai Jiao-Tong University, INPAC, Shanghai Key Laboratory for Particle Physics and Cosmology, Department of Physics and Astronomy, Shanghai (China); Wang, Wei [Shanghai Jiao-Tong University, INPAC, Shanghai Key Laboratory for Particle Physics and Cosmology, Department of Physics and Astronomy, Shanghai (China); Chinese Academy of Sciences, State Key Laboratory of Theoretical Physics, Institute of Theoretical Physics, Beijing (China)

2016-10-15

We suggest to study the B{sub s} and its excitations B{sub sJ} in the B{sub c} decays. We calculate the B{sub c} → B{sub sJ} and B{sub c} → B{sub J} form factors within the covariant light-front quark model, where the B{sub sJ} and B{sub J} denote an s-wave or p-wave anti bs and anti bd meson, respectively. The form factors at q{sup 2} = 0 are directly computed while their q{sup 2}-distributions are obtained by extrapolation. The derived form factors are then used to study semileptonic B{sub c} → (B{sub sJ}, B{sub J}) anti lν decays, and nonleptonic B{sub c} → B{sub sJ}π. Branching fractions and polarizations are predicted in the standard model. We find that the branching fractions are sizable and might be accessible at the LHC experiment and future high-energy e{sup +}e{sup -} colliders with a high luminosity at the Z-pole. The future experimental measurements are helpful to study the nonperturbative QCD dynamics in the presence of a heavy spectator and also of great value for the study of spectroscopy. (orig.)

Measurement of the branching fractions of {Lambda}{sub c}{sup +}{r_arrow}p{bar K}n({pi})

Energy Technology Data Exchange (ETDEWEB)

Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Severini, H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Spencer, M.B.; Sung, M.; Undrus, A.; Wanke, R.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio43210 (United States); Nemati, B.; Richichi, S.J.; Ross, W.R.; Skubic, P. [University of Oklahoma, Norman, Oklahoma73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana47907 (United States); Gibbons, L.; Glenn, S.; Johnson, S.D.; Kwon, Y.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Ugolini, D.; Wang, R.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas75275 (United States); Artuso, M.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; Stone, S.; Viehhauser, G.; Xing, X. [Syracuse University, Syracuse, New York13244 (United States); Bartelt, J.; Csorna, S.E.; Jain, V.; McLean, K.W.; Marka, S. [Vanderbilt University, Nashville, Tennessee37235 (United States); Godang, R.; Kinoshita, K.; Lai, I.C.; Pomianowski, P.; Schrenk, S. [Virginia Polytechnic Institute and State University, Blacksburg, Virginia24061 (United States); Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J. [Wayne State University, Detroit, Michigan48202 (United States); Barish, B.; Chadha, M.; Chan, S.; Eigen, G.; Miller, J.S.; OGrady, C.; Schmidtler, M.; Urheim, J.; Weinstein, A.J.; and others

1998-04-01

Using data recorded by the CLEO-II detector at CESR, we report new measurements of the branching fractions for the decays of the charmed baryon {Lambda}{sub c}{sup +} into pK{sup {minus}}{pi}{sup +}{pi}{sup 0}, p{bar K}{sup 0}, p{bar K}{sup 0}{pi}{sup +}{pi}{sup {minus}}, and p{bar K}{sup 0}{pi}{sup 0}, all measured relative to pK{sup {minus}}{pi}{sup +}. The relative branching fractions are 0.67{plus_minus}0.04{plus_minus}0.11,0.46{plus_minus}0.02{plus_minus}0.04,0.52 {plus_minus}0.04{plus_minus}0.05, and 0.66{plus_minus}0.05{plus_minus}0.07, respectively. {copyright} {ital 1998} {ital The American Physical Society}

Tunable diode laser absorption spectroscopy-based tomography system for on-line monitoring of two-dimensional distributions of temperature and H{sub 2}O mole fraction

Energy Technology Data Exchange (ETDEWEB)

Xu, Lijun, E-mail: lijunxu@buaa.edu.cn; Liu, Chang; Jing, Wenyang; Cao, Zhang [School of Instrument Science and Opto-Electronic Engineering, Beihang University, Beijing 100191 (China); Ministry of Education’s Key Laboratory of Precision Opto-Mechatronics Technology, Beijing 100191 (China); Xue, Xin; Lin, Yuzhen [School of Energy and Power Engineering, Beihang University, Beijing 100191 (China)

2016-01-15

To monitor two-dimensional (2D) distributions of temperature and H{sub 2}O mole fraction, an on-line tomography system based on tunable diode laser absorption spectroscopy (TDLAS) was developed. To the best of the authors’ knowledge, this is the first report on a multi-view TDLAS-based system for simultaneous tomographic visualization of temperature and H{sub 2}O mole fraction in real time. The system consists of two distributed feedback (DFB) laser diodes, a tomographic sensor, electronic circuits, and a computer. The central frequencies of the two DFB laser diodes are at 7444.36 cm{sup −1} (1343.3 nm) and 7185.6 cm{sup −1} (1391.67 nm), respectively. The tomographic sensor is used to generate fan-beam illumination from five views and to produce 60 ray measurements. The electronic circuits not only provide stable temperature and precise current controlling signals for the laser diodes but also can accurately sample the transmitted laser intensities and extract integrated absorbances in real time. Finally, the integrated absorbances are transferred to the computer, in which the 2D distributions of temperature and H{sub 2}O mole fraction are reconstructed by using a modified Landweber algorithm. In the experiments, the TDLAS-based tomography system was validated by using asymmetric premixed flames with fixed and time-varying equivalent ratios, respectively. The results demonstrate that the system is able to reconstruct the profiles of the 2D distributions of temperature and H{sub 2}O mole fraction of the flame and effectively capture the dynamics of the combustion process, which exhibits good potential for flame monitoring and on-line combustion diagnosis.

An experimental study of radioprotective effect of ginseng alkaloid fraction on cellular damage

Energy Technology Data Exchange (ETDEWEB)

Yoo, Seong Yul; Cho, Chul Koo; Kim, Mi Sook; Yoo, Hyung Jun; Kim, Seong Ho; Kim, Tae Hwan [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

1997-09-01

This paper is to assess the effect of Adaptagen as a radioprotector in which main component is alkaloid fraction of ginseng. Evaluation was made in vitro and in vivo study with NIGP(S) mouse by the measurement of regeneration of jejunal crypt cell and micronucleus assay to analyze radioprotective effect of ginseng alkaloid fraction in comparison with that of water fraction after whole body irradiation. The results were as follows, 1. The degree of radiation damage of mouse jejunal crypt cell was diminished in both of alkaloid and water fraction groups compared to control group but more in alkaloid fraction group than water fraction group. 2. Regeneration of mouse jejunal crypt cell was higher both in alkaloid and water fraction groups than control group. 3. In vitro study, frequency of micronucleus was diminished in tendency for the treated groups than control group but statistically insignificant. 4. In vitro study, frequency of micronucleus was diminished in both alkaloid and water fraction groups compared to control group but more in alkaloid fraction group than water fraction group.

Sub-cellular damage by copper in the cnidarian Zoanthus robustus.

Science.gov (United States)

Grant, A; Trompf, K; Seung, D; Nivison-Smith, L; Bowcock, H; Kresse, H; Holmes, S; Radford, J; Morrow, P

2010-09-01

Sessile organisms may experience chronic exposure to copper that is released into the marine environment from antifoulants and stormwater runoff. We have identified the site of damage caused by copper to the symbiotic cnidarian, Zoanthus robustus (Anthozoa, Hexacorallia). External changes to the zoanthids were apparent when compared with controls. The normally flexible bodies contracted and became rigid. Histological examination of the zoanthid tissue revealed that copper had caused sub-cellular changes to proteins within the extracellular matrix (ECM) of the tubular body. Collagen in the ECM and the internal septa increased in thickness to five and seven times that of controls respectively. The epithelium, which stained for elastin, was also twice as thick and tough to cut, but exposure to copper did not change the total amount of desmosine which is found only in elastin. We conclude that copper stimulated collagen synthesis in the ECM and also caused cross-linking of existing proteins. However, there was no expulsion of the symbiotic algae (Symbiodinium sp.) and no effect on algal pigments or respiration (44, 66 and 110 microg Cu L(-1)). A decrease in net photosynthesis was observed only at the highest copper concentration (156 microg Cu L(-1)). These results show that cnidarians may be more susceptible to damage by copper than their symbiotic algae. Copyright (c) 2010 Elsevier Inc. All rights reserved.

Procedure Development to Determine Organic Compounds in the PM{sub 1}-2.5 and PM{sub 2}.5-10 Fractions of Atmospheric Aerosols; Desarrollo de la Metodologia para la Determinacion de los Compuestos Organicos en las Fracciones PM{sub 1}-2.5 y PM{sub 2}.5-10 del Aerosol Atmosferico

Energy Technology Data Exchange (ETDEWEB)

Pindado, O; Perez, R M

2011-07-28

An analytical procedure development to measure organic compounds such as aliphatic hydrocarbons, polycyclic aromatic compounds, n-alcohols and fatty acids in PM{sub 1}-2.5 and PM{sub 2}.5-10 of atmospheric aerosol is accomplished. The development encompasses an optimization of extraction step, derivatization step and chromatographic analysis. The method developed consists in a microwave extraction, followed by a stage of fractionation and analysis by GC/MS. (Author) 20 refs.

Isolation of a significant fraction of non-phototroph diversity from a desert Biological Soil Crust

Directory of Open Access Journals (Sweden)

Ulisses eNunes da Rocha

2015-04-01

Full Text Available Biological Soil Crusts (BSCs are organosedimentary assemblages comprised of microbes and minerals in topsoil of terrestrial environments. BSCs strongly impact soil quality in dryland ecosystems (e.g., soil structure and nutrient yields due to pioneer species such as Microcoleus vaginatus; phototrophs that produce filaments that bind the soil together, and support an array of heterotrophic microorganisms. These microorganisms in turn contribute to soil stability and biogeochemistry of BSCs. Non-cyanobacterial populations of BSCs are less well known than cyanobacterial populations. Therefore, we attempted to isolate a broad range of numerically significant and phylogenetically representative BSC aerobic heterotrophs. Combining simple pre-treatments (hydration of BSCs under dark and light and isolation strategies (media with varying nutrient availability and protection from oxidative stress we recovered 402 bacterial and one fungal isolate in axenic culture, which comprised 116 phylotypes (at 97% 16S rRNA gene sequence homology, 115 bacterial and one fungal. Each medium enriched a mostly distinct subset of phylotypes, and cultivated phylotypes varied due to the BSC pre-treatment. The fraction of the total phylotype diversity isolated, weighted by relative abundance in the community, was determined by the overlap between isolate sequences and OTUs reconstructed from metagenome or metatranscriptome reads. Together, more than 8% of relative abundance of OTUs in the metagenome was represented by our isolates, a cultivation efficiency much larger than typically expected from most soils. We conclude that simple cultivation procedures combined with specific pre-treatment of samples afford a significant reduction in the culturability gap, enabling physiological and metabolic assays that rely on ecologically relevant axenic cultures.

Heterogeneous Nature of Relaxation Dynamics of Room-Temperature Ionic Liquids (EMIm)<sub>2sub>[Co(NCS)>4sub>] and (BMIm)<sub>2sub>[Co(NCS)>4sub>

Energy Technology Data Exchange (ETDEWEB)

Hensel-Bielowka, Stella [Univ. of Silesia, Katowice (Poland). Inst. of Chemistry; Wojnarowska, Zaneta [Univ. of Silesia, Katowice (Poland). Inst. of Physics; Univ. of Silesia, Chorzow (Poland). Silesian Center for Education and Interdisciplinary Research (SMCEBI); Dzida, Marzena [Univ. of Silesia, Katowice (Poland). Inst. of Chemistry; Zorębski, Edward [Univ. of Silesia, Katowice (Poland). Inst. of Chemistry; Zorębski, Michał [Univ. of Silesia, Katowice (Poland). Inst. of Chemistry; Geppert-Rybczyńska, Monika [Univ. of Silesia, Katowice (Poland). Inst. of Chemistry; Peppel, Tim [Leibniz Inst. for Catalysis, Rostock (Germany); Grzybowska, Katarzyna [Univ. of Silesia, Katowice (Poland). Inst. of Physics; Wang, Yangyang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Center for Nanophase Materials Sciences; Sokolov, Alexei P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Chemical Sciences Division; Univ. of Tennessee, Knoxville, TN (United States). Dept. of Chemistry; Paluch, Marian [Univ. of Silesia, Katowice (Poland). Inst. of Physics; Univ. of Silesia, Chorzow (Poland). Silesian Center for Education and Interdisciplinary Research (SMCEBI)

2015-08-11

Dynamic crossover above T<sub>g> has been recognized as a characteristic feature of molecular dynamics of liquids approaching glass transition. Experimentally, it is manifested as a change in Vogel–Fulcher–Tammann dependence or a breakdown of the Stokes–Einstein and related relations. In this study, we report the exception from this rather general pattern of behavior. By means of dielectric, ultrasonic, rheological, and calorimetric methods, dynamics of two good ionic conductors (BMIm)<sub>2sub>[Co(NCS)>4sub>] and (EMIm)<sub>2sub>[Co(NCS)>4sub>] of less common stoichiometry (2:1) was studied in a very broad temperature range. However, none of the mentioned dynamic changes was observed in the entire studied temperature range. On the contrary, the single VFT and the same fractional Walden coefficient were found for conductivity and viscosity changes over 12 decades. Finally and moreover, ultrasonic studies revealed that the data at temperatures which cover the normal liquid region cannot be fitted by a single exponential decay, and the Cole–Cole function should be used instead.

Imaging of Caenorhabditis elegans samples and sub-cellular localization of new generation photosensitizers for photodynamic therapy, using non-linear microscopy

Energy Technology Data Exchange (ETDEWEB)

Filippidis, G [Institute of Electronic Structure and Laser, Foundation of Research and Technology-Hellas, PO Box 1527, 71110 Heraklion (Greece); Kouloumentas, C [Institute of Electronic Structure and Laser, Foundation of Research and Technology-Hellas, PO Box 1527, 71110 Heraklion (Greece); Kapsokalyvas, D [Institute of Electronic Structure and Laser, Foundation of Research and Technology-Hellas, PO Box 1527, 71110 Heraklion (Greece); Voglis, G [Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Heraklion 71110, Crete (Greece); Tavernarakis, N [Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Heraklion 71110, Crete (Greece); Papazoglou, T G [Institute of Electronic Structure and Laser, Foundation of Research and Technology-Hellas, PO Box 1527, 71110 Heraklion (Greece)

2005-08-07

Two-photon excitation fluorescence (TPEF) and second-harmonic generation (SHG) are relatively new promising tools for the imaging and mapping of biological structures and processes at the microscopic level. The combination of the two image-contrast modes in a single instrument can provide unique and complementary information concerning the structure and the function of tissues and individual cells. The extended application of this novel, innovative technique by the biological community is limited due to the high price of commercial multiphoton microscopes. In this study, a compact, inexpensive and reliable setup utilizing femtosecond pulses for excitation was developed for the TPEF and SHG imaging of biological samples. Specific cell types of the nematode Caenorhabditis elegans were imaged. Detection of the endogenous structural proteins of the worm, which are responsible for observation of SHG signals, was achieved. Additionally, the binding of different photosensitizers in the HL-60 cell line was investigated, using non-linear microscopy. The sub-cellular localization of photosensitizers of a new generation, very promising for photodynamic therapy (PDT) (Hypericum perforatum L. extracts) was achieved. The sub-cellular localization of these novel photosensitizers was linked with their photodynamic action during PDT, and the possible mechanisms for cell killing have been elucidated.

Super-resolution imaging and tracking of protein-protein interactions in sub-diffraction cellular space

Science.gov (United States)

Liu, Zhen; Xing, Dong; Su, Qian Peter; Zhu, Yun; Zhang, Jiamei; Kong, Xinyu; Xue, Boxin; Wang, Sheng; Sun, Hao; Tao, Yile; Sun, Yujie

2014-07-01

Imaging the location and dynamics of individual interacting protein pairs is essential but often difficult because of the fluorescent background from other paired and non-paired molecules, particularly in the sub-diffraction cellular space. Here we develop a new method combining bimolecular fluorescence complementation and photoactivated localization microscopy for super-resolution imaging and single-molecule tracking of specific protein-protein interactions. The method is used to study the interaction of two abundant proteins, MreB and EF-Tu, in Escherichia coli cells. The super-resolution imaging shows interesting distribution and domain sizes of interacting MreB-EF-Tu pairs as a subpopulation of total EF-Tu. The single-molecule tracking of MreB, EF-Tu and MreB-EF-Tu pairs reveals intriguing localization-dependent heterogonous dynamics and provides valuable insights to understanding the roles of MreB-EF-Tu interactions.

Super-resolution imaging and tracking of protein–protein interactions in sub-diffraction cellular space

Science.gov (United States)

Liu, Zhen; Xing, Dong; Su, Qian Peter; Zhu, Yun; Zhang, Jiamei; Kong, Xinyu; Xue, Boxin; Wang, Sheng; Sun, Hao; Tao, Yile; Sun, Yujie

2014-01-01

Imaging the location and dynamics of individual interacting protein pairs is essential but often difficult because of the fluorescent background from other paired and non-paired molecules, particularly in the sub-diffraction cellular space. Here we develop a new method combining bimolecular fluorescence complementation and photoactivated localization microscopy for super-resolution imaging and single-molecule tracking of specific protein–protein interactions. The method is used to study the interaction of two abundant proteins, MreB and EF-Tu, in Escherichia coli cells. The super-resolution imaging shows interesting distribution and domain sizes of interacting MreB–EF-Tu pairs as a subpopulation of total EF-Tu. The single-molecule tracking of MreB, EF-Tu and MreB–EF-Tu pairs reveals intriguing localization-dependent heterogonous dynamics and provides valuable insights to understanding the roles of MreB–EF-Tu interactions. PMID:25030837

Dependence of mitochondrial and cytosolic adenine nucleotides on oxygen partial pressure in isolated hepatocytes. Application of a new rapid high pressure filtration technique for fractionation.

OpenAIRE

Hummerich, H; de Groot, H; Noll, T; Soboll, S

1988-01-01

By using a new rapid high pressure filtration technique, mitochondrial and cytosolic ATP and ADP contents were determined in isolated hepatocytes at different oxygen partial pressures. At 670 mmHg, subcellular adenine nucleotide contents and ATP/ADP ratios were comparable with values obtained with the digitonin fractionation technique. However at lower oxygen partial pressure ADP appears to be rephosphorylated during digitonin fractionation whereas with high pressure filtration fractionation ...

Immunomodulatory effect of an isolated fraction from Tinospora crispa on intracellular expression of INF-γ, IL-6 and IL-8

Science.gov (United States)

2014-01-01

Background Immunomodulators are substances that modify immune system response to a threat. Immunomodulators modulate and potentiate the immune system, keeping it highly prepared for any threat. The immunomodulatory effect of the traditional medicine Tinospora crispa is investigated in this work. Methods T. crispa ethanol extract was fractionated by using different solvents. The ethanol extract and effective isolated fraction were used to investigate the potential immunomodulatory effect of different T. crispa doses ranging from 25 μg/mL to 1000 μg/mL on RAW 246.7 cells by detecting intracellular INF-γ, IL-6, and IL-8 expressions. The antioxidant activity of T. crispa was evaluated through FRAP and DPPH. The total phenolic and total flavonoid contents were also quantified. Results Results show that T. crispa extract has higher antioxidant potential than ascorbic acid. The FRAP value of T. crispa extract is 11011.11 ± 1145.42 μmol Fe+2/g, and its DPPH inhibition percentage is 55.79 ± 7.9, with 22 μg/mL IC50. The results also reveal that the total phenolic content of T. crispa extract is 213.16- ± 1.31 mg GAE/g dry stem weight, and the total flavonoid content is 62.07- ± 39.76 mg QE/g dry stem weight. T. crispa crude extract and its isolated fraction significantly stimulate RAW264.7 cell viability (P ≤ 0.05) and intracellular INF-γ, IL-6, and IL-8 expressions. The results of LC-MS show that four of the active compounds detected in the T. crispa isolated fraction are cordioside, quercetin, eicosenoic acid (paullinic acid), and boldine. Conclusions The results of this study obviously indicate that T. crispa has immunomodulatory effects through the stimulation of INF-γ, IL-6, and IL-8 expressions. LC-MS phytochemical analysis showed that the T. crispa fraction has cordioside, quercetin, eicosenoic acid (paullinic acid), and boldine, which may be responsible for the immunostimulator effect of T. crispa. PMID:24969238

Branching fractions of semileptonic D and D{sub s} decays from the covariant light-front quark model

Energy Technology Data Exchange (ETDEWEB)

Cheng, Hai-Yang; Kang, Xian-Wei [Academia Sinica, Institute of Physics, Taipei (China)

2017-09-15

Based on the predictions of the relevant form factors from the covariant light-front quark model, we show the branching fractions for the D(D{sub s}) → (P, S, V, A) lν{sub l} (l = e or μ) decays, where P denotes the pseudoscalar meson, S the scalar meson with a mass above 1 GeV, V the vector meson and A the axial-vector one. Comparison with the available experimental results are made, and we find an excellent agreement. The predictions for other decay modes can be tested in a charm factory, e.g., the BESIII detector. The future measurements will definitely further enrich our knowledge of the hadronic transition form factors as well as the inner structure of the even-parity mesons (S and A). (orig.)

Magic Doping Fractions in High-Temperature Superconductors

Energy Technology Data Exchange (ETDEWEB)

Komiya, Seiki; /CRIEPI, Tokyo; Chen, Han-Dong; Zhang, Shou-Cheng; /Stanford U., Phys. Dept.; Ando, Yoichi; /CRIEPI, Tokyo

2010-01-15

We report hole-doping dependence of the in-plane resistivity {rho}{sub ab} in a cuprate superconductor La{sub 2-x}Sr{sub x}CuO{sub 4}, carefully examined using a series of high-quality single crystals. Our detailed measurements find a tendency towards charge ordering at particular rational hole doping fractions of 1/16, 3/32, 1/8, and 3/16. This observation appears to suggest a specific form of charge order and is most consistent with the recent theoretical prediction of the checkerboard-type ordering of the Cooper pairs at rational doping fractions x = (2m + 1)/2{sup n}, with integers m and n.

Contribution of effluent organic matter (EfOM) to ultrafiltration (UF) membrane fouling: Isolation, characterization, and fouling effect of EfOM fractions

KAUST Repository

Zheng, Xing; Khan, Muhammad; Croue, Jean-Philippe

2014-01-01

EfOM has been regarded as a major organic foulant resulting in UF membrane fouling in wastewater reclamation. To investigate fouling potential of different EfOM fractions, the present study isolated EfOM into hydrophobic neutrals (HPO-N), colloids

Probiotic Properties and Cellular Antioxidant Activity of Lactobacillus plantarum MA2 Isolated from Tibetan Kefir Grains.

Science.gov (United States)

Tang, Wei; Li, Chao; He, Zengguo; Pan, Fen; Pan, Shuo; Wang, Yanping

2017-11-20

Lactobacillus plantarum MA2 was isolated from traditional Chinese Tibetan kefir grains. Its antioxidant properties had been demonstrated in vitro and in vivo previously. In the present study, the probiotic characteristics of this strain were further evaluated by investigating its acid and bile salt tolerances, cell surface hydrophobicity, and autoaggregation, respectively. In addition, the cellular antioxidant activity (CAA) assay was applied to test the antioxidant capacity of the isolate in different growth phases. Same method was also used to evaluate the antioxidant capacity of its fermentation supernatant, cell-free extract, and intact cell quantitatively. The results of probiotic characteristic tests showed that MA2 could survive at pH 2.5 and 0.3% bile salt. Meanwhile, the measurements of cell surface hydrophobicity and autoaggregation were 45.29 ± 2.15 and 6.30 ± 0.34%, respectively. The results of cellular antioxidant activity tests indicated that MA2 had high antioxidant potential. The CAA value of logarithmic phase cell-free extract of MA2 (39,450.00 ± 424.05 μmol quercetin equivalents/100 g sample) was significantly higher than that in stationary phase cell-free extract (3395.98 ± 126.06 μmol quercetin equivalents/100 g sample) and that of fermentation supernatant in logarithmic phase (2174.41 ± 224.47 μmol quercetin equivalents/100 g sample) (p < 0.05). The CAA method was successively applied to evaluate the antioxidant capacity of MA2 in this study, which suggests that it could be used as a useful method for lactic acid bacteria antioxidant potential evaluation.

In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi.

Science.gov (United States)

Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

2016-01-01

Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus-host interaction was conducted by the same assay. CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes with viral entry process in the host cell and acts directly on the viral

In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi

Science.gov (United States)

Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

2016-01-01

Background: Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. Objective: To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. Materials and Methods: The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus–host interaction was conducted by the same assay. Results: CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. Conclusion: The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. SUMMARY Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes

Comparison of Different Fractionation Schedules Toward a Single Fraction in High-Dose-Rate Brachytherapy as Monotherapy for Low-Risk Prostate Cancer Using 3-Dimensional Radiobiological Models

Energy Technology Data Exchange (ETDEWEB)

Mavroidis, Panayiotis, E-mail: mavroidis@uthscsa.edu [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Department of Medical Radiation Physics, Karolinska Institutet and Stockholm University, Stockholm (Sweden); Milickovic, Natasa [Department of Medical Physics and Engineering, Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Cruz, Wilbert F. [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Tselis, Nikolaos [Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Karabis, Andreas [Pi-Medical Ltd., Athens (Greece); Stathakis, Sotirios; Papanikolaou, Nikos [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Zamboglou, Nikolaos [Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Baltas, Dimos [Department of Medical Physics and Engineering, Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Nuclear and Particle Physics Section, Physics Department, University of Athens, Athens (Greece)

2014-01-01

Purpose: The aim of the present study was the investigation of different fractionation schemes to estimate their clinical impact. For this purpose, widely applied radiobiological models and dosimetric measures were used to associate their results with clinical findings. Methods and Materials: The dose distributions of 12 clinical high-dose-rate brachytherapy implants for prostate were evaluated in relation to different fractionation schemes. The fractionation schemes compared were: (1) 1 fraction of 20 Gy; (2) 2 fractions of 14 Gy; (3) 3 fractions of 11 Gy; and (4) 4 fractions of 9.5 Gy. The clinical effectiveness of the different fractionation schemes was estimated through the complication-free tumor control probability (P{sub +}), the biologically effective uniform dose, and the generalized equivalent uniform dose index. Results: For the different fractionation schemes, the tumor control probabilities were 98.5% in 1 × 20 Gy, 98.6% in 2 × 14 Gy, 97.5% in 3 × 11 Gy, and 97.8% in 4 × 9.5 Gy. The corresponding P{sub +} values were 88.8% in 1 × 20 Gy, 83.9% in 2 × 14 Gy, 86.0% in 3 × 11 Gy, and 82.3% in 4 × 9.5 Gy. With use of the fractionation scheme 4 × 9.5 Gy as reference, the isoeffective schemes regarding tumor control for 1, 2, and 3 fractions were 1 × 19.68 Gy, 2 × 13.75 Gy, and 3 × 11.05 Gy. The optimum fractionation schemes for 1, 2, 3, and 4 fractions were 1 × 19.16 Gy with a P{sub +} of 91.8%, 2 × 13.2 Gy with a P{sub +} of 89.6%, 3 × 10.6 Gy with a P{sub +} of 88.4%, and 4 × 9.02 Gy with a P{sub +} of 86.9%. Conclusions: Among the fractionation schemes 1 × 20 Gy, 2 × 14 Gy, 3 × 11 Gy, and 4 × 9.5 Gy, the first scheme was more effective in terms of P{sub +}. After performance of a radiobiological optimization, it was shown that a single fraction of 19.2 to 19.7 Gy (average 19.5 Gy) should produce at least the same benefit as that given by the 4 × 9.5 Gy scheme, and it should reduce the expected total complication probability by

Antioxidant-Rich Fraction of Urtica dioica Mediated Rescue of Striatal Mito-Oxidative Damage in MPTP-Induced Behavioral, Cellular, and Neurochemical Alterations in Rats.

Science.gov (United States)

Bisht, Rohit; Joshi, Bhuwan Chandra; Kalia, Ajudhiya Nath; Prakash, Atish

2017-09-01

Parkinson's disease (PD) having a complex and multi-factorial neuropathology includes mainly the degeneration of the dopaminergic nigrostriatal pathway, which is a cumulative effect of depleted endogenous antioxidant enzymes, increased oxidative DNA damage, mitochondrial dysfunction, excitotoxicity, and neuroinflammation. The present study was designed to investigate the neuroprotective effect of a potent antioxidant from Urtica dioica in a 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) model of parkinsonism. MPTP was administered intranigrally for the induction of PD in male Wistar rats. Behavioral alterations were assessed in between the study period. Animals were sacrificed immediately after behavioral session, and different biochemical, cellular, and neurochemical parameters were measured. Intranigrally repeated administration of MPTP showed significant impairment of motor co-ordination and marked increase of mito-oxidative damage and neuroinflammation in rats. Intranigral MPTP significantly decreases the dopamine and its metabolites with impairment of dopaminergic cell density in rat brain. However, post-treatment with the potent antioxidant fraction of Urtica dioica Linn. (UD) (20, 40, 80 mg/kg) improved the motor function, mito-oxidative defense alteration significantly and dose dependently in MPTP-treated rats. In addition, the potent antioxidant fraction of UD attenuated the pro-inflammatory cytokines (TNF-α and IL-β) and restored the level of dopamine and its metabolites in MPTP-induced PD in rats. Moreover, minocycline (30 mg/kg) with lower dose of UD (20 mg/kg) had significantly potentiated the protective effect of minocycline as compared to its effect with other individual drug-treated groups. In conclusion, Urtica dioica protected the dopaminergic neurons probably by reducing mito-oxidative damage, neuroinflammation, and cellular alteration along with enhanced neurotrophic potential. The above results revealed that the antioxidant rich

Exosomal and Non-Exosomal Transport of Extra-Cellular microRNAs in Follicular Fluid: Implications for Bovine Oocyte Developmental Competence.

Directory of Open Access Journals (Sweden)

Md Mahmodul Hasan Sohel

Full Text Available Cell-cell communication within the follicle involves many signaling molecules, and this process may be mediated by secretion and uptake of exosomes that contain several bioactive molecules including extra-cellular miRNAs. Follicular fluid and cells from individual follicles of cattle were grouped based on Brilliant Cresyl Blue (BCB staining of the corresponding oocytes. Both Exoquick precipitation and differential ultracentrifugation were used to separate the exosome and non-exosomal fraction of follicular fluid. Following miRNA isolation from both fractions, the human miRCURY LNA™ Universal RT miRNA PCR array system was used to profile miRNA expression. This analysis found that miRNAs were present in both exosomal and non-exosomal fraction of bovine follicular fluid. We found 25 miRNAs differentially expressed (16 up and 9 down in exosomes and 30 miRNAs differentially expressed (21 up and 9 down in non-exosomal fraction of follicular fluid in comparison of BCB- versus BCB+ oocyte groups. Expression of selected miRNAs was detected in theca, granulosa and cumulus oocyte complex. To further explore the potential roles of these follicular fluid derived extra-cellular miRNAs, the potential target genes were predicted, and functional annotation and pathway analysis revealed most of these pathways are known regulators of follicular development and oocyte growth. In order to validate exosome mediated cell-cell communication within follicular microenvironment, we demonstrated uptake of exosomes and resulting increase of endogenous miRNA level and subsequent alteration of mRNA levels in follicular cells in vitro. This study demonstrates for the first time, the presence of exosome or non-exosome mediated transfer of miRNA in the bovine follicular fluid, and oocyte growth dependent variation in extra-cellular miRNA signatures in the follicular environment.

FIRST MEASUREMENTS OF {sup 15}N FRACTIONATION IN N{sub 2}H{sup +} TOWARD HIGH-MASS STAR-FORMING CORES

Energy Technology Data Exchange (ETDEWEB)

Fontani, F. [INAF-Osservatorio Astrofisico di Arcetri, L.go E. Fermi 5, I-50125 Firenze (Italy); Caselli, P.; Bizzocchi, L. [Max Planck Institute for Extraterrestrial Physics, Giessenbachstrasse 1, D-85748 Garching (Germany); Palau, A. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, P.O. Box 3-72, 58090 Morelia, Michoacán, México (Mexico); Ceccarelli, C. [Univ. Grenoble Alpes, IPAG, F-38000 Grenoble (France)

2015-08-01

We report on the first measurements of the isotopic ratio {sup 14}N/{sup 15}N in N{sub 2}H{sup +} toward a statistically significant sample of high-mass star-forming cores. The sources belong to the three main evolutionary categories of the high-mass star formation process: high-mass starless cores, high-mass protostellar objects, and ultracompact H ii regions. Simultaneous measurements of the {sup 14}N/{sup 15}N ratio in CN have been made. The {sup 14}N/{sup 15}N ratios derived from N{sub 2}H{sup +} show a large spread (from ∼180 up to ∼1300), while those derived from CN are in between the value measured in the terrestrial atmosphere (∼270) and that of the proto-solar nebula (∼440) for the large majority of the sources within the errors. However, this different spread might be due to the fact that the sources detected in the N{sub 2}H{sup +} isotopologues are more than those detected in the CN ones. The {sup 14}N/{sup 15}N ratio does not change significantly with the source evolutionary stage, which indicates that time seems to be irrelevant for the fractionation of nitrogen. We also find a possible anticorrelation between the {sup 14}N/{sup 15}N (as derived from N{sub 2}H{sup +}) and the H/D isotopic ratios. This suggests that {sup 15}N enrichment could not be linked to the parameters that cause D enrichment, in agreement with the prediction by recent chemical models. These models, however, are not able to reproduce the observed large spread in {sup 14}N/{sup 15}N, pointing out that some important routes of nitrogen fractionation could be still missing in the models.

In vitro schistosomicidal effects of aqueous and dichloromethane fractions from leaves and stems of Piper species and the isolation of an active amide from P. amalago L. (Piperaceae).

Science.gov (United States)

Carrara, V S; Vieira, S C H; de Paula, R G; Rodrigues, V; Magalhães, L G; Cortez, D A G; Da Silva Filho, A A

2014-09-01

Dichloromethane and aqueous fractions from leaves and stems of Piper arboreum Aubl., P. aduncum L., P. amalago L., P. crassinervium H.B. & K., P. diospyrifolium Kunth, P. hispidum Sw. and P. xylosteoides (Kunth) Steud. were tested against adult worms of Schistosoma mansoni. The in vitro activity was evaluated in terms of mortality, number of separated worms and number of worms with reduced motor activity. Most dichloromethane fractions from all Piper species showed moderate schistosomicidal activity, but aqueous fractions were not active. The dichloromethane fraction of P. amalago leaves (at 100 μg/ml) showed the highest activity, resulting in worm mortality, the separation of worm pairs and reduced motor activity. Chromatographic fractionation of the dichloromethane fraction of P. amalago leaves led to the isolation of its major compound, which was also tested against adults of S. mansoni. The isolated piperamide N-[7-(3',4'-methylenedioxyphenyl)-2(Z),4(Z)-heptadienoyl] pyrrolidine, at 100 μ m, resulted in the mortality of all adult worms after 24 h of incubation. The findings suggest that species of Piper are potential sources of schistosomicidal compounds.

Studies of the diffractive photoproduction of isolated photons at HERA

Energy Technology Data Exchange (ETDEWEB)

Abramowicz, H. [Tel Aviv Univ. (Israel). School of Physics; Max Planck Institute for Physics, Munich (Germany); Abt, I. [Max Planck Institut fuer Physik, Muenchen (Germany); Adamczyk, L. [AGH Univ. of Science and Technology, Krakow (Poland). Faculty of Physics and Applied Computer Science; Collaboration: ZEUS Collaboration; and others

2017-07-20

The photoproduction of isolated photons has been measured in diffractive events recorded by the ZEUS detector at HERA. Cross sections are evaluated in the photon transverse-energy and pseudorapidity ranges 5sub T}<15 GeV and -0.7<η{sup γ}<0.9, inclusively and also with a jet with transverse energy and pseudorapidity in the ranges 4sub T}<35 GeV and -1.5<η{sup jet}<1.8, using a total integrated electron-proton luminosity of 456 pb{sup -1}. A number of kinematic variables were studied and compared to predictions from the Rapgap Monte Carlo model. An excess of data is observed above the Rapgap predictions for z{sup meas}{sub P}>0.9, where z{sup meas}{sub P} is the fraction of the longitudinal momentum of the colourless ''Pomeron'' exchange that is transferred to the photon-jet final state, giving evidence for direct Pomeron interactions.

Effect-independent measures of tissue response to fractionated radiation

International Nuclear Information System (INIS)

Thames, H.D.

1984-01-01

Tissue repair factors are measures of sparing from dose fractionation, in the absence of proliferation. A desirable feature of any repair factor is that it be independent of the level of injury induced in the tissue, since otherwise the comparison of tissues on the basis of the factor would not be meaningful. The repair factors F/sub R/ and F/sub rec/ are increasing functions of D/sub 1/, and depend on level of skin reaction after fractionated radiation. By contrast, β/α is effect-independent as a measure of repair capacity in skin, gut, and bone marrow. For late fibrotic reactions in the kidney, there was an increase in β/α with increased levels of injury that was statistically insignificant. The halftime, T/sub 1/2/, for intracellular repair processes in tissues is a measure of repair kinetics. Effect-independence is defend for T/sub 1/2/ as independence from size of dose per fraction. T/sub 1/2/ is independent of fraction size in skin, gut, and spinal cord, and is longer (1.5 hours) in the late-reacting tissues (lung and spinal cord) than in those that react acutely (less than 1 hour), with skin as the exception (1.3 hours). Therefore, early and late-responding normal tissues may be distinguished in terms of both repair capacity and repair kinetics: repair is slower in late-responding tissues, which are also more sensitive to changes in dose fractionation

Isolation of plasma membrane-associated membranes from rat liver.

Science.gov (United States)

Suski, Jan M; Lebiedzinska, Magdalena; Wojtala, Aleksandra; Duszynski, Jerzy; Giorgi, Carlotta; Pinton, Paolo; Wieckowski, Mariusz R

2014-02-01

Dynamic interplay between intracellular organelles requires a particular functional apposition of membrane structures. The organelles involved come into close contact, but do not fuse, thereby giving rise to notable microdomains; these microdomains allow rapid communication between the organelles. Plasma membrane-associated membranes (PAMs), which are microdomains of the plasma membrane (PM) interacting with the endoplasmic reticulum (ER) and mitochondria, are dynamic structures that mediate transport of proteins, lipids, ions and metabolites. These structures have gained much interest lately owing to their roles in many crucial cellular processes. Here we provide an optimized protocol for the isolation of PAM, PM and ER fractions from rat liver that is based on a series of differential centrifugations, followed by the fractionation of crude PM on a discontinuous sucrose gradient. The procedure requires ∼8-10 h, and it can be easily modified and adapted to other tissues and cell types.

The uranium(VI) oxoazides [UO{sub 2}(N{sub 3}){sub 2}.CH{sub 3}CN], [(bipy){sub 2}(UO{sub 2}){sub 2}(N{sub 3}){sub 4}], [(bipy)UO{sub 2}(N{sub 3}){sub 3}]{sup -}, [UO{sub 2}(N{sub 3}){sub 4}]{sup 2-}, and [(UO{sub 2}){sub 2}(N{sub 3}){sub 8}]{sup 4-}

Energy Technology Data Exchange (ETDEWEB)

Haiges, Ralf; Christe, Karl O. [Loker Hydrocarbon Research Institute and Department of Chemistry, University of Southern California, Los Angeles, CA (United States); Vasiliu, Monica; Dixon, David A. [Department of Chemistry, The University of Alabama, Tuscaloosa, AL (United States)

2017-01-12

The reaction between [UO{sub 2}F{sub 2}] and an excess of Me{sub 3}SiN{sub 3} in acetonitrile solution results in fluoride-azide exchange and the uranium(VI) dioxodiazide adduct [UO{sub 2}(N{sub 3}){sub 2}.CH{sub 3}CN] was isolated in quantitative yield. The subsequent reaction of [UO{sub 2}(N{sub 3}){sub 2}.CH{sub 3}CN] with 2,2{sup '}-bipyridine (bipy) resulted in the formation of the azido-bridged binuclear complex [(bipy){sub 2}(UO{sub 2}){sub 2}(N{sub 3}){sub 4}]. The triazido anion [(bipy)UO{sub 2}(N{sub 3}){sub 3}]{sup -} was obtained by the reaction of [UO{sub 2}(N{sub 3}){sub 2}.CH{sub 3}CN] with stoichiometric amounts of bipy and the ionic azide [PPh{sub 4}][N{sub 3}]. The reaction of [UO{sub 2}(N{sub 3}){sub 2}] with two equivalents of the [PPh{sub 4}][N{sub 3}] resulted in the formation of the mononuclear tetraazido anion [UO{sub 2}(N{sub 3}){sub 4}]{sup 2-} as well as the azido-bridged binuclear anion [(UO{sub 2}){sub 2}(N{sub 3}){sub 8}]{sup 4-}. The novel uranium oxoazides were characterized by their vibrational spectra and in the case of [(bipy){sub 2}(UO{sub 2}){sub 2}(N{sub 3}){sub 4}].CH{sub 3}CN, [PPh{sub 4}][(bipy)UO{sub 2}(N{sub 3}){sub 3}], [PPh{sub 4}]{sub 2}[UO{sub 2}(N{sub 3}){sub 4}], [PPh{sub 4}]{sub 2}[UO{sub 2}(N{sub 3}){sub 4}].2CH{sub 3}CN, and [PPh{sub 4}]{sub 4}[(UO{sub 2}){sub 2}(N{sub 3}){sub 8}].4CH{sub 3}CN by their X-ray crystal structures. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Wound healing effect of flavonoid rich fraction and luteolin isolated from Martynia annua Linn. on streptozotocin induced diabetic rats

Institute of Scientific and Technical Information of China (English)

Santram Lodhi; Abhay K Singhai

2013-01-01

Objective: To evaluate wound healing potential of flavonoid fractions of Martynia annua (M. annua) Linn. leaves in diabetic rats on the basis of folkloric information and preliminary study. Methods: The flavonoid compound luteolin and apigenin were isolated from dried leaves of plant by column chromatography. The two concentrations (0.2% and 0.5% w/w) of luteolin and flavonoid fraction were selected for topically applied as ointment on diabetic wound. The Povidone Iodine Ointment USP was used as a reference. On 18th days, protein content, hydroxyproline and antioxidants (SOD, CAT and GSH) level in granuloma tissues were determined.Results:The results showed that, percent wound contraction were observed significantly (P<0.01) greater in MAF fraction and 0.5% w/w of luteolin treatment groups. Presence of matured collagen fibres and fibroblasts with better angiogenesis were observed in histopathological studies.Conclusions:In conclusion, our findings suggest that flavonoid fraction (MAF) and luteolin (0.5%w/w) may have potential benefit in enhancing wound healing in diabetic condition, possibly due to free-radical scavenging activity of plant.

THE CLUSTER AND FIELD GALAXY ACTIVE GALACTIC NUCLEUS FRACTION AT z = 1-1.5: EVIDENCE FOR A REVERSAL OF THE LOCAL ANTICORRELATION BETWEEN ENVIRONMENT AND AGN FRACTION

Energy Technology Data Exchange (ETDEWEB)

Martini, Paul [Department of Astronomy and Center for Cosmology and Astroparticle Physics, Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Miller, E. D.; Bautz, M. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Brodwin, M. [Department of Physics and Astronomy, University of Missouri, 5110 Rockhill Road, Kansas City, MO 64110 (United States); Stanford, S. A. [Department of Physics, University of California, One Shields Avenue, Davis, CA 95616 (United States); Gonzalez, Anthony H. [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Hickox, R. C. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Laboratory, Hanover, NH 03755 (United States); Stern, D.; Eisenhardt, P. R. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Galametz, A. [INAF-Osservatorio di Roma, Via Frascati 33, I-00040 Monteporzio (Italy); Norman, D.; Dey, A. [NOAO, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Jannuzi, B. T. [Department of Astronomy and Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Murray, S.; Jones, C. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Brown, M. J. I., E-mail: martini@astronomy.ohio-state.edu [School of Physics, Monash University, Clayton, Victoria 3800 (Australia)

2013-05-01

The fraction of cluster galaxies that host luminous active galactic nuclei (AGNs) is an important probe of AGN fueling processes, the cold interstellar medium at the centers of galaxies, and how tightly black holes and galaxies co-evolve. We present a new measurement of the AGN fraction in a sample of 13 clusters of galaxies (M {>=} 10{sup 14} M{sub Sun }) at 1 < z < 1.5 selected from the Spitzer/IRAC Shallow Cluster Survey, as well as the field fraction in the immediate vicinity of these clusters, and combine these data with measurements from the literature to quantify the relative evolution of cluster and field AGN from the present to z {approx} 3. We estimate that the cluster AGN fraction at 1 < z < 1.5 is f{sub A} = 3.0{sup +2.4}{sub -1.4}% for AGNs with a rest-frame, hard X-ray luminosity greater than L{sub X,{sub H}} {>=} 10{sup 44} erg s{sup -1}. This fraction is measured relative to all cluster galaxies more luminous than M{sup *}{sub 3.6}(z) + 1, where M{sup *}{sub 3.6}(z) is the absolute magnitude of the break in the galaxy luminosity function at the cluster redshift in the IRAC 3.6 {mu}m bandpass. The cluster AGN fraction is 30 times greater than the 3{sigma} upper limit on the value for AGNs of similar luminosity at z {approx} 0.25, as well as more than an order of magnitude greater than the AGN fraction at z {approx} 0.75. AGNs with L{sub X,{sub H}} {>=} 10{sup 43} erg s{sup -1} exhibit similarly pronounced evolution with redshift. In contrast to the local universe, where the luminous AGN fraction is higher in the field than in clusters, the X-ray and MIR-selected AGN fractions in the field and clusters are consistent at 1 < z < 1.5. This is evidence that the cluster AGN population has evolved more rapidly than the field population from z {approx} 1.5 to the present. This environment-dependent AGN evolution mimics the more rapid evolution of star-forming galaxies in clusters relative to the field.

CH{sub 3} and CD{sub 3} radicals isolated in argon: high resolution ESR spectra and analysis by three-dimensional quantum rotor model. A case study of low temperature quantum effects on radicals

Energy Technology Data Exchange (ETDEWEB)

Shiotani, Masaru; Yamada, Tomoya; Komaguchi, Kenji [Hiroshima Univ., Higashi-Hiroshima (Japan). Faculty of Engineering; Benetis, N.P.; Lund, A.; Soernes, A.R.

1998-10-01

The present study deals with high resolution isotropic ESR spectra of the CH{sub 3} and CD{sub 3} radicals isolated in solid argon matrix at low temperature from 4 K to 40 K. Argon gases mixed with methane (Ar/methane {approx_equal} 500 mole ratio) were condensed at the end of Suprasile ESR tube at 4.2 K. Methyl radicals were generated by X-ray irradiation at 4 K and subjected to an ESR study. The 6.0 K ESR spectrum of the CH{sub 4}/Ar system is shown in Fig. 1. For CH{sub 3} radical the {sup 1}H hyperfine (hf) quartet was observed with an equal intensity (A-lines). The E-lines were absent at 4 K, but became visible at m{sub F} = {+-}1/2 positions above 12 K increased with temperature. The CD{sub 3} gave a peculiar spectrum at 4 K with an abnormally strong central singlet superimposed on a much weaker seven line spectrum of a freely rotating CD{sub 3}. The temperature dependent spectra showed clear quantum effects due to three-dimensional spin-rotation couplings. The spectra were analyzed with the following assumptions: (a) a planar D{sub 3} geometry, (b) a free and three-dimensional quantum rotation and (c) a thermally isolated radical. Application of the Pauli principle in combination to the D{sub 3} point group resulted in interesting selections for ESR-transitions for both the CH{sub 3} and CD{sub 3} spectra. That is, the {sup 1}H hf quartet of CH{sub 3} radical (A-lines) was attributed to the rotational ground state, J=0, with totally symmetric A{sub 1} nuclear states. The central strong singlet of CD{sub 3} was attributed to one spin-rotation state with A{sub 2} antisymmetric nuclear states at the lowest rotational level of J=0. (author)

Synthesis and structural characterization of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9}

Energy Technology Data Exchange (ETDEWEB)

Braeuchle, Sebastian; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie; Seibald, Markus [OSRAM GmbH, Schwabmuenchen (Germany). Corporate Innovation

2017-07-01

Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} was prepared by high-temperature solid state synthesis at 900 C in a platinum crucible from lithium carbonate, potassium carbonate, boric acid, and europium(III) oxide. The title compound crystallizes in the orthorhombic space group Pca2{sub 1} (no. 29) (Z = 4). The structure was refined from single-crystal X-ray diffraction data: a = 21.126(2), b = 6.502(2), c = 17.619(2) Aa, V = 2420.1(2) Aa{sup 3}, R1 = 0.0183 and wR2 = 0.0412 for all data. The crystal structure of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} is isotypic to Li{sub 3}K{sub 3}Y{sub 7}(BO{sub 3}){sub 9} featuring isolated BO{sub 3} units and LiO{sub 6} octahedra forming [Li{sub 3}B{sub 4}O{sub 21}] units in the ac plane, which are linked by additional BO{sub 3} units. The K{sup +} and Eu{sup 3+} cations are arranged in the cavities of the structure.

A catalyst for hydrogenating medium-distilled petroleum fractions

Energy Technology Data Exchange (ETDEWEB)

Mordanov, M A; Gasanova, Zh I; Isaev, A Ia; Khavkin, V A; Kurganov, V M; Musaeva, S K

1982-01-01

The catalyst for hydrogenating medium-distilled petroleum fractions, which contain Cr/sub 2/O/sub 3/ and Ni-concentrate components in the gamma-A1/sub 2/O/sub 3/ transfer agent, also contains, as a Ni-concentrate component, NiO and Re in the following component ratios (by percentage): Cr/sub 2/O/sub 3/ 25-44, NiO 4-25, Re 1-2 and the transfer agent the remainder, in order to improve catalytic resistance to catalyst toxins--nitrous and sulfurous compounds. The resistance of the proposed catalyst to toxins makes it possible to hydrogenate in less stringent conditions (280 degrees, 30 atmospheres) without first hydropurifying the raw material. Here, the catalyst's selectivity reaches 100 percent (aromatic hydrocarbons are absent); the yield of the target fraction is 99 percent.

A Breast Cell Atlas: Organelle analysis of the MDA-MB-231 cell line by density-gradient fractionation using isotopic marking and label-free analysis

Directory of Open Access Journals (Sweden)

Marianne Sandin

2015-09-01

Full Text Available Protein translocation between organelles in the cell is an important process that regulates many cellular functions. However, organelles can rarely be isolated to purity so several methods have been developed to analyse the fractions obtained by density gradient centrifugation. We present an analysis of the distribution of proteins amongst organelles in the human breast cell line, MDA-MB-231 using two approaches: an isotopic labelling and a label-free approach.

Measurement of the Branching Fractions and CP Asymmetries of B{sup -} --> D{sup 0}{sub (CP)}K{sup -} Decays with the BABAR Detector

Energy Technology Data Exchange (ETDEWEB)

Aubert, B

2004-08-17

The authors have reconstructed B{sup -} --> D{sup 0}K{sup -} decays with D{sup 0} mesons decaying to non-CP (K{sup -}{pi}{sup +}), CD-even (K{sup -}K{sup +}, {pi}{sup -}{pi}{sup +}) and CP-odd (K{sup 0}{sub s}{pi}{sup 0}) eigenstates. They have measured the CP asymmetries A{sub CP{sup +}} = 0.40 {+-} 0.15(stat) {+-} 0.08(syst), A{sup CP{sup -}} = 0.21 {+-} 0.17(stat) {+-} 0.07(syst), and the double ratio of branching fractions R{sub +} = 0.87 {+-} 0.14(stat) {+-} 0.06(syst), R{sub -} = 0.80 {+-} 0.14(stat) {+-} 0.08(syst). These results improve the previous existing measurements from BABAR. All results presented in this document are preliminary.

A structural transformation and its effect on the physical properties of the V-substituted Bi sub 2 Sr sub 2 Ca sub 2 Cu sub 3 O sub 1 sub 0 sub + sub y system

CERN Document Server

Yakinci, M E

1997-01-01

Systematic substitution of V in the Bi sub 2 sub - subdelta V subdelta Sr sub 2 Ca sub 2 Cu sub 3 O sub 1 sub 0 sub + sub y system (delta=0, 0.2, 0.4, 0.6, 0.8 and 1) was carried out in order to determine the effect of V ions on the phase formation and on the physical properties of the BSCCO 2223 system. The most interesting observation was structural transformation of the system from tetragonal to orthorhombic after delta=0.6. A solid solubility limit for V was also found to exist. Resistivity and susceptibility studies have shown that high-T sub c superconductivity exists up to delta=0.6 and that the semiconducting-to-metallic transition or fully semiconducting behaviour occurs after this limit. A fractionally small but very-high-T sub c transition at around 210 K was also observed, but it was not reproducible. Among the V-substituted samples the best electrical properties were obtained for delta=0.2; T sub c and T sub o were found to be 112 K and 92 K, respectively, the calculated value of J sub c was foun...

Method for the isolation of biologically active monomeric immunoglobulin A from a plasma fraction.

Science.gov (United States)

Leibl, H; Tomasits, R; Wolf, H M; Eibl, M M; Mannhalter, J W

1996-04-12

A purification method for immunoglobulin A (IgA) yielding monomeric IgA with a purity of over 97% has been developed. This procedure uses ethanol-precipitated plasma (Cohn fraction III precipitate) as the starting material and includes heparin-Sepharose adsorption, dextran sulfate and ammonium sulfate precipitation, hydroxyapatite chromatography, batch adsorption by an anion-exchange matrix and gel permeation. Additional protein G Sepharose treatment leads to an IgA preparation of greater than 99% purity. The isolated IgA presented with an IgA subclass distribution, equivalent to IgA in unfractionated plasma, and was biologically active, as was shown by its ability to down-modulate Haemophilus influenzae-b-induced IL-6 secretion of human monocytes.

Fractionation of distillers dried grains with solubles (DDGS) by sieving and winnowing.

Science.gov (United States)

Liu, KeShun

2009-12-01

Four commercial samples of distillers dried grains with solubles (DDGS) were sieved. All sieved fractions except for the pan fraction, constituting about 90% of original mass, were then winnowed with an air blast seed cleaner. Sieving was effective in producing fractions with varying composition. As the particle size decreased, protein and ash contents increased, and total carbohydrate (CHO) decreased. Winnowing sieved fractions was also effective in shifting composition, particularly for larger particle classes. Heavy sub-fractions were enriched in protein, oil and ash, while light sub-fractions were enriched for CHO. For protein, the combination of the two procedures resulted in a maximum 56.4% reduction in a fraction and maximum 60.2% increase in another fraction. As airflow velocity increased, light sub-fraction mass increased, while the compositional difference between the heavy and light sub-fractions decreased. Winnowing three times at a lower velocity was as effective as winnowing one time at a medium velocity. Winnowing the whole DDGS was much less effective than winnowing sieved fractions in changing composition, but sieving winnowed fractions was more effective than sieving whole DDGS. The two combination sequences gave comparable overall effects but sieving followed by winnowing is recommended because it requires less time. Regardless of combinational sequence, the second procedure was more effective in shifting composition than the first procedure.

Polysaccharide fraction from higher plants which strongly interacts with the cytosolic phosphorylase isozyme. I. Isolation and characterization

International Nuclear Information System (INIS)

Yang, Yi; Steup, M.

1990-01-01

From leaves of Spinacia oleracea L. or from Pisum sativum L. and from cotyledons of germinating pea seeds a high molecular weight polysaccharide fraction was isolated. The apparent size of the fraction, as determined by gel filtration, was similar to that of dextran blue. Following acid hydrolysis the monomer content of the polysaccharide preparation was studied using high pressure liquid and thin layer chromatography. Glucose, galactose, arabinose, and ribose were the main monosaccharide compounds. The native polysaccharide preparation interacted strongly with the cytosolic isozyme of phosphorylase (EC 2.4.1.1). Interaction with the plastidic phosphorylase isozyme(s) was by far weaker. Interaction with the cytosolic isozyme was demonstrated by affinity electrophoresis, kinetic measurements, and by 14 C-labeling experiments in which the glucosyl transfer from [ 14 C]glucose 1-phosphate to the polysaccharide preparation was monitored

The Effects of Cooling Rate on the Microstructure and Mechanical Properties of Ti{sub 4}0Zr{sub 1}0Cu{sub 3}6Pd{sub 1}4 Metallic Glass Matrix Composites

Energy Technology Data Exchange (ETDEWEB)

Park, Seon Yong; Lim, Ka Ram; Na, Young Sang; Kim, Seong Eon [Korea Institute of Materials Science, Changwon (Korea, Republic of); Choi, Youn Suk [Pusan National University, Busan (Korea, Republic of)

2016-11-15

In this paper, we demonstrate that the microstructure and mechanical properties in the Ti{sub 4}0Zr{sub 1}0Cu{sub 3}6Pd{sub 1}4 alloy can be tailored by controlling the cooling rate during solidification. A lower cooling rate increases the volume fraction of crystalline phase such as B2 but decreases the free volume of the glassy matrix. The increase of the B2 volume fraction can dramatically enhance the toughness of the composites, since the B2 phase is relatively ductile compared to the glassy matrix and seems to have good interface stability with the matrix. From the experimental results, it was found that there is a transition point in the plasticity of the composites depending on the cooling rate. Here, we explain how the toughness of the composites varies in accordance with the cooling rate in the Ti{sub 4}0Zr{sub 1}0Cu{sub 3}6Pd{sub 1}4 alloy system.

Imaging of HER3-expressing xenografts in mice using a {sup 99m}Tc(CO){sub 3}-HEHEHE-Z{sub HER3:08699} affibody molecule

Energy Technology Data Exchange (ETDEWEB)

Orlova, Anna; Rosestedt, Maria; Varasteh, Zohreh; Selvaraju, Ram Kumar [Uppsala University, Preclinical PET Platform, Department of Medicinal Chemistry, Uppsala (Sweden); Malm, Magdalena; Andersson, Ken; Staahl, Stefan; Loefblom, John [KTH Royal Institute of Technology, Division of Protein Technology, School of Biotechnology, Stockholm (Sweden); Altai, Mohamed; Honarvar, Hadis; Strand, Joanna; Tolmachev, Vladimir [Uppsala University, Division of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala (Sweden)

2014-07-15

Human epidermal growth factor receptor type 3 (HER3) is a transmembrane receptor tyrosine kinase belonging to the HER (ErbB) receptor family. Membranous expression of HER3 is associated with trastuzumab resistance in breast cancer and the transition to androgen independence in prostate cancer. Imaging of HER3 expression in malignant tumors may provide important diagnostic information that can influence patient management. Affibody molecules with low picomolar affinity to HER3 were recently selected. The aim of this study was to investigate the feasibility of HER3 imaging using radiolabeled Affibody molecules. A HER3-binding Affibody molecule, Z{sub 08699}, with a HEHEHE-tag on N-terminus was labeled with {sup 99m}Tc(CO){sub 3} using an IsoLink kit. In vitro and in vivo binding specificity and the cellular processing of the labeled binder were evaluated. Biodistribution of {sup 99m}Tc(CO){sub 3}-HEHEHE-Z{sub 08699} was studied over time in mice bearing HER3-expressing xenografts. HEHEHE-Z{sub 08699} was labeled with {sup 99m}Tc(CO){sub 3} with an isolated yield of >80 % and a purity of >99 %. Binding of {sup 99m}Tc(CO){sub 3}-HEHEHE-Z{sub 08699} was specific to BT474 and MCF7 (breast cancer), and LS174T (colon cancer) cells. Cellular processing showed rapid binding and relatively quick internalization of the receptor/Affibody molecule complex (70 % of cell-associated radioactivity was internalized after 24 h). The tumor targeting was receptor mediated and the excretion was predominantly renal. Receptor-mediated uptake was also found in the liver, lung, stomach, intestine, and salivary glands. At 4 h pi, tumor-to-blood ratios were 7 ± 3 for BT474, and 6 ± 2 for LS174T xenografts. LS174T tumors were visualized by microSPECT 4 h pi. The results of this study suggest the feasibility of HER3-imaging in malignant tumors using Affibody molecules. (orig.)

Central Antinociceptive and Mechanism of Action of Pereskia bleo Kunth Leaves Crude Extract, Fractions, and Isolated Compounds

Directory of Open Access Journals (Sweden)

Carolina Carvalho Guilhon

2015-01-01

Full Text Available Pereskia bleo (Kunth DC. (Cactaceae is a plant commonly used in popular medicine in Malaysia. In this work, we evaluate the antinociceptive effect of P. bleo leaf extracts and isolated compounds in central antinociceptive model. Ethanol extract (E, hexane (H, ethyl acetate (EA, or butanol (B fractions (30, 50, or 100 mg/kg, p.o., sitosterol (from hexane and vitexin (from ethyl acetate, were administered to mice. Antinociceptive effect was evaluated in the hot plate and capsaicin- or glutamate-induced licking models. Morphine (1 mg/kg, p.o. was used as reference drug. Naloxone (1 mg/kg, i.p., atropine (1 mg/kg, i.p., and L-nitro arginine methyl ester (L-NAME, 3 mg/kg, i.p. were administered 30 min earlier (100 mg/kg, p.o. in order to evaluate the mechanism of the antinociceptive action. Higher dose of B developed an effect significantly superior to morphine-treated group. Naloxone prevented the antinociceptive effect of all fractions. L-NAME demonstrated effect against E, EA, and B. In all fractions, sitosterol and vitexin reduced the licking time after capsaicin injection. Glutamate-induced licking response was blocked by H, EA, and B. Our results indicate that Pereskia bleo fractions, sitosterol and vitexin, possessed a central antinociceptive effect. Part of this effect is mediated by opioid receptors and nitrergic pathway.

Antioxidant Activity of Whey from Milk Fermented with Lactobacillus Species Isolated from Nigerian Fermented Foods

Directory of Open Access Journals (Sweden)

Ifeoma Korie

2010-01-01

Full Text Available Eight Lactobacillus isolates obtained from five indigenous fermented foods (ogi, ogi baba, wara, kunnu and ugba were investigated. Wara is a dairy-based food while the others are not dairy-based. The bacteria were isolated on MRS agar and purified by successive streaking on the same medium. The whey fraction of skimmed milk fermented with each isolate was assayed for radical scavenging effects using 2,2-diphenyl-1-picrylhydrazyl (DPPH radical. All the whey fractions showed radical scavenging activities. The five isolates with the highest activities were selected. On the basis of Gram stain reaction, cellular morphology, biochemical tests and carbohydrate utilization profiles they were identified as strains of Lactobacillus brevis, L. fermentum, L. plantarum, L. casei and L. delbrueckii. The antioxidant activities of whey fractions from 24-hour fermentations with the selected organisms were investigated using both radical scavenging effects and lipid peroxidation inhibitory activity. The radical scavenging activity was generally higher than the lipid peroxidation inhibition, except in the L. plantarum strain, which did not show any significant difference in both activities. The probiotic potential of the isolates was evaluated by pH and bile tolerance. None of the selected isolates showed any growth at pH=2.0 but L. casei and L. delbrueckii survived at this pH. Four of the five selected isolates were able to grow in 0.5 % dehydrated bile, with L. casei strain showing the highest level of growth, followed by L. delbrueckii. L. plantarum strain was not bile tolerant. The ability of L. casei and L. delbrueckii strains to survive at pH=2 and grow in the presence of bile indicates that the isolates may be able to colonize the gastrointestinal tract. The findings of this study indicate that Lactobacillus strains isolated from indigenous Nigerian fermented foods could be useful as starter cultures to provide antioxidants in food and that fermented milk

Characteristics of biohydrogen production by ethanoligenens R{sub 3} isolated from continuous stirred tank reactor

Energy Technology Data Exchange (ETDEWEB)

Jiao, A.Y.; Liu, K. [Northeast Forestry Univ., Harbin (China). School of Forestry; Li, Y.F. [Northeast Forestry Univ., Harbin (China). School of Forestry; Shanghai Univ. of Engineering Science (China). College of Chemistry and Chemical Engineering; Liu, B. [Northeast Forestry Univ., Harbin (China). School of Material Science and Engineering; Xu, J.L. [Shanghai Univ. of Engineering Science (China). College of Chemistry and Chemical Engineering

2010-07-01

This study investigated the fermentative hydrogen production characteristics of ethanoligenens R{sub 3} isolated from anaerobic sludge in a continuous stirred tank reactor. The effects of the initial pH value, the proportion of carbon and nitrogen sources, and the effects of fermentation temperature were investigated in a series of batch experiments. Substrates for the hydrogen production of glucose and peptone were used as carbon and nitrogen sources. Results of the experiments showed that a maximum hydrogen production yield of 834 mlH{sub 2}/L culture was obtained with a fermentation temperature of 35 degrees C and an initial pH value of 5.5. The maximum average hydrogen production rate of 10.87 mmolH{sub 2}/g cell dry weight per hour was obtained at a carbon-nitrogen source ratio of 3.3. The degradation efficiency of the glucose used as a carbon source ranged from 91.5 to 95.43 per cent during the conversion of glucose to hydrogen by the bacteria.

Ubbelohde viscometer measurement of water-based Fe{sub 3}O{sub 4} magnetic fluid prepared by coprecipitation

Energy Technology Data Exchange (ETDEWEB)

Gu, H. [School of Physics and Electronic Engineering, Changshu Institute of Technology, Changshu 215500 (China); Tang, X. [College of Chemistry, Chemical Engineering and Materials Science and Key Laboratory of Organic Synthesis of Jiangsu Province, Soochow University, SIP, Suzhou 215123 (China); Hong, R.Y., E-mail: rhong@suda.edu.cn [College of Chemistry, Chemical Engineering and Materials Science and Key Laboratory of Organic Synthesis of Jiangsu Province, Soochow University, SIP, Suzhou 215123 (China); College of Chemistry and Chemical Engineering, Fuzhou University, Fuzhou 350002 (China); Feng, W.G. [Suzhou Nanocomp Inc., Suzhou New District, Suzhou 215011 (China); Xie, H.D.; Chen, D.X. [Suzhou YouNuo Plastic Industry Co., Ltd., Suzhou 215021 (China); Badami, D. [Department of Chemical Engineering, University of Waterloo, Waterloo, Canada ON N2L 3G1 (Canada)

2013-12-15

Fe{sub 3}O{sub 4} nanoparticles were prepared by co-precipitation and coated by sodium dodecyl benzene sulfonate (SDBS) to obtain water-based magnetic fluid. The viscosity of the magnetic fluid was measured using an Ubbelohde viscometer. The effects of magnetic particles volume fraction, surfactant mass fraction and temperature on the viscosity were studied. Experimental results showed that the magnetic fluid with low magnetic particle volume fraction behaved as a Newtonian fluid and the viscosity of the magnetic fluid increased with an increase of the suspended magnetic particles volume fraction. The experimental data was compared with the results of a theoretically derived equation. The viscosity of the magnetic fluid also increased with an increase in surfactant mass portion, while it decreased with increasing temperature. Moreover, the viscosity increased with increasing the magnetic field intensity. Increasing the temperature and the surfactant mass fraction weakened the influence of the magnetic field on the viscosity of the magnetic fluid. - Highlights: • Fe{sub 3}O{sub 4} nanoparticles were prepared using co-precipitation and coated by sodium dodecyl benzene sulfonate to obtain water-based magnetic fluid. • The viscosity of different magnetic fluids was measured using an Ubbelohde viscometer. • The effects of magnetic particles volume fraction, surfactant mass fraction and temperature on the viscosity of magnetic fluids were studied.

Bioactivity-guided isolation of spasmolytic components of Pycnocycla spinosa Decne ex Boiss.

Science.gov (United States)

Sadraei, H; Asghari, G; Behzad, S

2011-07-01

Hydroalcoholic extract of Pycnocycla spinosa has spasmolytic effect in vitro and antidiarrhoeal action in vivo. The aim of this research was to separate fractions of total hydroalcoholic extract of P. spinosa guided by their spasmolytic activity. Aerial parts of P. spinosa were extracted with ethanol. The concentrated extract was subjected to column chromatography and thin layer chromatography. Initially four fractions were obtained (F1, F2, F3, and F4) and their spasmolytic activities were determined on ileum contraction induced by KCl (80 mM). The more active fraction was subjected to further isolation and tested to find its most active components. The active component was phytochemically characterized using phytochemical methods including ultraviolet and infrared spectroscopy. Hydroalcoholic extract of P. spinosa (10-320 μg/ml) in a concentration dependent manner inhibited ileum contraction with the IC(50) value of 47 ± 8.1 μg/ml (mean ± S.E.M., n=6). Fraction F2 was the most potent inhibitor of ileum contraction (IC(50)= 3.4 ± 0.33 μg/ml). From five sub-fractions separated from fraction F2 (F2a, F2b, F2c, F2d, and F2e, respectively), F2c was a more active component with the IC(50) value of 2.6 ± 0.27 μg/ml. The primary results of target fraction (F2c) showed sugar moiety in its structure or in one of its components. In this research we have isolated pharmacological active fraction which is most likely responsible for antispasmodic action of P. spinosa hydroalcoholic extract.

Parametric study of the fractional-order Chen-Lee system

Energy Technology Data Exchange (ETDEWEB)

Tam, L.M. [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Tomas Pereira S.J., Taipa, Macau (China)], E-mail: fstlmt@umac.mo; Tou, W.M.S. [Department of Electromechanical Engineering, Faculty of Science and Technology, University of Macau, Av. Padre Tomas Pereira S.J., Taipa, Macau (China)

2008-08-15

The dynamics of fractional-order systems have attracted a great deal of attention in recent years. In this paper, the effects of parameter changes on the dynamics of the fractional-order Chen-Lee system were studied numerically. The parameter ranges used were relatively broad. The order used for the system was fixed at 2.7 (q{sub 1} = q{sub 2} = q{sub 3} = 0.9). The system displays rich dynamic behaviors, such as a fixed point, periodic motion (including period-3 motion), chaotic motion, and transient chaos. The chaotic motion identified was validated by the confirmation of a positive Lyapunov exponent. Period-doubling routes to chaos in the fractional-order Chen-Lee system were also found.

Hydrothermal synthesis and crystal structures of Na{sub 2}Be{sub 3}(SeO{sub 3}){sub 4}.H{sub 2}O and Cs{sub 2}[Mg(H{sub 2}O){sub 6}]{sub 3}(SeO{sub 3}){sub 4}

Energy Technology Data Exchange (ETDEWEB)

Shen, Chen; Mei, Dajiang; Sun, Chuanling; Liu, Yunsheng; Wu, Yuandong [College of Chemistry and Chemical Engineering, Shanghai University of Engineering Science (China)

2017-09-04

The selenites, Na{sub 2}Be{sub 3}(SeO{sub 3}){sub 4}.H{sub 2}O and Cs{sub 2}[Mg(H{sub 2}O){sub 6}]{sub 3}(SeO{sub 3}){sub 4}, were synthesized under hydrothermal conditions. The crystal structures of Na{sub 2}Be{sub 3}(SeO{sub 3}){sub 4}.H{sub 2}O and Cs{sub 2}[Mg(H{sub 2}O){sub 6}]{sub 3}(SeO{sub 3}){sub 4} were determined by single-crystal X-ray diffractions. Na{sub 2}Be{sub 3}(SeO{sub 3}){sub 4}.H{sub 2}O crystallizes in the triclinic space group P1 (no. 2) with unit cell parameters a = 4.8493(9), b = 12.013(2), c = 12.077(2) Aa, and Z = 2, whereas Cs{sub 2}[Mg(H{sub 2}O){sub 6}]{sub 3}(SeO{sub 3}){sub 4} crystallizes in the monoclinic space group C2/m (no. 12) with lattice cell parameters a = 12.596(6), b = 7.297(4), c = 16.914(8) Aa, and Z = 2. Na{sub 2}Be{sub 3}(SeO{sub 3}){sub 4}.H{sub 2}O features a three-dimensional open framework structure formed by BeO{sub 4} tetrahedra and SeO{sub 3} trigonal pyramids. Na cations and H{sub 2}O molecules are located in different tunnels. Cs{sub 2}[Mg(H{sub 2}O){sub 6}]{sub 3}(SeO{sub 3}){sub 4} has a structure composed of isolated [Mg(H{sub 2}O){sub 6}] octahedra and SeO{sub 3} trigonal pyramids interacted by hydrogen bonds, and Cs cations are resided in-between. Both compounds were characterized by thermogravimetric analysis and FT-IR spectroscopy. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Development of mathematical model of H{sub 2}O-HNO{sub 3}-UO{sub 2}(NO{sub 3}){sub 2}-TBP-Diluent System

Energy Technology Data Exchange (ETDEWEB)

Ochkin, A.; Gladilov, D.; Nekhaevskiy, S.; Merkushkin, A. [D. Mendeleev University of Chemical Technology of Russia, 9 Miusskay Sqr., Moscow, 125047 (Russian Federation)

2016-07-01

The nuclear fuel reprocessing is based on the PUREX process. Usually 30% TBP in hydrocarbon diluents is applied, then the composition of the organic phase can be expressed as H{sub 2}O-HNO{sub 3}-UO{sub 2}(NO{sub 3}){sub 2}-Pu(NO{sub 3}){sub 4}-TBP-diluent. The mathematical model of H{sub 2}O-HNO{sub 3}-UO{sub 2}(NO{sub 3}){sub 2}-TBP-dodecane system has been elaborated. Mole fractions and volume ones and rational activity coefficients have been used in order to create the system of equations on the base of mass action law. The method for calculating activity coefficients was provided. The formation constants of uranyl nitrate di-solvate and mono-solvate and di-solvate of acid have been determined. Interaction between uranyl nitrate di-solvate and dodecane and between TBP and dodecane was taken into account. Activity coefficients of nitric acid and uranyl nitrate in mixed solutions were considered. Errors of adequacy have been determined for the systems containing 30% and 12% TBP concentrations.

Effect of the neutral charge fraction in the Coulomb explosion of H{sub 2}{sup +} ions through aluminum foils

Energy Technology Data Exchange (ETDEWEB)

Denton, Cristian D. E-mail: cdenton@fis.utfsm.cl; Abril, Isabel; Barriga-Carrasco, Manuel D.; Garcia-Molina, Rafael; Lantschner, Gerardo H.; Eckardt, Juan C.; Arista, Netor R

2002-06-01

The Coulomb explosion of the proton fragments dissociated from H{sub 2}{sup +} molecules moving through thin aluminum foils has been studied by means of their energy spectra, measured in the forward direction, and by computer simulations. The covered energy range goes from 25 to 100 keV/u. Estimations of the neutral charge fraction of the fragments inside the foil have been obtained by comparison of the experimental energy spectra with the computer simulations.

Variable dimensionality and framework found in a series of quaternary zinc selenites, A{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}·xH{sub 2}O (A = Na, Rb, and Cs; 0≤x≤1) and Cs{sub 2}Zn{sub 2}(SeO{sub 3}){sub 3}·2H{sub 2}O

Energy Technology Data Exchange (ETDEWEB)

Lü, Minfeng; Jo, Hongil; Oh, Seung-Jin; Ok, Kang Min, E-mail: kmok@cau.ac.kr

2017-01-15

Five new alkali metal zinc selenites, A{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}·xH{sub 2}O (A = Na, Rb, and Cs; 0≤x≤1) and Cs{sub 2}Zn{sub 2}(SeO{sub 3}){sub 3}·2H{sub 2}O have been synthesized by heating a mixture of ZnO, SeO{sub 2} and A{sub 2}CO{sub 3} (A = Na, Rb, and Cs), and characterized by X-ray diffraction (XRD) and spectroscopic analyses techniques. All of the reported materials revealed a rich structural chemistry with different frameworks and connection modes of Zn{sup 2+}. While Rb{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4} and Cs{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}·H{sub 2}O revealed three-dimensional frameworks consisting of isolated ZnO{sub 4} tetrahedra and SeO{sub 3} polyhedra, Na{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}, Cs{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}, and Cs{sub 2}Zn{sub 2}(SeO{sub 3}){sub 3}·2H{sub 2}O contained two-dimensional [Zn{sub 3}(SeO{sub 3}){sub 4}]{sup 2-} layers. Specifically, whereas isolated ZnO{sub 4} tetrahedra and SeO{sub 3} polyhedra are arranged into two-dimensional [Zn{sub 3}(SeO{sub 3}){sub 4}]{sup 2-} layers in two cesium compounds, circular [Zn{sub 3}O{sub 10}]{sup 14-} chains and SeO{sub 3} linkers are formed in two-dimensional [Zn{sub 3}(SeO{sub 3}){sub 4}]{sup 2-} layers in Na{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4}. Close structural examinations suggest that the size of alkali metal is significant in determining the framework geometry as well as connection modes of transition metal cations. - Graphical abstract: Variable dimensions and frameworks were found in a series of quaternary zinc selenites, A{sub 2}Zn{sub 3}(SeO{sub 3}){sub 4} (A = Na, Rb and Cs). - Highlights: • Five novel quaternary zinc selenites are synthesized. • All the selenites with different structures contain polarizable d{sup 10} and lone pair cations. • The size of alkali metal cations is significant in determining the framework geometry.

A novel optical microscope for imaging large embryos and tissue volumes with sub-cellular resolution throughout.

Science.gov (United States)

McConnell, Gail; Trägårdh, Johanna; Amor, Rumelo; Dempster, John; Reid, Es; Amos, William Bradshaw

2016-09-23

Current optical microscope objectives of low magnification have low numerical aperture and therefore have too little depth resolution and discrimination to perform well in confocal and nonlinear microscopy. This is a serious limitation in important areas, including the phenotypic screening of human genes in transgenic mice by study of embryos undergoing advanced organogenesis. We have built an optical lens system for 3D imaging of objects up to 6 mm wide and 3 mm thick with depth resolution of only a few microns instead of the tens of microns currently attained, allowing sub-cellular detail to be resolved throughout the volume. We present this lens, called the Mesolens, with performance data and images from biological specimens including confocal images of whole fixed and intact fluorescently-stained 12.5-day old mouse embryos.

Labelled T{sub 3}, T{sub 4} and TBP for In Vitro Testing of Thyroid Function in Man and Animals

Energy Technology Data Exchange (ETDEWEB)

Czerniak, P.; Boruchowski, Sabina; Shomron, I. [Dept. of Radiotherapy and Isotopes, Tel-Hashomer Hospital, Tel-Aviv University Medical School, Faculty of Continuing Medical Education, Tel-Aviv (Israel)

1970-02-15

Iodothyronines are bound to determined electrophoretic fractions of serum proteins - TBP (TBG, TBA, TBPA). Radioiodine labelled T{sub 3} and T{sub 4} complex the free TBP fractions until saturation. The excess of added in vitro thyronines is then absorbed by the RBC. The changes described can be detected and quantitatively determined by radioisotope tests: radioelectrophoresis - T{sub 3/4} BP test, and RBC - {sup 125}I T{sub 3} test (Hamolsky test). The in vitro tests of the thyroid function can be clinically reliable if the protein fractions are normal, and they may be altered without thyroid pathology if the TBG fractions are abnormal. The electrophoretic fractions vary quantitatively and qualitatively in animals of different classes and orders. We chose these features to study the correlation between iodothyronines, plasma proteins and the above-mentioned thyroid tests. Twenty-two animal species (arranged according to the increasing percentage of the Hamolsky test) were examined: goat (8.6%, cow, lamb, calf, man, camel, goose, hamster, rat, turkey, marmot, duck, horse, donkey, hen, dog, pigeon, rabbit, guinea-pig, mouse, fish and frog (91.5%). The following additional parameters were examined: PBI, serum quantitative electrophoresis, T{sub 3} BP studies. All the tests were performed under identical technical conditions. Results and conclusions: (1) The Hamolsky test in the examined animals ranges from 9% to 92%. It is highest in the poicolothermics, in which much prealbumin and few glubulins are found on electrophoresis. The T{sub 3} BP is low, and about a half of the added {sup 125}I T{sub 3} remains unbound. (2) T{sub 3} and T{sub 4} are complexed with T{sub 3} BP and T{sub 4} BP fractions, which correspond to prealbumin, albumin, alpha 1-2, beta and exceptionally gamma globulin. The fractions are variable but characteristic for each animal species. T{sub 3} BP does not correlate exactly with T{sub 4} BP, and seems to be distributed over more fractions

Generalized Functions for the Fractional Calculus

Science.gov (United States)

Lorenzo, Carl F.; Hartley, Tom T.

1999-01-01

Previous papers have used two important functions for the solution of fractional order differential equations, the Mittag-Leffler functionE(sub q)[at(exp q)](1903a, 1903b, 1905), and the F-function F(sub q)[a,t] of Hartley & Lorenzo (1998). These functions provided direct solution and important understanding for the fundamental linear fractional order differential equation and for the related initial value problem (Hartley and Lorenzo, 1999). This paper examines related functions and their Laplace transforms. Presented for consideration are two generalized functions, the R-function and the G-function, useful in analysis and as a basis for computation in the fractional calculus. The R-function is unique in that it contains all of the derivatives and integrals of the F-function. The R-function also returns itself on qth order differ-integration. An example application of the R-function is provided. A further generalization of the R-function, called the G-function brings in the effects of repeated and partially repeated fractional poles.

Isolation of Asphaltene-Degrading Bacteria from Sludge Oil

Directory of Open Access Journals (Sweden)

Pingkan Aditiawati

2015-03-01

Full Text Available Sludge oil contains 30%–50% hydrocarbon fractions that comprise saturated fractions, aromatics, resins, and asphaltene. Asphaltene fraction is the most persistent fraction. In this research, the indigenous bacteria that can degrade asphaltene fractions from a sludge oil sample from Balikpapan that was isolated using BHMS medium (Bushnell-Hass Mineral Salt with 0.01% (w/v yeast extract, 2% (w/v asphaltene extract, and 2% (w/v sludge oil. The ability of the four isolates to degrade asphaltene fractions was conducted by the biodegradation asphaltene fractions test using liquid cultures in a BHMS medium with 0.01% (w/v yeast extract and 2% (w/v asphaltene extract as a carbon source. The parameters measured during the process of biodegradation of asphaltene fractions include the quantification of Total Petroleum Hydrocarbon (g, log total number of bacteria (CFU/ml, and pH. There are four bacteria (isolates 1, 2, 3, and 4 that have been characterized to degrade asphaltic fraction and have been identified as Bacillus sp. Lysinibacillus fusiformes, Acinetobacter sp., and Mycobacterium sp., respectively. The results showed that the highest ability to degrade asphaltene fractions is that of Bacillus sp. (isolate 1 and Lysinibacillus fusiformes (Isolate 2, with biodegradation percentages of asphaltene fractions being 50% and 55%, respectively, and growth rate at the exponential phase is 7.17x107 CFU/mL.days and 4.21x107 CFU/mL.days, respectively.

Λ{sub b} → π{sup -}(D{sub s}{sup -})Λ{sub c}(2595), π{sup -}(D{sub s}{sup -})Λ{sub c}(2625) decays and DN, D*N molecular components

Energy Technology Data Exchange (ETDEWEB)

Liang, Wei-Hong [Guangxi Normal University, Department of Physics, Guilin (China); Centro Mixto Universidad de Valencia-CSIC Institutos de Investigacion de Paterna, Departamento de Fisica Teorica y IFIC, Valencia (Spain); Bayar, Melahat [Kocaeli University, Department of Physics, Izmit (Turkey); Oset, Eulogio [Centro Mixto Universidad de Valencia-CSIC Institutos de Investigacion de Paterna, Departamento de Fisica Teorica y IFIC, Valencia (Spain)

2017-01-15

From the perspective that Λ{sub c}(2595) and Λ{sub c}(2625) are dynamically generated resonances from the DN, D*N interaction and coupled channels, we have evaluated the rates for Λ{sub b} → π{sup -}Λ{sub c}(2595) and Λ{sub b} → π{sup -}Λ{sub c}(2625) up to a global unknown factor that allows us to calculate the ratio of rates and compare with experiment, where good agreement is found. Similarly, we can also make predictions for the ratio of rates of the, yet unknown, decays of Λ{sub b} → D{sub s}{sup -}Λ{sub c}(2595) and Λ{sub b} → D{sub s}{sup -}Λ{sub c}(2625) and make estimates for their individual branching fractions. (orig.)

Cell segmentation in time-lapse fluorescence microscopy with temporally varying sub-cellular fusion protein patterns.

Science.gov (United States)

Bunyak, Filiz; Palaniappan, Kannappan; Chagin, Vadim; Cardoso, M

2009-01-01

Fluorescently tagged proteins such as GFP-PCNA produce rich dynamically varying textural patterns of foci distributed in the nucleus. This enables the behavioral study of sub-cellular structures during different phases of the cell cycle. The varying punctuate patterns of fluorescence, drastic changes in SNR, shape and position during mitosis and abundance of touching cells, however, require more sophisticated algorithms for reliable automatic cell segmentation and lineage analysis. Since the cell nuclei are non-uniform in appearance, a distribution-based modeling of foreground classes is essential. The recently proposed graph partitioning active contours (GPAC) algorithm supports region descriptors and flexible distance metrics. We extend GPAC for fluorescence-based cell segmentation using regional density functions and dramatically improve its efficiency for segmentation from O(N(4)) to O(N(2)), for an image with N(2) pixels, making it practical and scalable for high throughput microscopy imaging studies.

Comparative study of void fraction models

International Nuclear Information System (INIS)

Borges, R.C.; Freitas, R.L.

1985-01-01

Some models for the calculation of void fraction in water in sub-cooled boiling and saturated vertical upward flow with forced convection have been selected and compared with experimental results in the pressure range of 1 to 150 bar. In order to know the void fraction axial distribution it is necessary to determine the net generation of vapour and the fluid temperature distribution in the slightly sub-cooled boiling region. It was verified that the net generation of vapour was well represented by the Saha-Zuber model. The selected models for the void fraction calculation present adequate results but with a tendency to super-estimate the experimental results, in particular the homogeneous models. The drift flux model is recommended, followed by the Armand and Smith models. (F.E.) [pt

Size characterization by Sedimentation Field Flow Fractionation of silica particles used as food additives

Energy Technology Data Exchange (ETDEWEB)

Contado, Catia, E-mail: Catia.Contado@unife.it [University of Ferrara, Department of Chemical and Pharmaceutical Sciences, via L. Borsari, 46, 44121 Ferrara (Italy); Ravani, Laura [University of Ferrara, Department of Life Sciences and Biotechnologies, via L. Borsari, 46, 44121 Ferrara (Italy); Passarella, Martina [University of Ferrara, Department of Chemical and Pharmaceutical Sciences, via L. Borsari, 46, 44121 Ferrara (Italy)

2013-07-25

Graphical abstract: -- Highlights: •Four types of SiO{sub 2} particles were characterized by SdFFF, PCS and EM techniques. •Clusters of 10 nm nanoparticles were found in some SiO{sub 2} samples. •A method was set up to extract SiO{sub 2} particles from food matrices. •The effects of the carrier solution composition on SdFFF separations were evaluated. •Particle size distributions were obtained from SiO{sub 2} particles extracted from foodstuffs. -- Abstract: Four types of SiO{sub 2}, available on the market as additives in food and personal care products, were size characterized using Sedimentation Field Flow Fractionation (SdFFF), SEM, TEM and Photon Correlation Spectroscopy (PCS). The synergic use of the different analytical techniques made it possible, for some samples, to confirm the presence of primary nanoparticles (10 nm) organized in clusters or aggregates of different dimension and, for others, to discover that the available information is incomplete, particularly that regarding the presence of small particles. A protocol to extract the silica particles from a simple food matrix was set up, enriching (0.25%, w w{sup −1}) a nearly silica-free instant barley coffee powder with a known SiO{sub 2} sample. The SdFFF technique, in conjunction with SEM observations, made it possible to identify the added SiO{sub 2} particles and verify the new particle size distribution. The SiO{sub 2} content of different powdered foodstuffs was determined by graphite furnace atomic absorption spectroscopy (GFAAS); the concentrations ranged between 0.006 and 0.35% (w w{sup −1}). The protocol to isolate the silica particles was so applied to the most SiO{sub 2}-rich commercial products and the derived suspensions were separated by SdFFF; SEM and TEM observations supported the size analyses while GFAAS determinations on collected fractions permitted element identification.

Magnesium isotope fractionation in bacterial mediated carbonate precipitation experiments

Science.gov (United States)

Parkinson, I. J.; Pearce, C. R.; Polacskek, T.; Cockell, C.; Hammond, S. J.

2012-12-01

Magnesium is an essential component of life, with pivotal roles in the generation of cellular energy as well as in plant chlorophyll [1]. The bio-geochemical cycling of Mg is associated with mass dependant fractionation (MDF) of the three stable Mg isotopes [1]. The largest MDF of Mg isotopes has been recorded in carbonates, with foraminiferal tests having δ26Mg compositions up to 5 ‰ lighter than modern seawater [2]. Magnesium isotopes may also be fractionated during bacterially mediated carbonate precipitation and such carbonates are known to have formed in both modern and ancient Earth surface environments [3, 4], with cyanobacteria having a dominant role in carbonate formation during the Archean. In this study, we aim to better constrain the extent to which Mg isotope fractionation occurs during cellular processes, and to identify when, and how, this signal is transferred to carbonates. To this end we have undertaken biologically-mediated carbonate precipitation experiments that were performed in artificial seawater, but with the molar Mg/Ca ratio set to 0.6 and with the solution spiked with 0.4% yeast extract. The bacterial strain used was marine isolate Halomonas sp. (gram-negative). Experiments were run in the dark at 21 degree C for two to three months and produced carbonate spheres of various sizes up to 300 μm in diameter, but with the majority have diameters of ~100 μm. Control experiments run in sterile controls (`empty` medium without bacteria) yielded no precipitates, indicating a bacterial control on the precipitation. The carbonate spheres are produced are amenable to SEM, EMP and Mg isotopic analysis by MC-ICP-MS. Our new data will shed light on tracing bacterial signals in carbonates from the geological record. [1] Young & Galy (2004). Rev. Min. Geochem. 55, p197-230. [2] Pogge von Strandmann (2008). Geochem. Geophys. Geosys. 9 DOI:10.1029/2008GC002209. [3] Castanier, et al. (1999). Sed. Geol. 126, 9-23. [4] Cacchio, et al. (2003

Sub-50-as isolated extreme ultraviolet continua generated by 1.6-cycle near-infrared pulse combined with double optical gating scheme

Science.gov (United States)

Oguri, Katsuya; Mashiko, Hiroki; Ogawa, Tatsuya; Hanada, Yasutaka; Nakano, Hidetoshi; Gotoh, Hideki

2018-04-01

We demonstrate the generation of ultrabroad bandwidth attosecond continua extending to sub-50-as duration in the extreme ultraviolet (EUV) region based on a 1.6-cycle Ti:sapphire laser pulse. The combination of the amplitude gating scheme with a sub-two-cycle driver pulse and the double optical gating scheme achieves the continuum generation with a bandwidth of 70 eV at the full width at half maximum near the peak photon energy of 140 eV, which supports a Fourier-transform-limited pulse duration as short as 32 as. The carrier-envelope-phase (CEP) dependence of the attosecond continua shows a single-peak structure originating from the half-cycle cut-off at appropriate CEP values, which strongly indicates the generation of a single burst of an isolated attosecond pulse. Our approach suggests a possibility for isolated sub-50-as pulse generation in the EUV region by compensating for the intrinsic attosecond chirp with a Zr filter.

Search for B⁰<sub>s> → μ+ μ- and B⁰<sub>d> → mu+mu- decays in p anti-p collisions with CDF. II.

Energy Technology Data Exchange (ETDEWEB)

Abulencia, A.; Acosta, D.; Adelman, J.; Affolder, T.; Akimoto, T.; Albrow, M. G.; Ambrose, D.; Amerio, S.; Amidei, D.; Anastassov, A.; Anikeev, K.; Annovi, A.; Antos, J.; Aoki, M.; Apollinari, G.; Arguin, J. -F.; Arisawa, T.; Artikov, A.; Ashmanskas, W.; Attal, A.; Azfar, F.

2005-08-01

We report on a search for B⁰<sub>s> → μ+ μ- and B⁰<sub>d> → mu+mu- decays in p anti-p collisions at √s = 1.96 TeV using 364.4 pb ^-1 of data collected by the CDF II dectector at Fermilab Tevatron Collider. After applying all selection requirements, we observe no candidates inside the B⁰<sub>s> or B⁰<sub>d> mass windows. The resulting upper limits on the branching fractions are β(B⁰<sub>s> → μ+μ-) < 1.5 x 10^-7 and β(B⁰<sub>d> → μ+μ-) < 3.9 x 10^-8 at 90 % confidence level. (auth)

Visible photoluminescence from plasma-polymerized-organosilicone thin films deposited from HMDSO/O{sub 2} induced remote plasma: effect of oxygen fraction

Energy Technology Data Exchange (ETDEWEB)

Naddaf, M; Saloum, S [Department of Physics, Atomic Energy Commission of Syria (AECS), PO Box 6091 Damascus (Syrian Arab Republic)], E-mail: scientific6@aec.org.sy

2008-09-07

Visible photoluminescence (PL) from thin films deposited on silicon wafers by remote plasma polymerization of the hexamethyledisiloxane (HMDSO)/O{sub 2} mixture in a radio-frequency hollow cathode discharge reactor has been investigated as a function of different oxygen fractions ({chi}{sub O{sub 2}}=0, 0.38, 0.61, 0.76 and 0.9). At room temperature, the film deposited at ({chi}{sub O{sub 2}}=0 exhibits a strong, broad PL band peak centred at around 537.6 nm. A blue shift and a considerable decrease ({approx}one order) in the intensity of the PL peak are observed after the addition of oxygen. Furthermore, in contrast to the film deposited from pure HMDSO, the low temperature (15 K) PL spectra of the film deposited from different HMDSO/O{sub 2} mixtures exhibit two separated 'green-blue' and 'yellow-green' PL peaks. The PL behaviour of the deposited films is correlated with their structural and morphological properties, investigated by using Fourier transform infrared, atomic force microscope and contact angle techniques. In addition, it is found from spectrophotometry measurements that the deposited films have relatively low absorption coefficients (in the range 100-500 cm{sup -1}) in the spectral range of their PL emission, attractive for possible integrated optics devices.

Influence of milling time on microstructure and magnetic properties of Fe{sub 80}P{sub 11}C{sub 9} alloy produced by mechanical alloying

Energy Technology Data Exchange (ETDEWEB)

Taghvaei, A.H. [Department of Materials Science and Engineering, Shiraz University of Technology, Shiraz (Iran, Islamic Republic of); Ghajari, F., E-mail: fati.ghajari@gmail.com [Department of Materials Science and Engineering, Shiraz University, Shiraz (Iran, Islamic Republic of); Markó, D. [IFW Dresden, Institute for Complex Materials, Helmholtzstr. 20, 01069 Dresden (Germany); Prashanth, K.G. [IFW Dresden, Institute for Complex Materials, Helmholtzstr. 20, 01069 Dresden (Germany); Additive manufacturing Center, Sandvik AB, 81181 Sandviken (Sweden)

2015-12-01

Fe{sub 80}P{sub 11}C{sub 9} alloy with amorphous/nanocrytalline microstructure has been synthesized by mechanical alloying of the elemental powders. The microstructure, thermal behavior and morphology of the produced powders have been studied by X-ray diffraction (XRD), differential scanning calorimetry (DSC) and scanning electron microscopy (SEM), respectively. The crystallite size, lattice strain and fraction of the amorphous phase have been calculated by Rietveld refinement method. The results indicate that the powders microstructure consists of α-Fe(P,C) nanocrystals with an average diameter of 9 nm±1 nm dispersed in the amorphous matrix after 90 h of milling. Moreover, the fraction of amorphous phase initially increases up to 90 h of milling and then decreases after 120 h of milling, as a result of mechanical crystallization and formation of Fe{sub 2}P phase. The magnetic measurements show that while the saturation magnetization decreases continuously with the milling time, the coercivity exhibits a complicated trend. The correlation between microstructural changes and magnetic properties has been discussed in detail. - Highlights: • Glass formation was investigated in Fe{sub 80}P{sub 11}C{sub 9} by mechanical alloying. • Structural parameters were calculated by Rietveld refinement method. • Milling first increased and then decreased the fraction of amorphous phase. • Magnetic properties were significantly changed upon milling.

Comparison of some peptidic and proteic ovine pineal fractions with a bovine pineal E5 fraction

Energy Technology Data Exchange (ETDEWEB)

Noteborn, H P; Ebels, I; Salemink, C A [State Univ. of Utrecht, Utrecht (Netherlands). Department of Organic Chemistry; Pevet, P [The Netherlands Institute for Brain Research, Amsterdam (Netherlands).; Reinharz, A C [Hopital Cantonal, Geneva (Switzerland). Department of Medicine, Division of Endocrinology; Neacsu, C [Institute of Cellular Biology and Pathology, Bucharest (Romania).

1982-01-01

Using rather simple and mild extraction and separation methods, three ovine pineal fractions (XM 300R - PP 7.2, PP 7.2' and PP 7.2S) were obtained, which contain peptidic/proteic substances and which show fluorescence characteristics of indoles. The ovine fractions were compared with the bovine pineal E5-fraction. The ovine fractions are chemically sensitive to normal laboratory light and stable in red light (..lambda.. > 600 nm). Immunologically, these fractions and the bovine E5 fraction are stable. From the results of radioimmunological experiments it was concluded that the bovine pineal E5 fraction as well as the ovine pineal fraction XM 300R - PP 7.2 and PP 7.2S may contain (a) peptide(s) ending by the same carboxy terminal tripeptide Pro-Arg-Gly(NH/sub 2/).

Transport properties of partially-filled Ce{sub y}Co{sub 4}Sb{sub 12}

Energy Technology Data Exchange (ETDEWEB)

Uher, C; Chen, B; Hu, S; Morelli, D T; Meisner, G P

1997-07-01

The authors have investigated the magnetic and transport properties of Ce{sub y}Co{sub 4}Sb{sub 12} filled skutterudites with the filling fraction y {le} 0.1. These compounds are n-type materials that develop a magnetic moment upon the presence of trivalent cerium. Cerium has a strong influence on all transport properties and even in small amounts it drastically reduces the lattice thermal conductivity. The resulting figures of merit are comparable to the values established previously for the p-type filled skutterudites.

Non-equilibrium Inertial Separation Array for High-throughput, Large-volume Blood Fractionation.

Science.gov (United States)

Mutlu, Baris R; Smith, Kyle C; Edd, Jon F; Nadar, Priyanka; Dlamini, Mcolisi; Kapur, Ravi; Toner, Mehmet

2017-08-30

Microfluidic blood processing is used in a range of applications from cancer therapeutics to infectious disease diagnostics. As these applications are being translated to clinical use, processing larger volumes of blood in shorter timescales with high-reliability and robustness is becoming a pressing need. In this work, we report a scaled, label-free cell separation mechanism called non-equilibrium inertial separation array (NISA). The NISA mechanism consists of an array of islands that exert a passive inertial lift force on proximate cells, thus enabling gentler manipulation of the cells without the need of physical contact. As the cells follow their size-based, deterministic path to their equilibrium positions, a preset fraction of the flow is siphoned to separate the smaller cells from the main flow. The NISA device was used to fractionate 400 mL of whole blood in less than 3 hours, and produce an ultrapure buffy coat (96.6% white blood cell yield, 0.0059% red blood cell carryover) by processing whole blood at 3 mL/min, or ∼300 million cells/second. This device presents a feasible alternative for fractionating blood for transfusion, cellular therapy and blood-based diagnostics, and could significantly improve the sensitivity of rare cell isolation devices by increasing the processed whole blood volume.

Correlation Between Minimum Apparent Diffusion Coefficient (ADCmin) and Tumor Cellularity: A Meta-analysis.

Science.gov (United States)

Surov, Alexey; Meyer, Hans Jonas; Wienke, Andreas

2017-07-01

Diffusion-weighted imaging (DWI) is a magnetic resonance imaging (MRI) technique based on measure of water diffusion that can provide information about tissue microstructure, especially about cell count. Increase of cell density induces restriction of water diffusion and decreases apparent diffusion coefficient (ADC). ADC can be divided into three sub-parameters: ADC minimum or ADC min , mean ADC or ADC mean and ADC maximum or ADC max Some studies have suggested that ADC min shows stronger correlations with cell count in comparison to other ADC fractions and may be used as a parameter for estimation of tumor cellularity. The aim of the present meta-analysis was to summarize correlation coefficients between ADC min and cellularity in different tumors based on large patient data. For this analysis, MEDLINE database was screened for associations between ADC and cell count in different tumors up to September 2016. For this work, only data regarding ADC min were included. Overall, 12 publications with 317 patients were identified. Spearman's correlation coefficient was used to analyze associations between ADC min and cellularity. The reported Pearson correlation coefficients in some publications were converted into Spearman correlation coefficients. The pooled correlation coefficient for all included studies was ρ=-0.59 (95% confidence interval (CI)=-0.72 to -0.45), heterogeneity Tau 2 =0.04 (pcorrelated moderately with tumor cellularity. The calculated correlation coefficient is not stronger in comparison to the reported coefficient for ADC mean and, therefore, ADC min does not represent a better means to reflect cellularity. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

Suppression of thermal and chemical nociception in rats by methanol extract and its sub-fraction from lantana camara

International Nuclear Information System (INIS)

Simjee, S.U.; Perveen, H.; Zehra, S.Q.

2016-01-01

The traditional use of Lantana camara (Verbenaceae) is reported to include anti-nociceptive, antimicrobial, and immunosuppressant activity. To our knowledge no systematic study has been carried out on the anti-nociceptive activity of L. camara. The present study was designed to delineate the analgesic activity of L. camara extract and its fractions to elucidate the traditional belief in the painkilling effects. Experimental models employed were thermal and chemical-induced nociception assays. After initial screening of the methanol extract and its fractions prepared from the aerial parts of the plant, the dose of 50,100 and 200 mg/kg were selected and route of administration was i.p. The test samples were tested against a reference drug indomethacine (i.p. 5 mg/kg). The observations were made at 15, 30, 60, and 120 seconds following the administration of the samples or reference drug. Experiments on naloxone antagonism were conducted to determine involvement of opioid receptors. Compared to concurrent controls, a significant anti-nociceptive activity was observed in methanol extract LC (ED50 50 mg/kg, P < 0.002) and its sub-fractions LCEA-AQ (ED50 50 mg/kg, P < 0.004), LCEA (ED50 100 mg/kg, P < 0.004) and LCEA-PEI (ED50 100 mg/kg, P < 0.005). No apparent acute toxicity was observed in any test groups. The anti-nociceptive activity was not precipitated by naloxone antagonism indicating that these fractions do not act through opioid receptors. The methanol extract and active fractions of Lantana camara possess anti-nociceptive activity. Further investigations are needed to elucidate the mechanism of its action. (author)

Antibacterial activity of crude methanolic extract and various fractions of Vitex agnus castus and Myrsine africana against clinical isolates of Methicillin Resistant Staphylococcus aureus.

Science.gov (United States)

Ahmad, Bashir; Hafeez, Nabia; Ara, Gulshan; Azam, Sadiq; Bashir, Shumaila; Khan, Ibrar

2016-11-01

Staphylococcus aureus is a nosocomial pathogen that resides in the soft tissues causing many diseases. The current study was conducted to determine the prevalence of Methicillin Resistant S. aureus (MRSA) in ear discharge and pus of patients and antibacterial activity of crude methanolic extract (Cr. MeOH Ext.) and various fractions of M. Africana and V. agnus castus against clinical isolates of MRSA. A total of 40 samples were collected from ear, nose and throat (ENT) outpatient department and wards of Khyber Teaching Hospital (KTH), Peshawar. Out of 40 samples, 36 (90%) samples showed growth on Mannitol Salt Agar (MSA) media out of which 9(25%) were MRSA and the remaining 27(75%) were methicillin susceptible S. aureus (MSSA). A good antibacterial activity was observed for the Cr. MeOH Ext. (76.1%) and ethyl acetate (EtOAc) fraction of V. agnus castus against S11 (71.4%). The n-hexane fraction also showed good antibacterial effect (70%) against S 26 . The chloroform (CHCl3), butanol (BuOH) and aqueous fractions of M. africana showed good antibacterial activity against S 11 (71.4%), S32 (70%) and S 26 (75%), respectively. The above results revealed that the selected plants can be further utilized for isolation of the active ingredients as the crude extracts were found good for inhibition of MRSA.

Charged-Higgs on R{sub D}{sup {sub (}{sub *}{sub )}}, τ polarization, and FBA

Energy Technology Data Exchange (ETDEWEB)

Chen, Chuan-Hung [National Cheng-Kung University, Department of Physics, Tainan (China); Nomura, Takaaki [KIAS, School of Physics, Seoul (Korea, Republic of)

2017-09-15

We study the influence of a charged-Higgs on the excess of branching fraction ratio, R{sub M} = BR(anti B → Mτ anti ν{sub τ})/BR(anti B → Ml anti ν{sub l}) (M = D, D*), in a generic two-Higgs-doublet model. In order to investigate the lepton polarization, the detailed decay amplitudes with lepton helicity are given. When the charged-Higgs is used to resolve excesses, it is found that two independent Yukawa couplings are needed to explain the R{sub D} and R{sub D*} anomalies. We show that when the upper limit of BR(B{sub c} → τ anti ν{sub τ}) < 30% is included, R{sub D} can be significantly enhanced while R{sub D*} < 0.27. With the BR(B{sub c} → τ anti ν{sub τ}) constraint, we find that the τ-lepton polarizations can be still affected by the charged-Higgs effects, where the standard model (SM) predictions are obtained: P{sup τ}{sub D} ∼ 0.324 and P{sup τ}{sub D*} ∼ -0.500, and they can be enhanced to be P{sup τ}{sub D} ∼ 0.5 and P{sup τ}{sub D*} ∼ -0.41 by the charged-Higgs. The integrated lepton forward-backward asymmetry (FBA) is also studied, where the SM result is anti A{sup D{sup ({sup *{sup ),τ}{sub FB}}}} ∼ -0.359(0.064), and they can be enhanced (decreased) to be anti A{sup D{sup ({sup *{sup ),τ}{sub FB}}}} ∼ -0.33(0.02). (orig.)

Isolation and characterization of copper tolerant bacterial isolates

International Nuclear Information System (INIS)

Farooq, S.; Shoeb, E.; Badar, U.; Akhtar, J.

2008-01-01

Twelve bacterial strains were isolated from metal contaminated sites close to the chemical factory, Purification and characterization of these strains was done. Maximum tolerable concentration (MTC) of all the isolated strains was determined against heavy metals cadmium chloride (CdCl/sub 2/), copper sulphate (CuSO/sub 4/), and nickel chloride (NiCI/sub 2/) and antibiotics kanamycin (Km), streptomycin (Sm), and chloramphenicol (Cm). Most promising strain was found to be GESSF012 which showed MTC of 4.5 mM and 1.6 mM against CdCI/sub 2/ in enriched and minimal media respectively; whereas MTC of 750 micro g/ml was against Sm. GESSF012 demonstrated the occurrence of multiple stress tolerance as this strain showed considerable tolerance against other heavy metals including CuSO/sub 4/, (3.0 mM in enriched media and 1.8 mM in minimal media) and NiCl/sub 2/, (2.0 mM in enriched media and 1.8 mM in minimal media) as well as other antibiotics Cm and Km (150 and 125 micro g/ml respectively). Plasmids were detected in most of the strains including GESSF012. (author)

Cadmium bound to metal rich granules and exoskeleton from Gammarus pulex causes increased gut lipid peroxidation in zebrafish following single dietary exposure

International Nuclear Information System (INIS)

Khan, F.R.; Bury, N.R.; Hogstrand, C.

2010-01-01

There has been a growing interest in establishing how the sub-cellular distribution of metals in macro-invertebrate prey affects metal trophic bioavailability and toxicity. In this study, the crustacean Gammarus pulex was exposed to 300 μg Cd l -1 spiked with 109 Cd for 13 days, from which the two principal metal containing sub-cellular fractions, the metallothionein-like protein (MTLP) and the metal rich granule and exoskeleton (MRG + exo) were isolated. These fractions were produced at equal metal content, incorporated into gelatin and fed to zebrafish as a single meal; assimilation efficiency (AE), carcass and gut tissue metal concentrations and gut lipid peroxidative damage measured as malondialdehyde (MDA) were assessed. The AE of cadmium bound to the MTLP fraction was 32.1 ± 5.6% which was significantly greater than the AE of MRG + exo bound Cd, 13.0 ± 2.1% (p -1 in fish fed MTLP-Cd compared to 9.5 ± 1.4 ng Cd g -1 in fish fed MRG + exo fraction. Both feeds led to significantly increased MDA levels compared to the control group (gelatin only feed), but MRG + exo feed caused significantly more oxidative damage than the MTLP feed (p < 0.01). Thus, MTLP-Cd is more bioavailable than the cadmium bound to granules and exoskeleton, but it was the latter fraction, largely considered as having limited bioavailability, that appeared to exert a greater localised oxidative injury to the digestive tract of zebrafish.

CMV-specific T cell isolation from G-CSF mobilized peripheral blood: depletion of myeloid progenitors eliminates non-specific binding of MHC-multimers.

Science.gov (United States)

Beloki, Lorea; Ciaurriz, Miriam; Mansilla, Cristina; Zabalza, Amaya; Perez-Valderrama, Estela; Samuel, Edward R; Lowdell, Mark W; Ramirez, Natalia; Olavarria, Eduardo

2014-11-19

Cytomegalovirus (CMV)-specific T cell infusion to immunocompromised patients following allogeneic Hematopoietic Stem Cell Transplantation (allo-HSCT) is able to induce a successful anti-viral response. These cells have classically been manufactured from steady-state apheresis samples collected from the donor in an additional harvest prior to G-CSF mobilization, treatment that induces hematopoietic stem cell (HSC) mobilization to the periphery. However, two closely-timed cellular collections are not usually available in the unrelated donor setting, which limits the accessibility of anti-viral cells for adoptive immunotherapy. CMV-specific cytotoxic T cell (CTL) manufacture from the same G-CSF mobilized donor stem cell harvest offers great regulatory advantages, but the isolation using MHC-multimers is hampered by the high non-specific binding to myeloid progenitors, which reduces the purity of the cellular product. In the present study we describe an easy and fast method based on plastic adherence to remove myeloid cell subsets from 11 G-CSF mobilized donor samples. CMV-specific CTLs were isolated from the non-adherent fraction using pentamers and purity and yield of the process were compared to products obtained from unmanipulated samples. After the elimination of unwanted cell subtypes, non-specific binding of pentamers was notably reduced. Accordingly, following the isolation process the purity of the obtained cellular product was significantly improved. G-CSF mobilized leukapheresis samples can successfully be used to isolate antigen-specific T cells with MHC-multimers to be adoptively transferred following allo-HSCT, widening the accessibility of this therapy in the unrelated donor setting. The combination of the clinically translatable plastic adherence process to the antigen-specific cell isolation using MHC-multimers improves the quality of the therapeutic cellular product, thereby reducing the clinical negative effects associated with undesired

Al{sub 2}O{sub 3} reinforced nanoparticle ZrO{sub 2} (3at%?Y{sub 2}O{sub 3}); Al{sub 2}O{sub 3} reforcado com nanoparticulas de ZrO{sub 2}(3%mol Y{sub 2}O{sub 3})

Energy Technology Data Exchange (ETDEWEB)

Cossu, C.M.F.A.; Alves, M.F.R.P.; Campos, L.Q.B.; Magnago, R.O.; Santos, C., E-mail: caio.cossu@usp.br [Universidade do Estado do Rio de Janeiro (UERJ), Resende, RJ (Brazil). Faculdade de Tecnologia; Simba, B.G. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Guaratingueta, SP (Brazil). Faculdade de Engenharia

2016-07-01

This work developed a composite Al{sub 2}O{sub 3}-based reinforced with nanoparticles of ZrO{sub 2} (Y{sub 2}O{sub 3}), to evaluate the effect of the content of ZrO{sub 2} nanoparticles (Y{sub 2}O{sub 3}) on the mechanical properties. Mixtures containing a matrix of Al{sub 2}O{sub 3} with fractions in weight of 3%, 5%, 10% and 15%, ZrO{sub 2} (Y{sub 2}O{sub 3}), and were mixed in mortar mill. Mixtures received 5% polymeric binder (PVA); and after adding the binder, the material was pressed uniaxially to 50MPa, and then sintered at a temperature of 1600 ° C - 2h. The sintered products were characterized by X-ray diffraction, scanning electron microscopy (SEM), relative density, hardness and fracture toughness. The results of X-ray diffraction showed that Al{sub 2}O{sub 3} and tetragonal ZrO{sub 2} as crystal phases found after sintering. Furthermore, the relative green density of 55% was predominant in the compact; and after sintering, varied depending on the ZrO{sub 2} content, reaching 97% in sintered compositions with 3% ZrO{sub 2} nanoparticles (Y{sub 2O}3). The hardness of the samples showed values of 1670HV and the maximum toughness of 3.2 MPa × m{sup 1/2}, directly influenced by the presence of nanoparticles ZrO{sub 2} uniformly dispersed in the matrix Al{sub 2}O{sub 3}, which results in at least two main mechanisms tenacifiers: transformation of tetragonal-monoclinic phase of zirconia, and compressive residual strain between the two phases present, Al{sub 2}O{sub 3} and tetragonal ZrO{sub 2}. (author)

Polyfunctional catalyst for processiing benzene fractions

Energy Technology Data Exchange (ETDEWEB)

G. Byakov; B.D. Zubitskii; B.G. Tryasunov; I.Ya. Petrov [Kuznetsk Basin State Technical University, Kemerovo (Russian Federation)

2009-05-15

A by-product of the coke industry is a raw benzene fraction benzene- 1 which may serve as for catalytic processes. The paper reports a study on the influence of the composition and temperatures on the activity and selectivity of NiO-V{sub 2}O{sub 6}-MoO{sub 3}/{gamma}-Al{sub 2}O{sub 3} catalysts and the corresponding binary and tertiary subsystems are studied by a pulse method in model reactions; the hydrodealkylating of toluene and the hydrodesulfurizing of thioprhene. The optimal catalyst composition is established. The new catalyst is compared with industrial catalysts.

Search for highly interacting fractionally charged particles at PEP

International Nuclear Information System (INIS)

Wlodzimierz, G.

1982-01-01

Fractionally charged, highly interacting particles produced in e + e - annihilation at 20 GeV c.m. energy have been search for. The experiment was performed at the positron electron storage ring (PEP) at the Stanford Linear Accelerator Center (SLAC). The search used in the innermost part of the two-arm Free Quark Search (FQS) detector. This part was called the Thin Front End (TFE) and it covered 1/3 of the full solid angle. Each of its arms consisted of five multiwire proportional chambers (MWPC's), used for tracking and dE/dx measurement, and three hodoscopes of 0.16 cm thick Pilot F scintillator. The total thickness of the five MWPC's and the beam pipe was 0.007 hadronic collision lengths (lambda/sub c/). No candidates for fractionally charged particles were found. Upper limits on R/sub q anti q/ = sigma(e + e - →q anti q)/sigma(e + e - →μμ) are between: (1) 0.7% to 7% for quark interaction lengths (lambda/sub q/) equal to lambda/sub c/ and between 3% and 33% for lambda/sub q/ = 100lambda/sub c/ for Q = 1/3e quark charge and for quark masses up to 13 GeV/c 2 ; (2) 2% to 38% for lambda/sub q/ - lambda/sub c/ and from 7% to 160% for lambda/sub q/ = 100lambda/sub c/ for Q = 2/3e quark charge and for masses up to 8 GeV/c 2 . In the inclusive production channel the upper limits on R/sub q/ = sigma(e + e - →qqX)/sigma(e + e - →μμ) are for charge 1/3e only. R/sub q/ varies from 2% to 11% for lambda/sub q/ = lambda/sub c/ and from 3% to 16% for lambda/sub q/ = 100lambda/sub c/ and for quark masses up to 6.5 GeV/c 2 . These are the first limits on the production of fractionally charged particles with lambda/sub q/ = 100lambda/sub c/

High-pressure behavior of A <sub>2sub> B <sub>2sub> O <sub>7sub> pyrochlore (A=Eu, Dy; B=Ti, Zr)

Energy Technology Data Exchange (ETDEWEB)

Rittman, Dylan R.; Turner, Katlyn M.; Park, Sulgiye; Fuentes, Antonio F.; Yan, Jinyuan; Ewing, Rodney C.; Mao, Wendy L.

2017-01-28

In situ high-pressure X-ray diffraction and Raman spectroscopy were used to determine the influence of composition on the high-pressure behavior of A<sub>2sub>B>2sub>O>7sub> pyrochlore (A=Eu, Dy; B=Ti, Zr) up to ~50GPa. Based on X-ray diffraction results, all compositions transformed to the high-pressure cotunnite structure. The B-site cation species had a larger effect on the transition pressure than the A-site cation species, with the onset of the phase transformation occurring at ~41 GPa for B=Ti and ~16 GPa B=Zr. However, the A-site cation affected the kinetics of the phase transformation, with the transformation for compositions with the smaller ionic radii, i.e., A=Dy, proceeding faster than those with a larger ionic radii, i.e., A=Eu. These results were consistent with previous work in which the radius-ratio of the A- and B-site cations determined the energetics of disordering, and compositions with more similarly sized A- and B-site cations had a lower defect formation energy. Raman spectra revealed differences in the degree of short-range order of the different compositions. Due to the large phase fraction of cotunnite at high pressure for B=Zr compositions, Raman modes for cotunnite could be observed, with more modes recorded for A=Eu than A=Dy. These additional modes are attributed to increased short-to-medium range ordering in the initially pyrochlore structured Eu<sub>2sub>Zr>2sub>O>7sub> as compared with the initially defect-fluorite structured Dy<sub>2sub>Zr>2sub>O>7sub>.

Nonhomogeneous fractional Poisson processes

Energy Technology Data Exchange (ETDEWEB)

Wang Xiaotian [School of Management, Tianjin University, Tianjin 300072 (China)]. E-mail: swa001@126.com; Zhang Shiying [School of Management, Tianjin University, Tianjin 300072 (China); Fan Shen [Computer and Information School, Zhejiang Wanli University, Ningbo 315100 (China)

2007-01-15

In this paper, we propose a class of non-Gaussian stationary increment processes, named nonhomogeneous fractional Poisson processes W{sub H}{sup (j)}(t), which permit the study of the effects of long-range dependance in a large number of fields including quantum physics and finance. The processes W{sub H}{sup (j)}(t) are self-similar in a wide sense, exhibit more fatter tail than Gaussian processes, and converge to the Gaussian processes in distribution in some cases. In addition, we also show that the intensity function {lambda}(t) strongly influences the existence of the highest finite moment of W{sub H}{sup (j)}(t) and the behaviour of the tail probability of W{sub H}{sup (j)}(t)

Isolation of imidacloprid degrading bacteria from cotton fields

International Nuclear Information System (INIS)

Shahid, M.N.; Jabeen, F.; Hassan, S.W.

2008-01-01

Imidacloprid is cyclodiene organochlorine, used as an insecticide all over the world an possess a serious environmental threat. It is mostly used for cotton insects (bollworm, aphid and white fly). For isolation of imidacloprid degrading bacteria three soil samples were collected from cotton fields of district Layyah having five years history of use. Soil samples were analyzed by measuring pH and electric conductivity. The isolation of imidacroprid degrading bacteria was performed by enrichment technique. Fourteen bacterial strains: S/sub i-a/, S/sub i-b/, S/sub i-c/, S/sub i-d/, S/sub i-e/, S/sub a-a/, S/a-b/, S/a-c/, S/a-d/, S/sub b-a/, S/sub b-b/, S/sub b-c/, S/sub b-d/ and S/b-e/ were isolated on the basis of their colony morphologies. The purified colonies were characterized morphologically physiologically and biochemically. Gram staining was done and Gram staining was done and Gram negative strains were confirmed on macConkey agar and Eosin methylene blue. Bacterial strains were also checked for different minimal media in which only carbon source was the imidacloprid. For this purpose FTW, FTW without N/sun 2/, NSM, M/sub 9/ and MM/sub 2/ media were used and their optical densities were taken on spectrophotometer, isolates were checked for resistance to antibiotics and heavy metals. On the basis of these characteristics. S/sub a-c/ and S/sub l-d/ were assigned to Enterobacteriaceae, S/sub a-b/ to Pseudomonadaceae and rest of the bacterial isolates were affiliated. (author)

Magnetic ordering and electrical resistivity in Co{sub 0.2}Zn{sub 0.8}Fe{sub 2}O{sub 4} spinel oxide

Energy Technology Data Exchange (ETDEWEB)

Bhowmik, R.N. [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700065 (India)], E-mail: rabindranath.bhowmik@saha.ac.in; Ranganathan, R. [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700065 (India); Ghosh, B.; Kumar, S. [Department of Physics, Jadavpur University, Kolkata 700 032 (India); Chattopadhyay, S. [Department of Physics, University of Calcutta, 92, A.P.C. Road, Kolkata 700009 (India)

2008-05-29

We report the magnetic, Moessbauer spectroscopy and resistivity measurements in order to understand the electronic behaviour of bulk Co{sub 0.2}Zn{sub 0.8}Fe{sub 2}O{sub 4} spinel oxide. The effect of magnetic order on electrical behaviour is observed from the resistivity measurements in the absence and presence of magnetic field. The analysis of Moessbauer spectra suggests the absence of Fe{sup 2+} ions in the system, which implies that complete hopping of charge carriers between localized Fe{sup 3+}/Co{sup 2+} and Fe{sup 2+}/Co{sup 3+} pair of ions in B sublattice is not the favourable mechanism in Co{sub 0.2}Zn{sub 0.8}Fe{sub 2}O{sub 4}. We suggest that electrical behaviour of the present sample may be consistent with a model of fractional charge transfer via Fe{sub B}{sup 3+}-O{sup 2-}-Co{sub B}{sup 2+} superexchange path.

Isolation of low-molecular albumins of 2S fraction from soybean (Glycine max (L.) Merrill).

Science.gov (United States)

Galbas, Mariola; Porzucek, Filip; Woźniak, Anna; Słomski, Ryszard; Selwet, Marek

2013-01-01

Numerous studies have shown that consumption of soybean products decrease the risk of cancers in humans. Experiments at the molecular level have demonstrated that in most cases proteins and peptides are responsible for the anticancer properties of soybeen. Special attention should be paid to lunasin - a peptide described for the first time 16 years ago. Due to its structure it causes i.a., inhibition of cancer cell proliferation. A novel procedure for the isolation and purification of low-molecular-mass 2S soybean albumin protein is described in the present paper. A fraction of four peptides one of them corresponding to molecular mass and isoelectric point characteristic for lunasin. The obtained peptides decreased on the rate of HeLa cell proliferation.

Effect of composition on electrical properties of lead-free Bi{sub 0.5}(Na{sub 0.80}K{sub 0.20}){sub 0.5}TiO{sub 3}-(Ba{sub 0.98}Nd{sub 0.02})TiO{sub 3} piezoelectric ceramics

Energy Technology Data Exchange (ETDEWEB)

Jaita, Pharatree [Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Watcharapasorn, Anucha; Jiansirisomboon, Sukanda [Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Materials Science Research Center, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand)

2013-07-14

Lead-free piezoelectric ceramics with the composition of (1-x)Bi{sub 0.5}(Na{sub 0.80}K{sub 0.20}){sub 0.5}TiO{sub 3}-x(Ba{sub 0.98}Nd{sub 0.02})TiO{sub 3} or (1-x) BNKT-xBNdT (with x = 0-0.20 mol fraction) have been synthesized by a conventional mixed-oxide method. The compositional dependence of phase structure and electrical properties of the ceramics were systemically studied. The optimum sintering temperature of all BNKT-BNdT ceramics was found to be 1125 Degree-Sign C. X-ray diffraction pattern suggested that BNdT effectively diffused into BNKT lattice during sintering to form a solid solution with a perovskite structure. Scanning electron micrographs showed a slight reduction of grain size when BNdT was added. It was found that BNKT-0.10BNdT ceramic exhibited optimum electrical properties ({epsilon}{sub r} = 1716, tan{delta} = 0.0701, T{sub c} = 327 Degree-Sign C, and d{sub 33} = 211 pC/N), suggesting that this composition has a potential to be one of a promising lead-free piezoelectric candidate for dielectric and piezoelectric applications.

Ozonolysis of α-pinene: parameterization of secondary organic aerosol mass fraction

Directory of Open Access Journals (Sweden)

R. K. Pathak

2007-07-01

Full Text Available Existing parameterizations tend to underpredict the α-pinene aerosol mass fraction (AMF or yield by a factor of 2–5 at low organic aerosol concentrations (<5 µg m⁻³. A wide range of smog chamber results obtained at various conditions (low/high NO<sub>x>, presence/absence of UV radiation, dry/humid conditions, and temperatures ranging from 15–40°C collected by various research teams during the last decade are used to derive new parameterizations of the SOA formation from α-pinene ozonolysis. Parameterizations are developed by fitting experimental data to a basis set of saturation concentrations (from 10⁻² to 10⁴ µg m⁻³ using an absorptive equilibrium partitioning model. Separate parameterizations for α-pinene SOA mass fractions are developed for: 1 Low NO<sub>x>, dark, and dry conditions, 2 Low NO<sub>x>, UV, and dry conditions, 3 Low NO<sub>x>, dark, and high RH conditions, 4 High NO<sub>x>, dark, and dry conditions, 5 High NO<sub>x>, UV, and dry conditions. According to the proposed parameterizations the α-pinene SOA mass fractions in an atmosphere with 5 µg m⁻³ of organic aerosol range from 0.032 to 0.1 for reacted α-pinene concentrations in the 1 ppt to 5 ppb range.

Bioactive protein fraction DLBS1033 containing lumbrokinase isolated from Lumbricus rubellus: ex vivo, in vivo, and pharmaceutic studies

Directory of Open Access Journals (Sweden)

Tjandrawinata RR

2014-09-01

Full Text Available Raymond R Tjandrawinata,1 Jessica Trisina,1 Puji Rahayu,1 Lorentius Agung Prasetya,1 Aang Hanafiah,2 Heni Rachmawati3 1Dexa Laboratories of Biomolecular Sciences, Dexa Medica, Cikarang, Indonesia; 2National Nuclear Energy Agency, Bandung, Indonesia; 3School of Pharmacy, Bandung Institute of Technology, Bandung, Indonesia Abstract: DLBS1033 is a bioactive protein fraction isolated from Lumbricus rubellus that tends to be unstable when exposed to the gastrointestinal environment. Accordingly, appropriate pharmaceutical development is needed to maximize absorption of the protein fraction in the gastrointestinal tract. In vitro, ex vivo, and in vivo stability assays were performed to study the stability of the bioactive protein fraction in gastric conditions. The bioactive protein fraction DLBS1033 was found to be unstable at low pH and in gastric fluid. The “enteric coating” formulation showed no leakage in gastric fluid–like medium and possessed a good release profile in simulated intestinal medium. DLBS1033 was absorbed through the small intestine in an intact protein form, confirmed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS PAGE analysis. This result confirmed that an enteric coating formula using methacrylic acid copolymer could protect DLBS1033 from the acidic condition of the stomach by preventing the release of DLBS1033 in the stomach, while promoting its release when reaching the intestine. From the blood concentration–versus-time curve, 99mTc-DLBS1033 showed a circulation half-life of 70 minutes. This relatively long biological half-life supports its function as a thrombolytic protein. Thus, an enteric delivery system is considered the best approach for DLBS1033 as an oral thrombolytic agent. Keywords: bioactive protein fraction, enteric coated tablet, pharmacodynamic

Role of Heparan Sulfate in Cellular Infection of Integrin-Binding Coxsackievirus A9 and Human Parechovirus 1 Isolates.

Directory of Open Access Journals (Sweden)

Pirjo Merilahti

Full Text Available Heparan sulfate/heparin class of proteoglycans (HSPG have been shown to function in cellular attachment and infection of numerous viruses including picornaviruses. Coxsackievirus A9 (CV-A9 and human parechovirus 1 (HPeV-1 are integrin-binding members in the family Picornaviridae. CV-A9 Griggs and HPeV-1 Harris (prototype strains have been reported not to bind to heparin, but it was recently shown that some CV-A9 isolates interact with heparin in vitro via VP1 protein with a specific T132R/K mutation. We found that the infectivity of both CV-A9 Griggs and HPeV-1 Harris was reduced by sodium chlorate and heparinase suggestive of HSPG interactions. We analyzed the T132 site in fifty-four (54 CV-A9 clinical isolates and found that only one of them possessed T132/R mutation while the other nine (9 had T132K. We then treated CV-A9 Griggs and HPeV-1 Harris and eight CV-A9 and six HPeV-1 clinical isolates with heparin and protamine. Although infectivity of Griggs strain was slightly reduced (by 25%, heparin treatment did not affect the infectivity of the CV-A9 isolates that do not possess the T132R/K mutation, which is in line with the previous findings. Some of the HPeV-1 isolates were also affected by heparin treatment, which suggested that there may be a specific heparin binding site in HPeV-1. In contrast, protamine (a specific inhibitor of heparin completely inhibited the infection of both prototypes and clinical CV-A9 and HPeV-1 isolates. We conclude that T132R/K mutation has a role in heparin binding of CV-A9, but we also show data, which suggest that there are other HSPG binding sites in CV-A9. In all, we suggest that HSPGs play a general role in both CV-A9 and HPeV-1 infections.

Study of the Rare Hadronic Decays D⁺<sub>s> → K⁺π⁰, D⁺<sub>s> → π⁺ K⁰<sub>s> and D⁺<sub>s> → π⁺ π⁰ at BaBar

Energy Technology Data Exchange (ETDEWEB)

Nikolich, Michael Borivoje [Imperial College, London (United Kingdom)

2007-02-01

Ds mesons are fully reconstructed from four final states using approximately 229fb^-1 of data delivered by the PEP-II e⁺e^- collider and collected by the BaBar experiment at the Stanford Linear Accelerator Centre during the period 1999 to 2004. Measurements of the exclusive branching fractions (average over charge-conjugate decays), B, of the decays D⁺<sub>s> → K⁺π⁰, D⁺<sub>s>→ π⁺K⁰ and D⁺<sub>s> → π⁺π⁰ relative to the reference mode D⁺<sub>s> → K⁺$\\bar{K}$⁰ are presented.

Fractionation of hydrogen isotopes by sulfate- and nitrate-reducing bacteria

OpenAIRE

Magdalena Rose Osburn; Katherine S Dawson; Marilyn L Fogel; Alex Sessions

2016-01-01

Hydrogen atoms from water and food are incorporated into biomass during cellular metabolism and biosynthesis, fractionating the isotopes of hydrogen –protium and deuterium –that are recorded in biomolecules. While these fractionations are often relatively constant in plants, large variations in the magnitude of fractionation are observed for many heterotrophic microbes utilizing different central metabolic pathways. The correlation between metabolism and lipid δ2H provides a potential basis f...

Chloroplast to chromoplast transition in tomato fruit: spectral confocal microscopy analyses of carotenoids and chlorophylls in isolated plastids and time-lapse recording on intact live tissue.

Science.gov (United States)

Egea, Isabel; Bian, Wanping; Barsan, Cristina; Jauneau, Alain; Pech, Jean-Claude; Latché, Alain; Li, Zhengguo; Chervin, Christian

2011-08-01

There are several studies suggesting that tomato (Solanum lycopersicum) chromoplasts arise from chloroplasts, but there is still no report showing the fluorescence of both chlorophylls and carotenoids in an intermediate plastid, and no video showing this transition phase. Pigment fluorescence within individual plastids, isolated from tomato fruit using sucrose gradients, was observed at different ripening stages, and an in situ real-time recording of pigment fluorescence was performed on live tomato fruit slices. At the mature green and red stages, homogenous fractions of chloroplasts and chromoplasts were obtained, respectively. At the breaker stage, spectral confocal microscopy showed that intermediate plastids contained both chlorophylls and carotenoids. Furthermore, an in situ real-time recording (a) showed that the chloroplast to chromoplast transition was synchronous for all plastids of a single cell; and (b) confirmed that all chromoplasts derived from pre-existing chloroplasts. These results give details of the early steps of tomato chromoplast biogenesis from chloroplasts, with the formation of intermediate plastids containing both carotenoids and chlorophylls. They provide information at the sub-cellular level on the synchronism of plastid transition and pigment changes.

Measurement of the Branching Fraction for B+- -> chic0 K+-

Energy Technology Data Exchange (ETDEWEB)

Aubert, B.

2003-10-07

We present a measurement of the branching fraction of the decay B{sup {+-}} {yields} {chi}{sub c0}K{sup {+-}} from a sample of 89 million B{bar B} pairs collected by the BABAR detector at the PEP-II asymmetric-energy B Factory at SLAC. The {chi}{sub c0} meson is reconstructed through its two-body decays to {pi}{sup +}{pi}{sup -} and K{sup +}K{sup -}. The authors measure {Beta}(B{sup {+-}} {yields} {chi}{sub c0}K{sup {+-}}) x {Beta}({chi}{sub c0} {yields} {pi}{sup +}{pi}{sup -}) = (1.32 {sub -0.27}{sup +0.28}(stat) {+-} 0.09(syst)) x 10{sup -6} and {Beta}(B{sup {+-}} {yields} {chi}{sub c0}K{sup {+-}}) x {Beta}({chi}{sub c0} {yields} K{sup +}K{sup -}) = (1.49{sub -0.34}{sup +0.36}(stat) {+-} 0.11(syst)) x 10{sup -6}. Using the known values for the {chi}{sub c0} decays branching fractions, they combine these results to obtain {Beta}(B{sup {+-}} {yields} {chi}{sub c0} K{sup {+-}}) = (2.7 {+-} 0.7) x 10{sup -4}.

Carbon isotope fractionation of 1,1,1-trichloroethane during base-catalyzed persulfate treatment

Energy Technology Data Exchange (ETDEWEB)

Marchesi, Massimo, E-mail: m2marche@uwaterloo.ca [Department of Civil and Environmental Engineering, University of Waterloo, Waterloo, Ontario, Canada N2L 3G1 (Canada); Department of Earth and Environmental Sciences, University of Waterloo, Waterloo, Ontario, Canada N2L 3G1 (Canada); Thomson, Neil R. [Department of Civil and Environmental Engineering, University of Waterloo, Waterloo, Ontario, Canada N2L 3G1 (Canada); Aravena, Ramon [Department of Earth and Environmental Sciences, University of Waterloo, Waterloo, Ontario, Canada N2L 3G1 (Canada); Sra, Kanwartej S. [Department of Civil and Environmental Engineering, University of Waterloo, Waterloo, Ontario, Canada N2L 3G1 (Canada); Golder Associates Inc, Toronto, Ontario, Canada L5N 5Z7 (Canada); Otero, Neus; Soler, Albert [Departament de Cristal.lographia, Mineralogia i Diposits Minerals, Facultat de Geologia, Universitat de Barcelona, Barcelona, Spain 08028 (Spain)

2013-09-15

Highlights: • Treatability and C fractionation of 1,1,1-TCA by base-catalyzed S{sub 2}O{sub 8}{sup 2−} was studied. • The rate of degradation of 1,1,1-TCA increased with a higher OH{sup −}:S{sub 2}O{sub 8}{sup 2−} ratio. •Base-catalyzed S{sub 2}O{sub 8}{sup 2−} can potentially treat recalcitrant compound like 1,1,1-TCA. • An enrichment factor of −7.0‰ independent of the OH{sup −}:S{sub 2}O{sub 8}{sup 2−} ratio was obtained. • Carbon isotope can potentially be used to estimate the ISCO treatment efficacy. -- Abstract: The extent of carbon isotope fractionation during degradation of 1,1,1-trichloroethane (1,1,1-TCA) by a base-catalyzed persulfate (S{sub 2}O{sub 8}{sup 2−}) treatment system was investigated. Significant destruction of 1,1,1-TCA was observed at a pH of ∼12. An increase in the NaOH:S{sub 2}O{sub 8}{sup 2−} molar ratio from 0.2:1 to 8:1 enhanced the reaction rate of 1,1,1-TCA by a factor of ∼5 to yield complete (>99.9%) destruction. An average carbon isotope enrichment fractionation factor which was independent of the NaOH:S{sub 2}O{sub 8}{sup 2−} molar ratio of −7.0 ± 0.2‰ was obtained. This significant carbon isotope fractionation and the lack of dependence on changes in the NaOH:S{sub 2}O{sub 8}{sup 2−} molar ratio demonstrates that carbon isotope analysis can potentially be used in situ as a performance assessment tool to estimate the degradation effectiveness of 1,1,1-TCA by a base-catalyzed persulfate system.

A feasibility study: Selection of a personalized radiotherapy fractionation schedule using spatiotemporal optimization

Energy Technology Data Exchange (ETDEWEB)

Kim, Minsun, E-mail: mk688@uw.edu; Stewart, Robert D. [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195-6043 (United States); Phillips, Mark H. [Departments of Radiation Oncology and Neurological Surgery, University of Washington, Seattle, Washington 98195-6043 (United States)

2015-11-15

Purpose: To investigate the impact of using spatiotemporal optimization, i.e., intensity-modulated spatial optimization followed by fractionation schedule optimization, to select the patient-specific fractionation schedule that maximizes the tumor biologically equivalent dose (BED) under dose constraints for multiple organs-at-risk (OARs). Methods: Spatiotemporal optimization was applied to a variety of lung tumors in a phantom geometry using a range of tumor sizes and locations. The optimal fractionation schedule for a patient using the linear-quadratic cell survival model depends on the tumor and OAR sensitivity to fraction size (α/β), the effective tumor doubling time (T{sub d}), and the size and location of tumor target relative to one or more OARs (dose distribution). The authors used a spatiotemporal optimization method to identify the optimal number of fractions N that maximizes the 3D tumor BED distribution for 16 lung phantom cases. The selection of the optimal fractionation schedule used equivalent (30-fraction) OAR constraints for the heart (D{sub mean} ≤ 45 Gy), lungs (D{sub mean} ≤ 20 Gy), cord (D{sub max} ≤ 45 Gy), esophagus (D{sub max} ≤ 63 Gy), and unspecified tissues (D{sub 05} ≤ 60 Gy). To assess plan quality, the authors compared the minimum, mean, maximum, and D{sub 95} of tumor BED, as well as the equivalent uniform dose (EUD) for optimized plans to conventional intensity-modulated radiation therapy plans prescribing 60 Gy in 30 fractions. A sensitivity analysis was performed to assess the effects of T{sub d} (3–100 days), tumor lag-time (T{sub k} = 0–10 days), and the size of tumors on optimal fractionation schedule. Results: Using an α/β ratio of 10 Gy, the average values of tumor max, min, mean BED, and D{sub 95} were up to 19%, 21%, 20%, and 19% larger than those from conventional prescription, depending on T{sub d} and T{sub k} used. Tumor EUD was up to 17% larger than the conventional prescription. For fast proliferating

Lipase genes in Mucor circinelloides: identification, sub-cellular location, phylogenetic analysis and expression profiling during growth and lipid accumulation.

Science.gov (United States)

Zan, Xinyi; Tang, Xin; Chu, Linfang; Zhao, Lina; Chen, Haiqin; Chen, Yong Q; Chen, Wei; Song, Yuanda

2016-10-01

Lipases or triacylglycerol hydrolases are widely spread in nature and are particularly common in the microbial world. The filamentous fungus Mucor circinelloides is a potential lipase producer, as it grows well in triacylglycerol-contained culture media. So far only one lipase from M. circinelloides has been characterized, while the majority of lipases remain unknown in this fungus. In the present study, 47 potential lipase genes in M. circinelloides WJ11 and 30 potential lipase genes in M. circinelloides CBS 277.49 were identified by extensive bioinformatics analysis. An overview of these lipases is presented, including several characteristics, sub-cellular location, phylogenetic analysis and expression profiling of the lipase genes during growth and lipid accumulation. All of these proteins contained the consensus sequence for a classical lipase (GXSXG motif) and were divided into four types including α/β-hydrolase_1, α/β-hydrolase_3, class_3 and GDSL lipase (GDSL) based on gene annotations. Phylogenetic analyses revealed that class_3 family and α/β-hydrolase_3 family were the conserved lipase family in M. circinelloides. Additionally, some lipases also contained a typical acyltransferase motif of H-(X) 4-D, and these lipases may play a dual role in lipid metabolism, catalyzing both lipid hydrolysis and transacylation reactions. The differential expression of all lipase genes were confirmed by quantitative real-time PCR, and the expression profiling were analyzed to predict the possible biological roles of these lipase genes in lipid metabolism in M. circinelloides. We preliminarily hypothesized that lipases may be involved in triacylglycerol degradation, phospholipid synthesis and beta-oxidation. Moreover, the results of sub-cellular localization, the presence of signal peptide and transcriptional analyses of lipase genes indicated that four lipase in WJ11 most likely belong to extracellular lipases with a signal peptide. These findings provide a platform

Production of Al-Ti-B grain refining master alloys from Na{sub 2}B{sub 4}O{sub 7} and K{sub 2}TiF{sub 6}

Energy Technology Data Exchange (ETDEWEB)

Birol, Yuecel [Materials Institute, Marmara Research Center, TUBITAK, Gebze, Kocaeli (Turkey)], E-mail: yucel.birol@mam.gov.tr

2008-06-30

It is very desirable to replace the KBF{sub 4} salt in the popular 'halide salt' process to reduce the volume of fluoride salts to be added to molten aluminium in the production of Al-Ti-B grain refiners. Being over 2 times richer in B, Na{sub 2}B{sub 4}O{sub 7} is a promising replacement for KBF{sub 4}, and is used in the present work to produce Al-Ti-B grain refiner master alloys. A fraction of the aluminide particles were entrapped in the spent salt giving a relatively lower Ti recovery when KBF{sub 4} was replaced by Na{sub 2}B{sub 4}O{sub 7}. The grain refining performance of the Al-Ti-B grain refiner alloy thus produced was nevertheless acceptable. The spent salt became too viscous with the oxides, aluminides and borides to be removed by decanting when Na{sub 2}B{sub 4}O{sub 7}.5H{sub 2}O was used to supply boron. The viscous spent salt, entrained in the grain refiner alloy, did not only impair its performance, but also hurt the fluidity of the molten alloy and made pouring difficult.

Therapeutic mechanism of treating SMMC-7721 liver cancer cells with magnetic fluid hyperthermia using Fe{sub 2}O{sub 3} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Yan, S.Y.; Chen, M.M.; Fan, J.G.; Wang, Y.Q.; Hu, Y.; Xu, L.M., E-mail: leiming.xu@aliyun.com.cn, E-mail: huying@sohu.com [Department of Gastroenterology, Xinhua Hospital, Shanghai Jiaotong University School of Medicine, Shanghai (China); Du, Y.Q. [Department of Pathology, Cancer Hospital, Fudan University, Shanghai (China)

2014-11-15

This study aimed to investigate the therapeutic mechanism of treating SMMC-7721 liver cancer cells with magnetic fluid hyperthermia (MFH) using Fe{sub 2}O{sub 3} nanoparticles. Hepatocarcinoma SMMC-7721 cells cultured in vitro were treated with ferrofluid containing Fe{sub 2}O{sub 3} nanoparticles and irradiated with an alternating radio frequency magnetic field. The influence of the treatment on the cells was examined by inverted microscopy, MTT and flow cytometry. To study the therapeutic mechanism of the Fe{sub 2}O{sub 3} MFH, Hsp70, Bax, Bcl-2 and p53 were detected by immunocytochemistry and reverse transcription polymerase chain reaction (RT-PCR). It was shown that Fe{sub 2}O{sub 3} MFH could cause cellular necrosis, induce cellular apoptosis, and significantly inhibit cellular growth, all of which appeared to be dependent on the concentration of the Fe{sub 2}O{sub 3} nanoparticles. Immunocytochemistry results showed that MFH could induce high expression of Hsp70 and Bax, decrease the expression of mutant p53, and had little effect on Bcl-2. RT-PCR indicated that Hsp70 expression was high in the early stage of MFH (,24 h) and became low or absent after 24 h of MFH treatment. It can be concluded that Fe{sub 2}O{sub 3} MFH significantly inhibited the proliferation of in vitro cultured liver cancer cells (SMMC-7721), induced cell apoptosis and arrested the cell cycle at the G2/M phase. Fe{sub 2}O{sub 3} MFH can induce high Hsp70 expression at an early stage, enhance the expression of Bax, and decrease the expression of mutant p53, which promotes the apoptosis of tumor cells. (author)

Production of the excited charm mesons D{sub 1} and D{sup *}{sub 2} at HERA

Energy Technology Data Exchange (ETDEWEB)

Abramowicz, H. [Tel Aviv Univ. (Israel). School of Physics; Max Planck Institute for Physics, Munich (Germany); Abt, I. [Max Planck Institute for Physics, Munich (Germany); Adamczyk, L. [AGH-Univ. of Science and Technology, Krakow (Poland). Faculty of Physics and Applied Computer Science] [and others; Collaboration: ZEUS Collaboration

2012-08-15

The production of the excited charm mesons D{sub 1}(2420) and D{sup *}{sub 2}(2460) in ep collisions has been measured with the ZEUS detector at HERA using an integrated luminosity of 373 pb{sup -1}. The masses of the neutral and charged states, the widths of the neutral states, and the helicity parameter of D{sub 1}(2420){sup 0} were determined and compared with other measurements and with theoretical expectations. The measured helicity parameter of the D{sup 0}{sub 1} allows for some mixing of S- and D-waves in its decay to D{sup *{+-}}{pi}{sup -+}. The result is also consistent with a pure D-wave decay. Ratios of branching fractions of the two decay modes of the D{sup *}{sub 2}(2460){sup 0} and D{sup *}{sub 2}(2460){sup {+-}} states were measured and compared with previous measurements. The fractions of charm quarks hadronising into D{sub 1} and D{sup *}{sub 2} were measured and are consistent with those obtained in e{sup +}e{sup -} annihilations.

Estimation's Role in Calculations with Fractions

Science.gov (United States)

Johanning, Debra I.

2011-01-01

Estimation is more than a skill or an isolated topic. It is a thinking tool that needs to be emphasized during instruction so that students will learn to develop algorithmic procedures and meaning for fraction operations. For students to realize when fractions should be added, subtracted, multiplied, or divided, they need to develop a sense of…

Structure of two-phase air-water flows. Study of average void fraction and flow patterns; Structure des ecoulements diphasiques eau-air. Etude de la fraction de vide moyenne et des configurations d'ecoulement

Energy Technology Data Exchange (ETDEWEB)

Roumy, R [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

1969-07-01

This report deals with experimental work on a two phase air-water mixture in vertical tubes of different diameters. The average void fraction was measured in a 2 metre long test section by means of quick-closing valves. Using resistive probes and photographic techniques, we have determined the flow patterns and developed diagrams to indicate the boundaries between the various patterns: independent bubbles, agglomerated bubbles, slugs, semi-annular, annular. In the case of bubble flow and slug flow, it is shown that the relationship between the average void fraction and the superficial velocities of the phases is given by: V{sub sg} = f(<{alpha}>) * g(V{sub sl}). The function g(V{sub sl}) for the case of independent bubbles has been found to be: g(V{sub sl}) = V{sub sl} + 20. For semi-annular and annular flow conditions; it appears that the average void fraction depends, to a first approximation only on the ratio V{sub sg}/V{sub sl}. (author) [French] Ce rapport est une etude experimentale d'un melange diphasique eau-air dans des tubes verticaux de differents diametres. Nous avons mesure la fraction de vide moyenne dans une portion de canal de longueur 2 m, au moyen d'un systeme de vannes a fermeture rapide et simultanee. Au moyen de sondes resistives et de photographies nous avons determine la configuration de l'ecoulement et trace des cartes donnant les frontieres entre les differentes configurations d'ecoulement: bulles independantes, bulles agglomerees, bouchons, semi-annulaire, annulaire. Nous montrons que pour les regimes a bulles et a bouchons, une equation de la forme V{sub sg} = f(<{alpha}>) * g(V{sub sl}) relie la fraction de vide moyenne aux vitesses superficielles de chacune des phases. Nous avons pu determiner la fonction g(V{sub sl}) dans le cas du regime a bulles independantes, et nous trouvons g(V{sub sl}) = V{sub sl} + 20. Pour les regimes semi-annulaire et annulaire, il semble qu'en premiere approximation, la fraction de vide moyenne ne depende que

Analysis of Equivalent Circuits for Cells: A Fractional Calculus Approach

Directory of Open Access Journals (Sweden)

Bernal-Alvarado J.

2012-07-01

Full Text Available Fractional order systems are considered by many mathematicians the systems of the XXI century. The reason is that nature has proved to be best described in terms of systems composed of fractional order derivatives. This emerging area of research is slowly gaining more strength in engineering, biochemistry, medicine, biophysics, among others. This paper presents an analysis in the frequency domain equivalent of cellular systems described by equations of integer and fractional order; it also carries out an analysis in time domain in order to display the memory capacity of fractional systems. It presents the fractional differential equations equivalent models and simulations comparing integer and fractional order.

Sugar supported H/sub 2/ production and C/sub 2/H/sub 2/ reduction by the cyanobiont Anabaena azollae

Energy Technology Data Exchange (ETDEWEB)

Rozen, A.; Tel-Or, E.

1986-01-01

Sugar supported activities of H/sub 2/ production and C/sub 2/H/sub 2/ reduction were characterized in axenic cell cultures of the cyanobiont Anabaena azollae isolated from the water fern Azolla filiculoides. Fructose was found to be the favoured substrate, enhancing activities in both the light and the dark even at relatively low concentrations of 0.5-1.0 mM. Higher concentrations of sucrose, (10-20mM) also supported H/sub 2/ production and C/sub 2/H/sub 2/ reduction, while glucose was less effective. Levels of H/sub 2/ production were always lower than those of C/sub 2/H/sub 2/ reduction. 13 references.

Small-scale isolation of meiocytes from arabidopsis thaliana anthers for cytological analysis

International Nuclear Information System (INIS)

Yuan, J.; Zhang, S.; Wang, J.; Li, N.; Li, M.

2016-01-01

In flowering plants, the meiocytes develop within nourishing tissues the anthers or the ovaries. Although most plants bear one or more anthers in each bisexual or male flower, the size of anthers that undergo meiosis is relatively small, and each anther contains only a small fraction of male meiocytes. As a consequence, the isolation of plant meiocytes is very challenging due to their relative inaccessibility. Efficient manual dissection of meiocytes from young Arabidopsis anthers for cytological and cytogenetic analyses is technically challenging. Indirect detection of cellular or nuclear phenotypes is impaired by poor penetration of the reagents, and cell type-specific imaging is deminished by the lack of clarity in whole-mount tissues. Here, we describe a method that allows the efficient isolation of male meiocytes of Arabidopsis. Anthers undergoing meiosis were dissected and collected into appropriate isolation/labeling buffer, depending on the downstream application. Meiocytes were released by crushing with a cover slip on a glass slide. The isolated meiocytes could be analyzed using a microscope. The technical skills required are simple, and the procedure does not require any special equipment. Isolated meiocytes are suitable for a variety of dowstream applications, such as cell morphological investigation, reporter gene assays, chromosome analyses, and callose staining. (author)

Awakened by cellular stress: isolation and characterization of a novel population of pluripotent stem cells derived from human adipose tissue.

Directory of Open Access Journals (Sweden)

Saleh Heneidi

Full Text Available Advances in stem cell therapy face major clinical limitations, particularly challenged by low rates of post-transplant cell survival. Hostile host factors of the engraftment microenvironment such as hypoxia, nutrition deprivation, pro-inflammatory cytokines, and reactive oxygen species can each contribute to unwanted differentiation or apoptosis. In this report, we describe the isolation and characterization of a new population of adipose tissue (AT derived pluripotent stem cells, termed Multilineage Differentiating Stress-Enduring (Muse Cells, which are isolated using severe cellular stress conditions, including long-term exposure to the proteolytic enzyme collagenase, serum deprivation, low temperatures and hypoxia. Under these conditions, a highly purified population of Muse-AT cells is isolated without the utilization of cell sorting methods. Muse-AT cells grow in suspension as cell spheres reminiscent of embryonic stem cell clusters. Muse-AT cells are positive for the pluripotency markers SSEA3, TR-1-60, Oct3/4, Nanog and Sox2, and can spontaneously differentiate into mesenchymal, endodermal and ectodermal cell lineages with an efficiency of 23%, 20% and 22%, respectively. When using specific differentiation media, differentiation efficiency is greatly enhanced in Muse-AT cells (82% for mesenchymal, 75% for endodermal and 78% for ectodermal. When compared to adipose stem cells (ASCs, microarray data indicate a substantial up-regulation of Sox2, Oct3/4, and Rex1. Muse-ATs also exhibit gene expression patterns associated with the down-regulation of genes involved in cell death and survival, embryonic development, DNA replication and repair, cell cycle and potential factors related to oncogenecity. Gene expression analysis indicates that Muse-ATs and ASCs are mesenchymal in origin; however, Muse-ATs also express numerous lymphocytic and hematopoietic genes, such as CCR1 and CXCL2, encoding chemokine receptors and ligands involved in stem cell

Measurement of |V sub c sub b | using (bar B) sup 0 -> D* sup + (ell) sup - (bar nu) sub e sub l sub l Decays

CERN Document Server

Della Ricca, G

2003-01-01

A preliminary measurement of |V sub c sub b | and the branching fraction BETA((bar B) sup 0 -> D* sup + (ell) sup - (bar nu) sub e sub l sub l) has been performed based on a sample of about 55,700 (bar B) sup 0 -> D* sup + (ell) sup - (bar nu) sub e sub l sub l decays recorded with the BABAR detector. The decays are identified in the D* sup + -> D sup 0 pi sup + final state, with the D sup 0 reconstructed in three different decay modes. The differential decay rate is measured as a function of the relativistic boost of the D* sup + in the (bar B) sup 0 rest frame. The value of the differential decay rate at ''zero recoil'', namely the point at which the D* sup + is at rest in the (bar B) sup 0 frame, is predicted in Heavy Quark Effective Theory as a kinematic factor times F(1)|V sub c sub b |, where F is the unique form factor governing the decay. We extrapolate the measured differential decay rate to the zero recoil point and obtain F(1)|V sub c sub b | = (34.03 +- 0.24 +- 1.31) x 10 sup - sup 3. Using a theo...

Mechanical properties of Bi,Pb(2223) single filaments and I sub c (epsilon) behaviour in longitudinally strained tapes

CERN Document Server

Passerini, R; Seeber, B; Flükiger, R

2002-01-01

The Young's modulus and fracture stress of isolated Bi,Pb(2223) filaments were deduced from three-point bending tests performed at different stages of the tapes preparation. These results were introduced in the model describing the evolution of critical current of tapes submitted to a longitudinal strain in view to predict their irreversible strain limit epsilon sub i sub r sub r. These calculated irreversible strain limits were compared to measured values, taken from a set of tapes made with different filling factors and composite matrices. This experiment shows that the predicted irreversible strain limits correspond to the measured ones. Presenting the I sub c behaviour of highly stressed tapes in a magnetic field, we discuss the evolution of the ratio I sup s sup t sup r sup o sup n sup g sub c sub 0 /I sub c sub 0 versus strain. This value, representative of the fraction of the critical current attributed to strongly connected grains, increases significantly during the crack formation regime at epsilon >...

Angular analysis and differential branching fraction of the decay B{sub s}{sup 0}→ϕμ{sup +}μ{sup −}

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Collaboration: The LHCb collaboration; and others

2015-09-25

An angular analysis and a measurement of the differential branching fraction of the decay B{sub s}{sup 0}→ϕμ{sup +}μ{sup −} are presented, using data corresponding to an integrated luminosity of 3.0 fb{sup −1} of pp collisions recorded by the LHCb experiment at √s=7 and 8 TeV. Measurements are reported as a function of q{sup 2}, the square of the dimuon invariant mass and results of the angular analysis are found to be consistent with the Standard Model. In the range 1fraction is found to be more than 3 σ below the Standard Model predictions.

Antinoceptive and Anti-inflammatory Activities of the Ethanolic Extract, Fractions and Flavones Isolated from Mimosa tenuiflora (Willd. Poir (Leguminosae.

Directory of Open Access Journals (Sweden)

Mariluze P Cruz

Full Text Available The bark of Mimosa tenuiflora (Willd. Poiret (Leguminosae family, popularly known as "jurema preta" in Brazil, is used by the population of Contendas of Sincorá (Bahia State, Brazil for the treatment of coughs and wound healing. Thus, the aim of this study was to evaluate the antinociceptive and anti-inflammatory activities of the bark ethanol extract (EEMT and solvent soluble fractions (hexane-H, DCM-D, EtOAc-E and BuOH-B of the extract in vivo. Additionally, we synthesized 5,7-dihidroxy-4'-methoxyflavanone (isosakuranetin and isolated the compound sakuranetin, and both compounds were also tested. The anti-inflammatory and antinociceptive assays performed were: writhing test; nociception induced by intraplantar formalin injection; leukocyte recruitment to the peritoneal cavity; evaluation of vascular permeability (Evans blue test; and evaluation of mechanical hypernociception (von Frey test. Production of TNF-α, IL-10, myeloperoxidase and the expression of ICAM-1 were also evaluated. Statistical analysis was performed by one-way ANOVA followed by the Bonferroni post-test (n = 8, with P < 0.05. The EEMT showed antinociceptive activities in writhing test (100-200 mg/kg, in the second phase of the formalin test (50-200 mg/kg, and in mechanical hypernociception (100 mg/kg. EEMT showed an anti-inflammatory effect by reducing neutrophil migration to the peritoneal cavity and in the plantar tissue detected by the reduction of myeloperoxidase activity (100 mg/kg, reduction of IL-10 levels and expression of ICAM-1 in the peritoneal exudate and the mesentery (100 mg/kg, respectively. The four soluble EEMT fractions showed good results in tests for antinociceptive (H, D, E, B and anti-inflammation (H, D, E. Only sakuranetin showed reduction of the writhing and neutrophil migration (200 mg/kg. Thus, the EEMT and soluble fractions of M. tenuiflora bark demonstrated great antinociceptive and anti-inflammatory activities, as also sakuranetin. More studies

Microstructure and properties of in-situ rf sputtered YBa{sub 2}Cu{sub 3}O{sub 7} thin films for microwave applications

Energy Technology Data Exchange (ETDEWEB)

Reagor, D.W.; Houlton, R.J.; Garzon, F.H.; Hawley, M.; Raistrick, I.D. [Los Alamos National Lab., NM (United States); Piza, M.E. [Massachusetts Inst. of Tech., Cambridge, MA (United States). Dept. of Materials Science

1992-06-01

The residual surface resistance of a number of films of YBa{sub 2}Cu{sub 3}O{sub 7}, prepared by off-axis sputtering onto MgO substrates, has been measured using parallel-plate resonator technique. Deposition conditions were kept constant, apart from the substrate temperature. There is no correlation between surface resistance and other important microscopic parameters, such as T{sub c} and c-axis lattice parameter. There is, however, a trend to higher R{sub s} with increasing volume fraction of in-plane misoriented material, although the correlation is not perfect. Furthermore, we have found that most of the misoriented material is localized at the film substrate interface and therefore is probably not responsible for most of the RF losses. The data suggest that at higher deposition temperatures, there is an increasing tendency for 45{degrees}-misoriented material to appear in the films, and it may be that a significant fraction of this material is present closer to the free film surface. STM qualitatively supports this conclusion.

Microstructure and properties of in-situ rf sputtered YBa sub 2 Cu sub 3 O sub 7 thin films for microwave applications

Energy Technology Data Exchange (ETDEWEB)

Reagor, D.W.; Houlton, R.J.; Garzon, F.H.; Hawley, M.; Raistrick, I.D. (Los Alamos National Lab., NM (United States)); Piza, M.E. (Massachusetts Inst. of Tech., Cambridge, MA (United States). Dept. of Materials Science)

1992-01-01

The residual surface resistance of a number of films of YBa{sub 2}Cu{sub 3}O{sub 7}, prepared by off-axis sputtering onto MgO substrates, has been measured using parallel-plate resonator technique. Deposition conditions were kept constant, apart from the substrate temperature. There is no correlation between surface resistance and other important microscopic parameters, such as T{sub c} and c-axis lattice parameter. There is, however, a trend to higher R{sub s} with increasing volume fraction of in-plane misoriented material, although the correlation is not perfect. Furthermore, we have found that most of the misoriented material is localized at the film substrate interface and therefore is probably not responsible for most of the RF losses. The data suggest that at higher deposition temperatures, there is an increasing tendency for 45{degrees}-misoriented material to appear in the films, and it may be that a significant fraction of this material is present closer to the free film surface. STM qualitatively supports this conclusion.

Isolation of imidacloprid degrading bacteria from industrial sites

International Nuclear Information System (INIS)

Shahid, M.N.; Jabeen, F.

2009-01-01

Immidacloprid is a cyclodiene organochlorine used as an insecticide all over the world and possessing a serous environmental threat. It is mostly used for cotton insects (bollworm, aphid and white fly). For isolation of imidacloprid degrading bacteria, two soil samples were collected from industrial contaminated sites of Kala Shah Kahu district sheikupura, having ten year history of use. Soil samples were analyzed by measuring pH and electric conductivity. The isolation of imidacroprid degrading bacteria was performed by enrichment technique. Eight bacterial strains, S/sub 1-a/ S/2-2-b/ S/2-c/ S/2-d/ S/2-e/ S/sub 2-f/ and S/sub 2-g/ and S/sub e-a/ were isolated on the basis of their colony morphologies. The purified colonies were characterized morphologically, physiologically and biochemically. Gram staining was done and Gram negative strain were confirmed on MacConkey agar and Eosin Methylene Blue. Bacterial strains were also checked for different minimal media in which only carbon source was the imidcloprid. For this purpose. FTW, FTW without N/sub 2/ NSM, M/sub 9/ and MM/sub 2/ media were used and their optical densities were taken on spectrophotometer isolates were checked for resistance to antibiotics and heavy metals. On these characteristics, S/sub 2-d/ and S/sub c-a/ were assigned to Enterobacteriaceae, S/sub 2-b/ to Pseudomonad and rest of the bacterial isolates were affiliated to bacillaceae. (author)

Development of Pb-rich (Bi, Pb) sub 3 Sr sub 2 Ca sub 2 Cu sub 1 O sub x phase during reformation of lead doped 2223 superconducting phase from melt quenched glass. [BiPbSrCaCuO

Energy Technology Data Exchange (ETDEWEB)

Oezkan, N; Glowacki, B A [IRC in Superconductivity, Univ. of Cambridge (United Kingdom)

1992-05-01

The reformation process of the lead doped superconducting 2223 phase from the melt quenched glass was investigated. It was shown that during the crystallisation of the glass a new lead rich phase, Bi{sub 0.5}Pb{sub 3}Sr{sub 2}Ca{sub 2}Cu{sub 1}O{sub x}, was formed and severe copper segregation was observed. The volume fraction of the high Tc 2223 phase increased with annealing time for an annealing temperature of 840degC. A glass sample annealed at 840degC for 150 h showed two superconducting transitions Tc = 107 K and Tc = 70 K. (orig.).

Sub-typing of extended-spectrum-β-lactamase-producing isolates from a nosocomial outbreak: application of a 10-loci generic Escherichia coli multi-locus variable number tandem repeat analysis.

Directory of Open Access Journals (Sweden)

Nahid Karami

Full Text Available Extended-spectrum β-lactamase producing Escherichia coli (ESBL-E. coli were isolated from infants hospitalized in a neonatal, post-surgery ward during a four-month-long nosocomial outbreak and six-month follow-up period. A multi-locus variable number tandem repeat analysis (MLVA, using 10 loci (GECM-10, for 'generic' (i.e., non-STEC E. coli was applied for sub-species-level (i.e., sub-typing delineation and characterization of the bacterial isolates. Ten distinct GECM-10 types were detected among 50 isolates, correlating with the types defined by pulsed-field gel electrophoresis (PFGE, which is recognized to be the 'gold-standard' method for clinical epidemiological analyses. Multi-locus sequence typing (MLST, multiplex PCR genotyping of bla CTX-M, bla TEM, bla OXA and bla SHV genes and antibiotic resistance profiling, as well as a PCR assay specific for detecting isolates of the pandemic O25b-ST131 strain, further characterized the outbreak isolates. Two clusters of isolates with distinct GECM-10 types (G06-04 and G07-02, corresponding to two major PFGE types and the MLST-based sequence types (STs 131 and 1444, respectively, were confirmed to be responsible for the outbreak. The application of GECM-10 sub-typing provided reliable, rapid and cost-effective epidemiological characterizations of the ESBL-producing isolates from a nosocomial outbreak that correlated with and may be used to replace the laborious PFGE protocol for analyzing generic E. coli.

Detection of Maillard reaction products by a coupled HPLC-Fraction collector technique and FTIR characterization of Cu(II)-complexation with the isolated species

Science.gov (United States)

Ioannou, Aristos; Daskalakis, Vangelis; Varotsis, Constantinos

2017-08-01

The isolation of reaction products of asparagine with reducing sugars at alkaline pH and high temperature has been probed by a combination of high performance liquid chromatography (HPLC) coupled with a Fraction Collector. The UV-vis and FTIR spectra of the isolated Maillard reaction products showed structure-sensitive changes as depicted by deamination events and formation of asparagine-saccharide conjugates. The initial reaction species of the Asn-Gluc reaction were also characterized by Density Functional Theory (DFT) methods. Evidence for Cu (II) metal ion complexation with the Maillard reaction products is supported by UV-vis and FTIR spectroscopy.

A novel organic–inorganic hybrid with Anderson type polyanions as building blocks: (C{sub 6}H{sub 10}N{sub 3}O{sub 2}){sub 2}Na(H{sub 2}O){sub 2}[Al(OH){sub 6}Mo{sub 6}O{sub 18}]·6H{sub 2}O

Energy Technology Data Exchange (ETDEWEB)

Thabet, Safa, E-mail: safathabet@hotmail.fr [Laboratoire de matériaux et cristallochimie, Département de chimie, Institut Supérieur des Sciences Appliquées et Technologier, Avenue El Mourouj, 5111 Mahdia (Tunisia); Ayed, Brahim, E-mail: brahimayed@yahoo.fr [Laboratoire de matériaux et cristallochimie, Département de chimie, Institut Supérieur des Sciences Appliquées et Technologier, Avenue El Mourouj, 5111 Mahdia (Tunisia); Haddad, Amor [Laboratoire de matériaux et cristallochimie, Département de chimie, Institut Supérieur des Sciences Appliquées et Technologier, Avenue El Mourouj, 5111 Mahdia (Tunisia)

2012-11-15

Graphical abstract: Display Omitted Highlights: ► Synthesis of a novel inorganic–organic hybrid compound based on Anderson polyoxomolybdates. ► Characterization by X-ray diffraction, IR and UV–Vis spectroscopies of the new compound. ► Potential applications in catalysis, biochemical analysis and electrical conductivity of the organic–inorganic compound. -- Abstract: A new organic–inorganic hybrid compound based on Anderson polyoxomolybdates, (C{sub 6}H{sub 10}N{sub 3}O{sub 2}){sub 2}Na(H{sub 2}O){sub 2}[Al(OH){sub 6}Mo{sub 6}O{sub 18}]·6H{sub 2}O (1) have been isolated by the conventional solution method and characterized by single-crystal X-ray diffraction, infrared, ultraviolet spectroscopy and Thermogravimetric Analysis (TGA). This compound crystallized in the triclinic system, space group P−1, with a = 94.635(1) Å, b = 10.958(1) Å, c = 11.602(1) Å, α = 67.525(1)°, β = 71.049(1)°, γ = 70.124(1)° and Z = 1. The crystal structures of the compounds exhibit three-dimensional supramolecular assembly based on the extensive hydrogen bonding interactions between organic cations, sodium cations, water molecules and Anderson polyoxoanions. The infrared spectrum fully confirms the X-ray crystal structure and the UV spectrum of the title compound exhibits an absorption peak at 210 nm.

Interactions among different fractions in the thermoplastic state of Goonyella coking coal

Energy Technology Data Exchange (ETDEWEB)

Takahiro Yoshida; Toshimasa Takanohashi; Masashi Iino; Haruo Kumagai; Kenji Kato [National Institute of Advanced Industrial Science and Technology, Tsukuba (Japan)

2004-04-01

Goonyella coking-coal was extracted with a 1:1 (v/v) carbon disulfide/N-methyl-2-pyrrolidinone (CS{sub 2}/NMP) mixed solvent and then fractionated into four with pyridine and chloroform. High-temperature {sup 1}H NMR analysis conducted on each fraction and their mixtures in-situ showed that the lightest, the chloroform-soluble fraction (CS), was rich in mobile hydrogen, H{sub m}, the variation of which with temperature corresponded to that of a thermoplastic parameter tan {delta} determined by in-situ viscoelastic measurement. In contrast, chloroform-insoluble and pyridine-soluble (CIPS) and pyridine-insoluble (PIMS) fractions showed scant change in H{sub m} with temperature, although the intermediate hydrogen, H{sub int}, increased upon heating. These results allow the different fractions to be characterized qualitatively on the basis of differences in hydrogen mobility. In mixtures of the continuous fractions, positive interactions occurred that enhanced the value of tan {delta} as well as the overall hydrogen mobility. A single maximum was observed in the tan {delta} response of these mixtures, which indicated that the heavier fractions were solvated through the action of the lighter ones. In a discontinuous mixture of the fractions, molecular interaction was slight compared to continuous mixtures; only the light fraction started to soften at low temperature and, as a result, a bimodal response occurred in tan {delta}. The thermoplastic response of coking coal can be modeled on a self-dissolution basis involving the {approximately}50% of solvent-soluble components that are present in whole coking coals and which possess a continuous fraction distribution from light to heavy. The mobility of the system develops continuously upon heating as a result of the progressive solvating action of the lighter components facilitating dissolution and/or dispersion of the heavier components. 25 refs., 7 figs., 2 tabs.

Observation of B{sub s}{sup 0}→χ{sub c1}ϕ decay and study of B{sup 0}→χ{sub c1,2}K{sup ⁎0} decays

Energy Technology Data Exchange (ETDEWEB)

Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Université, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andrews, J.E. [University of Maryland, College Park, MD (United States); and others

2013-09-21

The first observation of the decay B{sub s}{sup 0}→χ{sub c1}ϕ and a study of B{sup 0}→χ{sub c1,2}K{sup ⁎0} decays are presented. The analysis is performed using a dataset, corresponding to an integrated luminosity of 1.0 fb{sup −1}, collected by the LHCb experiment in pp collisions at a centre-of-mass energy of 7 TeV. The following ratios of branching fractions are measured: (table) where the third uncertainty is due to the limited knowledge of the branching fractions of χ{sub c}→J/ψγ modes.

Purification of lysosomal phospholipase A and demonstration of proteins that inhibit phospholipase A in a lysosomal fraction from rat kidney cortex

Energy Technology Data Exchange (ETDEWEB)

Hostetler, K.Y.; Gardner, M.F.; Giordano, J.R.

1986-10-21

Phospholipase A has been isolated from a crude lysosomal fraction from rat kidney cortex and purified 7600-fold with a recovery of 9.8% of the starting activity. The purified enzyme is a glycoprotein having an isoelectric point of pH 5.4 and an apparent molecular weight of 30,000 by high-pressure liquid chromatography gel permeation. Naturally occurring inhibitors of lysosomal phospholipase A are present in two of the lysosomal-soluble protein fractions obtained in the purification. They inhibit hydrolysis of 1,2-di(1-/sup 14/C)oleoylphosphatidylcholine by purified phospholipase A/sub 1/ with IC/sub 50/ values of 7-11 ..mu..g. The inhibition is abolished by preincubation with trypsin at 37/sup 0/C, but preincubation with trypsin at 4/sup 0/C has no effect, providing evidence that the inhibitors are proteins. The results suggest that the activity of lysosomal phospholipase A may be regulated in part by inhibitory proteins. Lysosomal phospholipase A from rat kidney hydrolyzes the sn-1 acyl group of phosphatidylcholine, does not require divalent cations for full activity, and is not inhibited by ethylenediaminetetraacetic acid. It has an acid pH optimum of 3.6-3.8. Neither rho-bromophenacyl bromide, diisopropyl fluorophosphate, nor mercuric ion inhibits phospholipase A/sub 1/. In contrast to rat liver, which has two major isoenzymes of acid phospholipase A/sub 1/, kidney cortex has only one isoenzyme of lysosomal phospholipase A/sub 1/.

Measurement of charm fragmentation fractions in photoproduction at HERA

Energy Technology Data Exchange (ETDEWEB)

Abramowicz, H. [Tel Aviv Univ. (Israel). School of Physics; Max-Planck-Institute for Physics, Munich (Germany); Abt, I. [Max-Planck-Institute for Physics, Muinch (Germany); Adamczyk, L. [AGH-Univ. of Science and Technology, Krakow (Poland). Faculty of Physics and Applied Computer Science] [and others; Collaboration: ZEUS Collaboration

2013-06-15

The production of D{sup 0}, D{sup *+}, D{sup +}, D{sub s}{sup +} and {Lambda}{sub c}{sup +} charm hadrons and their antiparticles in ep scattering at HERA has been studied with the ZEUS detector, using a total integrated luminosity of 372 pb{sup -1}. The fractions of charm quarks hadronising into a particular charm hadron were derived. In addition, the ratio of neutral to charged D-meson production rates, the fraction of charged D mesons produced in a vector state, and the strangeness-suppression factor have been determined. The measurements have been performed in the photoproduction regime. The charm hadrons were reconstructed in the range of transverse momentum p{sub T} > 3.8GeV and pseudorapidity vertical stroke {eta} vertical stroke <1.6. The charm fragmentation fractions are compared to previous results from HERA and from e{sup +}e{sup -} experiments. The data support the hypothesis that fragmentation is independent of the production process.

Fractional Josephson vortices: oscillating macroscopic spins

Energy Technology Data Exchange (ETDEWEB)

Gaber, T.; Buckenmaier, K.; Koelle, D.; Kleiner, R.; Goldobin, E. [Universitaet Tuebingen, Physikalisches Institut - Experimentalphysik II, Tuebingen (Germany)

2007-11-15

Fractional Josephson vortices carry a magnetic flux {phi}, which is a fraction of the magnetic flux quantum {phi}{sub 0}{approx}2.07 x 10{sup -15} Wb. We consider a fractional vortex which spontaneously appears at a phase discontinuity. Its properties are very different from the properties of the usual integer fluxon. In particular, a fractional vortex is pinned and may have one of two possible polarities - just like a usual spin 1/2 particle. The fractional vortex may also oscillate around its equilibrium position with an eigenfrequency which is expected to be within the Josephson plasma gap. Using microwave spectroscopy, we investigate the dependence of the eigenfrequency of a fractional Josephson vortex on its magnetic flux {phi} and on the bias current. The experimental results are in good agreement with theoretical predictions. Positive result of this experiment is a cornerstone for further investigation of more complex fractional vortex systems such as fractional vortex molecules and tunable bandgap materials. (orig.)

The study of the deuterium isotopic fractionation through the cell membrane of the plant

International Nuclear Information System (INIS)

Berdea, P.; Cuna, Stela; Deliu, C.

2002-01-01

The purpose of this study is to prove that there is a water deuterium isotope fractionation when the water passes through the cell membrane. The carrots (Daucus carota) were grown in vitro in a Murashige and Skoog mineral-salt medium and have been exposed to a water solution with a uniform isotopic content. After seven days the cell culture was filtered and the cell water was vacuum extracted. The water from aqueous solution and the cell water were analyzed for hydrogen by isotope ratio mass spectrometry. The procedure was repeated for 14 and 21 day old cell cultures. The measurements have revealed a water deuterium isotopic fractionation between extra-cellular water and cellular water. The deuterium content was found to be higher within the cells by 10 o / oo for non-embryonic cells and 13 o / oo for the embryonic cells. This fractionation is a non-evaporative fractionation between intracellular and extra-cellular water and it represents a new step in the overall fractionation of deuterium water in the plants. The existence of such isotopic fractionation through the cell membrane implies that the relationship between the deuterium content of cellulose nitrate in plant and meteoric water should be revised. Also, this finding is of interest for understanding the balance and dynamics of the hydrogen isotopes in the environment. (authors)

Crystallographic isomorphism in the structural type of α-HgI{sub 2} by example of KHgI{sub 3} · H{sub 2}O, β-Ag{sub 2}HgI{sub 4}, and β-Cu{sub 2}HgI{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Borisov, S. V., E-mail: borisov@niic.nsc.ru; Magarill, S. A.; Pervukhina, N. V. [Russian Academy of Sciences, Nikolaev Institute of Inorganic Chemistry, Siberian Branch (Russian Federation)

2017-03-15

The structure of KHgI{sub 3} · H{sub 2}O is assigned to the family of crystal structures having the three-layer cubic packing of iodine anions with cations in the tetrahedral voids (the structures of α-HgI{sub 2}, β-Ag{sub 2}HgI{sub 4}, and β-Cu{sub 2}HgI{sub 4} among them). Crystallographic analysis shows that the nodes of the three-layer close packing are populated by iodine anions and K cations in the ratio 3/4: 1/4. Transformation of the structure of α-HgI{sub 2} into the structure of KHgI{sub 3} · H{sub 2}O can be formally represented as the replacement of (HgI){sub n}{sup +} fragments by (KH{sub 2}O){sub n}{sup +} fragments: (Hg{sub 2}I{sub 4})–(HgI){sup +} + (KH{sub 2}O){sub n}{sup +} = KHgI{sub 3} · H{sub 2}O. Perforated layers of vertex-sharing HgI{sub 4} tetrahedra break down into parallel isolated chains. Channels formed in place of I–Hg–I–Hg–fragments are occupied by–H{sub 2}O–K–-H{sub 2}-O-K-H{sub 2}O-chains weakly bound to neighbors.

Evaluating sub-clinical cognitive dysfunction and event-related potentials (P300) in clinically isolated syndrome.

Science.gov (United States)

Kocer, Belgin; Unal, Tugba; Nazliel, Bijen; Biyikli, Zeynep; Yesilbudak, Zulal; Karakas, Sirel; Irkec, Ceyla

2008-12-01

This study investigated the presence of sub-clinical cognitive dysfunction in patients with clinically isolated syndrome (CIS) and the abnormalities of cognitive event-related potentials (ERPs). Subclinical cognitive dysfunction was assessed in 20 patients with CIS and in 20 healthy controls. Patients had impairments in verbal learning and long-term memory, evaluating attention, executive function and visuospatial skills, in decreasing order of frequency. SDLT and SIT were the most, and COWAT and BNT were the least affected tests. The N200 and P200 latencies were prolonged, and N100, N200 and P200 amplitudes were reduced in the patients relative to the controls, from the Fz, Cz and Pz electrode positions (p<0.05). Detailed cognitive testing is valuable in determining subclinical cognitive dysfunction in CIS patients. ERP abnormalities as well as abnormalities in detailed cognitivetesting in patients with CIS are helpful in the diagnosis of sub-clinical cognitive dysfunction.

Structural, optical and photoacoustic study of Sb{sub 2}Te{sub 3} prepared by mechanical alloying

Energy Technology Data Exchange (ETDEWEB)

Souza, S.M.; Triches, D.M. [Departamento de Engenharia Mecanica, Universidade Federal de Santa Catarina, Campus Universitario Trindade, S/N, C.P. 476, 88040-900 Florianopolis, Santa Catarina (Brazil); Lima, J.C. de, E-mail: fsc1jcd@fisica.ufsc.b [Departamento de Fisica, Universidade Federal de Santa Catarina, Campus Universitario Trindade, S/N, C.P. 476, 88040-900 Florianopolis, Santa Catarina (Brazil); Grandi, T.A. [Departamento de Fisica, Universidade Federal de Santa Catarina, Campus Universitario Trindade, S/N, C.P. 476, 88040-900 Florianopolis, Santa Catarina (Brazil); Biasi, R.S. de [Secao de Engenharia Mecanica e de Materiais, Instituto Militar de Engenharia, 22290-270 Rio de Janeiro, RJ (Brazil)

2010-07-01

Nanostructured Sb{sub 2}Te{sub 3} was produced from Sb and Te by mechanical alloying for 3 h. Volume fractions of crystalline and interfacial components of the milled powder were estimated from the X-ray diffraction (XRD) pattern corrected for polarization, re-absorption, and inelastic scattering and converted to electron units using the theoretical value of the mean square scattering factor of Sb{sub 2}Te{sub 3}. Annealing showed that the particles are stable up to at least 583 K. The influence of the interfacial component on optical and thermal properties of as-milled and annealed Sb{sub 2}Te{sub 3} was studied through Raman and photoacoustic absorption measurements. The contribution of the interfacial component to the thermal diffusivity of milled Sb{sub 2}Te{sub 3} was investigated assuming that the measured thermal diffusivity can be described as a random mixture of crystalline and interfacial components. The large volume fraction of interfacial component in the milled powder seems to be responsible for a significant increase in thermal diffusivity. After annealing at 583 K the value of thermal diffusivity is much smaller, close to the one reported for bulk Sb{sub 2}Te{sub 3}.

Improved polycrystalline Ni{sub 54}Mn{sub 16}Fe{sub 9}Ga{sub 21} high-temperature shape memory alloy by γ phase distributing along grain boundaries

Energy Technology Data Exchange (ETDEWEB)

Yang, Shuiyuan; Zhang, Fan; Zhang, Kaixin; Huang, Yangyang; Wang, Cuiping; Liu, Xingjun [Xiamen Univ. (China). Fujian Key Laboratory of Materials Genome

2016-09-15

In this study, the shape recovery and mechanical properties of Ni{sub 54}Mn{sub 16}Fe{sub 9}Ga{sub 21} high-temperature shape memory alloy are improved simultaneously. This results from the low, about 4.4%, volume fraction of γ phase being almost completely distributed along grain boundaries. The recovery strain gradually increases with the increase in residual strain with a shape recovery rate of above 68%, up to a maximum value of 5.3%. The compressive fracture strain of Ni{sub 54}Mn{sub 16}Fe{sub 9}Ga{sub 21} alloy is about 35%. The results further reveal that when applying a high compression deformation two types of cracks form and propagate either within martensite grains (type I) or along the boundaries between martensite phase and γ phase (type II) in the present two-phase alloy.

Enhanced ionic conductivity with Li{sub 7}O{sub 2}Br{sub 3} phase in Li{sub 3}OBr anti-perovskite solid electrolyte

Energy Technology Data Exchange (ETDEWEB)

Zhu, Jinlong, E-mail: jlzhu04@physics.unlv.edu, E-mail: yusheng.zhao@unlv.edu, E-mail: zhaoys@sustc.edu.cn; Li, Shuai; Zhang, Yi; Howard, John W.; Wang, Yonggang; Kumar, Ravhi S.; Wang, Liping [High Pressure Science and Engineering Center, University of Nevada, Las Vegas, Nevada 89154 (United States); Lü, Xujie [Center for Integrated Nanotechnologies and Earth and Environmental Sciences Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Li, Yutao [Materials Research Program and The Texas Materials Institute, University of Texas at Austin, Texas 78712 (United States); Zhao, Yusheng, E-mail: jlzhu04@physics.unlv.edu, E-mail: yusheng.zhao@unlv.edu, E-mail: zhaoys@sustc.edu.cn [High Pressure Science and Engineering Center, University of Nevada, Las Vegas, Nevada 89154 (United States); Department of Physics, South University of Science and Technology of China, Guangdong 518055 (China)

2016-09-05

Cubic anti-perovskites with general formula Li{sub 3}OX (X = Cl, Br, I) were recently reported as superionic conductors with the potential for use as solid electrolytes in all-solid-state lithium ion batteries. These electrolytes are nonflammable, low-cost, and suitable for thermoplastic processing. However, the primary obstacle of its practical implementation is the relatively low ionic conductivity at room temperature. In this work, we synthesized a composite material consisting of two anti-perovskite phases, namely, cubic Li{sub 3}OBr and layered Li{sub 7}O{sub 2}Br{sub 3,} by solid state reaction routes. The results indicate that with the phase fraction of Li{sub 7}O{sub 2}Br{sub 3} increasing to 44 wt. %, the ionic conductivity increased by more than one order of magnitude compared with pure phase Li{sub 3}OBr. Formation energy calculations revealed the meta-stable nature of Li{sub 7}O{sub 2}Br{sub 3}, which supports the great difficulty in producing phase-pure Li{sub 7}O{sub 2}Br{sub 3} at ambient pressure. Methods of obtaining phase-pure Li{sub 7}O{sub 2}Br{sub 3} will continue to be explored, including both high pressure and metathesis techniques.

Topical or systemic 16,16 dm prostaglandin E sub 2 or WR-2721 (WR-1065) protects mice from alopecia after fractionated irradiation

Energy Technology Data Exchange (ETDEWEB)

Geng, L.; Malkinson, F.D. (Rush-Presbyterian-St. Luke' s Medical Center, Chicago, IL (United States)); Hanson, W.R. (Hines VA Medical Center, IL (United States))

1992-04-01

Previous studies in mice demonstrated that systemic or topical 16,16 dm PGE{sub 2} protected against single dose radiation-induced hair loss. The authors have now investigated prostaglandin, or WR-2721, protection against murine alopecia produced by varying doses and schedules of fractionated radiation. In some studies with the radioprotectors given systematically, WR-2721 afforded slightly greater radioprotection than 16,16 dm PGE{sub 2}. The two compounds were essentially equally radioprotective in the topical application studies. Since both systemic and topical applications of the agents tested enhanced hair regrowth following radiation, the authors conclude that clinical use of these compounds may provide some protection of hair follicles, and perhaps other tissues, lying within a radiation therapy field. (author).

Heterogeneity of proteins expressed by Brazilian Sporothrix schenckii isolates.

Science.gov (United States)

Fernandes, Geisa Ferreira; Do Amaral, Cristiane Candida; Sasaki, Alexandre; Godoy, Patrício Martinez; De Camargo, Zoilo Pires

2009-12-01

The profiles of proteins present in the exoantigens of Brazilian Sporothrix schenckii isolates were studied and compared by electrophoresis (SDS-PAGE). Thirteen isolates from five different regions of Brazil (1,000 to 2,000 km apart) and ten from a more limited region (200 to 400 km apart within the state of São Paulo) were cultured in Sabouraud, M199 and minimum (MM) media. Qualitative and quantitative differences in the expression of proteins, which varied according to the medium and the isolate, were observed. Fractions with the same MW but varying in intensity were detected, as well as fractions present in 1 isolate but absent in others. Dendrograms were constructed and isolates grouped based on the fractions obtained, irrespective of the intensity. The results showed that Brazilian S. schenckii isolates express different protein profiles, a feature also present in isolates from a more restricted region. The exoantigens were found to have a maximum of 15 protein fractions, ranging in MW from 19-220 KDaltons depending on the medium used for the cultures. These data show the great heterogeneity of Brazilian S. schenckii protein expression.

Thermal and quantum escape of fractional Josephson vortices

Energy Technology Data Exchange (ETDEWEB)

Poehler, Hanna; Kienzle, Uta; Buckenmaier, Kai; Gaber, Tobias; Koelle, Dieter; Kleiner, Reinhold; Goldobin, Edward [Physikalisches Institut, Center for Collective Quantum Phenomena, Universitaet Tuebingen (Germany); Siegel, Michael [Institut fuer Mikro- und Nanoelektronische Systeme, Universitaet Karlsruhe (Germany)

2009-07-01

By using a pair of tiny current injectors one can create an arbitrary {kappa} discontinuity of the phase in a long Josephson junction (LJJ) and a fractional Josephson vortex (FJV), carrying a fraction {phi}/{phi}{sub 0}={kappa}/2{pi}{<=}1 of the magnetic flux quantum {phi}{sub 0}{approx}2.07 .10{sup -15} Wb, which is pinned at the discontinuity. If a bias current I, exceeds the critical value I{sub c}({kappa}), an integer fluxon is torn off the discontinuity and the LJJ switches to the voltage state. Due to thermal or quantum fluctuations this escape event may occur at I sub c}({kappa}). We have measured the critical current distribution P(I) for different values of {kappa}, temperature T and junction geometry. At low temperatures we see a saturation of the distribution width which is presumably due to the crossover from thermal activation to quantum tunnelling. The results are compared to numerical simulations based on the static sine-Gordon equation.

Study and characterization of the hexa ferrite Ba{sub 2}Co{sub 2}Fe{sub 12}O{sub 22} (Co{sub 2}-Y); Sintese e caracterizacao da hexaferrita Ba{sub 2}Co{sub 2}Fe{sub 12}O{sub 22} (Co{sub 2}-Y)

Energy Technology Data Exchange (ETDEWEB)

Pires Junior, G.F.M.; Rodrigues, H.O. [Universidade Federal do Ceara (DETI/UFC), Fortaleza, CE (Brazil). Dept. de Teleinformatica; Sales, J.C [Universidade Estadual Vale do Acarau (UVA), Fortaleza, CE (Brazil). Dept. de Engenharia; Sancho, E.O. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia de Materiais; Sombra, A.S.B. [Universidade Federal do Ceara (LOCEM/UFC), Fortaleza, CE (Brazil). Dept. de Fisica. Lab. de Telecomunicacoes e Ciencias e Engenharia de Materiais

2009-07-01

The objective of this work is to synthesize and to characterize the Hexaferrita Ba2Co{sub 2}Fe{sub 12}O{sub 22} (Co{sub 2}Y). The Y-type Hexaferrita (Co{sub 2}Y) was prepared by the ceramic conventional method. The mixed powder by 1 h was calcined at 1050 deg C for 3 h. After of the calcination the powders were characterized by scanning electron microscopy (SEM) and X-ray diffraction (XRD) using a diffractometer DMAXB of the Rigaku (Japan), CuK{sub {alpha}} radiation ({lambda}=1.5405 angstrom) in a tax of 0.5 deg /min and linear band (20 deg at 80 deg) in 2{theta}. The characterization more detailed by XRD was made using the DBWS9807a program that uses the method of Rietveld for refinement of crystalline structures and confirmed the isolated attainment of the phase (Co{sub 2}Y) with hexagonal crystalline structure (a = b = 5,8560 angstrom and c = 43,4977 angstrom; {alpha} = {beta} = 90 deg and {gamma} = 120 deg) with density and volume of the unit cell calculated of 5.45 g/cm{sup 3} and 1292,3 angstrom respectively. (author)

Mitochondrial bioenergetics during the initiation of mercuric chloride-induced renal activity. II. Functional alterations of renal cortical mitochondria isolated after mercuric chloride treatment

Energy Technology Data Exchange (ETDEWEB)

Weinberg, J.M. (Veterans Administration Medical Center, Ann Arbor, MI); Harding, P.G.; Humes, H.D.

1982-01-01

The mitochondrial functional defects occurring in the early stages of nephrotoxic renal injury secondary to mercuric chloride have been characterized. No loss of cellular integrity or major mitochondrial structural alterations occurred within the first 3 hr after a subcutaneous injection of 5 mg/kg of HgCl/sub 2/. At 3 h, levels of Hg/sup 2 +/ in renal cortex and isolated renal cortical mitochondria were 1.87 and 0.72 nmol/mg of protein, respectively. Much evidence suggested that this Hg/sup 2 +/ had reached the mitochondria in situ and not during the isolation process. Mitochondria isolated beginning 1 h after treatment with HgCl/sub 2/ showed depressed ADP uptake. At 2 h, inhibitions of State 3 and 2,4-dinitrophenol uncoupled respiration were detected. Inhibition of 2,4-dinitrophenol-activated mitochondrial ATPase activity was present when measured on mitochondria isolated at 3 h. These effects were not reversed by 2 mM dithioerythritol, 50 mg/ml of albumin or 5 mM MgCl/sub 2/. Analysis of the data in the context of information available on the in vitro effects of HgCl/sub 2/ (Weinberg, J.M., Harding, P.G., and Humes, H.D. (1982) J. Biol. Chem. 257, 60-67) indicated that the mitochondrial functional effects could not be attributed to interaction of the mitochondria with Hg/sup 2 +/ during their isolation. These studies implicate compromised mitochondrial bioenergetic function as one of the earliest intracellular effects of Hg/sup 2 +/ in the production of nephrotoxicity but suggest that the intracellular process involves events in addition to those seen with direct exposure of mitochondria to Hg/sup 2 +/ in vitro.

Effect of exposure to O/sub 3/, SO/sub 2/, and NO/sub 2/ upon the lung histamine content of guinea pigs

Energy Technology Data Exchange (ETDEWEB)

Suzuki, T

1969-01-01

Male guinea pigs were exposed to 1 or 4 to 8 ppM O/sub 3/, 10 or 50 ppM SO/sub 2/, or 10 or 80 ppM NO/sub 2/ for 3 hr. Histamine and water content of lungs were measured. Animals exposed to higher concentrations of O/sub 3/ or NO/sub 2/ had edematous lungs. Lungs of those exposed to lower concentrations of O/sub 3/ or NO/sub 2/ also had slightly higher water contents. Lung histamine content and concentration decreased by O/sub 3/ exposure but not by any other treatment. In vitro exposure of lung to O/sub 3/ showed released histamine occurring in the perfusion outflow. Endogenous, cellular, inert histamine evidently was released by O/sub 3/ stimulant. However, the mechanism for NO/sub 2/-caused edema was not revealed, but could be direct action on lung vessels rather than through histamine mediation.

Thermal transport properties of MoS <sub>2sub> and MoSe <sub>2sub> monolayers

Energy Technology Data Exchange (ETDEWEB)

Kandemir, Ali; Yapicioglu, Haluk; Kinaci, Alper; Çağın, Tahir; Sevik, Cem

2016-01-11

Isolation of single to few layer transition metal dichalgogenides open alternate venues in application of 2 dimensional materials to nanoelectronics. Either for general overheating issues or specific application in thermoelectric devices, the characterization of the thermal transport in these new low dimensional materials is needed for their efficient implementation. In this study, lattice thermal conductivities of single layer MoS<sub>2sub> and MoSe<sub>2sub> are evaluated using classical molecular dynamics method. The interactions between atoms are defined by Stillinger-Weber type empirical potentials that are developed to represent structural, mechanical, and vibrational properties of the given materials. In parameterization of the potentials, a stochastic optimization algorithm, namely particle swarm optimization is utilized. The final parameter sets produce quite consistent results with DFT in terms of lattice parameters, bond distances, elastic constants and vibrational properties of both single layer MoS<sub>2sub> and MoSe<sub>2sub>. The predicted thermal properties of both materials are in very good agreement with earlier first principles calculations. The discrepancies between calculations and experimental measurements are most likely to be caused by pristine nature of the structures in our simulations.

Electrical, magnetic and physical properties of YBa/sub 2/Cu/sub 3/O/sub 7-x/ superconductor/polymer composites

International Nuclear Information System (INIS)

Fuierer, P.A.; Srinivasan, T.T.; Newnham, R.E.

1988-01-01

A polymer matrix provides a composite with flexibility and improved impact strength as well as protection against humidity and chemical attack. Superconductor/polymer 0-3 composites have been prepared by mixing YBa/sub 2/Cu/sub 3/O/sub 7-x/ powder with silicone rubber, pressing and curing. The resistivities of these composites do not go to zero, however, the magnetic flux exclusion is maintained in the temperature range, T< T/sub c/(--91K). The composite resistivities show percolation behavior and diamagnetism increases with increasing volume fraction of the superconductor filler. The composites exhibit levitation and large diamagnetic susceptibilities

Unsaponifiable fraction isolated from grape (Vitis vinifera L.) seed oil attenuates oxidative and inflammatory responses in human primary monocytes.

Science.gov (United States)

Millan-Linares, Maria C; Bermudez, Beatriz; Martin, Maria E; Muñoz, Ernesto; Abia, Rocio; Millan, Francisco; Muriana, Francisco J G; Montserrat-de la Paz, Sergio

2018-04-25

Grape (Vitis vinifera L.) seed has well-known potential for production of oil as a byproduct of winemaking and is a rich source of bioactive compounds. Herein, we report that the unsaponifiable fraction (UF) isolated from grape seed oil (GSO) possesses anti-oxidative and anti-inflammatory properties towards human primary monocytes. The UF isolated from GSO was phytochemically characterized by GC-MS and HPLC. Freshly obtained human monocytes were used to analyse the effects of GSOUF (10-100 μg mL-1) on oxidative and inflammatory responses using FACS analysis, RT-qPCR, and ELISA procedures. GSOUF skewed the monocyte plasticity towards the anti-inflammatory non-classical CD14+CD16++ monocytes and reduced the inflammatory competence of LPS-treated human primary monocytes diminishing TNF-α, IL-1β, and IL-6 gene expression and secretion. In addition, GSOUF showed a strong reactive oxygen species (ROS)-scavenging activity, reducing significantly nitrite levels with a significant decrease in Nos2 gene expression. Our results suggest that the UF isolated from GSO has significant potential for the management of inflammatory and oxidative conditions and offer novel benefits derived from the consumption of GSO in the prevention of inflammation-related diseases.

Effects of sub-lethal high-pressure homogenization treatment on the outermost cellular structures and the volatile-molecule profiles of two strains of probiotic lactobacilli.

Science.gov (United States)

Tabanelli, Giulia; Vernocchi, Pamela; Patrignani, Francesca; Del Chierico, Federica; Putignani, Lorenza; Vinderola, Gabriel; Reinheimer, Jorge A; Gardini, Fausto; Lanciotti, Rosalba

2015-01-01

Applying sub-lethal levels of high-pressure homogenization (HPH) to lactic acid bacteria has been proposed as a method of enhancing some of their functional properties. Because the principal targets of HPH are the cell-surface structures, the aim of this study was to examine the effect of sub-lethal HPH treatment on the outermost cellular structures and the proteomic profiles of two known probiotic bacterial strains. Moreover, the effect of HPH treatment on the metabolism of probiotic cells within a dairy product during its refrigerated storage was investigated using SPME-GC-MS. Transmission electron microscopy was used to examine the microstructural changes in the outermost cellular structures due to HPH treatment. These alterations may be involved in the changes in some of the technological and functional properties of the strains that were observed after pressure treatment. Moreover, the proteomic profiles of the probiotic strains treated with HPH and incubated at 37°C for various periods showed different peptide patterns compared with those of the untreated cells. In addition, there were differences in the peaks that were observed in the low-mass spectral region (2000-3000 Da) of the spectral profiles of the control and treated samples. Due to pressure treatment, the volatile-molecule profiles of buttermilk inoculated with treated or control cells and stored at 4°C for 30 days exhibited overall changes in the aroma profile and in the production of molecules that improved its sensory profile, although the two different species imparted specific fingerprints to the product. The results of this study will contribute to understanding the changes that occur in the outermost cellular structures and the metabolism of LAB in response to HPH treatment. The findings of this investigation may contribute to elucidating the relationships between these changes and the alterations of the technological and functional properties of LAB induced by pressure treatment.

Fractional Charge Definitions and Conditions

Energy Technology Data Exchange (ETDEWEB)

Goldhaber, A.S.

2004-06-04

Fractional charge is known through theoretical and experimental discoveries of isolable objects carrying fractions of familiar charge units--electric charge Q, spin S, and the difference of baryon and lepton numbers B-L. With a few simple assumptions all these effects may be described using a generalized version of charge renormalization for locally conserved charges, in which medium correlations yield familiar adiabatic, continuous renormalization, or sometimes nonadiabatic, discrete renormalization. Fractional charges may be carried by fundamental particles or fundamental solitons. Either picture works for the simplest fractional-quantum-Hall-effect quasiholes, though the particle description is far more general. The only known fundamental solitons in three or fewer space dimensions d are the kink (d = 1), the vortex (d = 2), and the magnetic monopole (d = 3). Further, for a charge not intrinsically coupled to the topological charge of a soliton, only the kink and the monopole may carry fractional values. The same reasoning enforces fractional values of B-L for electrically charged elementary particles.

Fractional Charge Definitions and Conditions

International Nuclear Information System (INIS)

Goldhaber, A.S.

2004-01-01

Fractional charge is known through theoretical and experimental discoveries of isolable objects carrying fractions of familiar charge units--electric charge Q, spin S, and the difference of baryon and lepton numbers B-L. With a few simple assumptions all these effects may be described using a generalized version of charge renormalization for locally conserved charges, in which medium correlations yield familiar adiabatic, continuous renormalization, or sometimes nonadiabatic, discrete renormalization. Fractional charges may be carried by fundamental particles or fundamental solitons. Either picture works for the simplest fractional-quantum-Hall-effect quasiholes, though the particle description is far more general. The only known fundamental solitons in three or fewer space dimensions d are the kink (d = 1), the vortex (d = 2), and the magnetic monopole (d = 3). Further, for a charge not intrinsically coupled to the topological charge of a soliton, only the kink and the monopole may carry fractional values. The same reasoning enforces fractional values of B-L for electrically charged elementary particles

Porosity and biocompatibility study of ceramic implants based on ZrO{sub 2} and Al{sub 2}O{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Litvinova, Larisa, E-mail: larisalitvinova@yandex.ru, E-mail: vshupletsova@mail.ru, E-mail: leitsin@mail.ru; Shupletsova, Valeria, E-mail: larisalitvinova@yandex.ru, E-mail: vshupletsova@mail.ru, E-mail: leitsin@mail.ru; Leitsin, Vladimir, E-mail: larisalitvinova@yandex.ru, E-mail: vshupletsova@mail.ru, E-mail: leitsin@mail.ru [Immanuel Kant Baltic Federal University, Kaliningrad (Russian Federation); Vasyliev, Roman, E-mail: rvasiliev@ukr.net, E-mail: zoubov77@yahoo.com; Zubov, Dmitry, E-mail: rvasiliev@ukr.net, E-mail: zoubov77@yahoo.com [State Institute of Genetic and Regenerative Medicine, National Academy of Medical Sciences of Ukraine, Kiev (Ukraine); Buyakov, Ales, E-mail: kulkov@ms.tsc.ru, E-mail: kulkov@ms.tsc.ru; Kulkov, Sergey, E-mail: kulkov@ms.tsc.ru, E-mail: kulkov@ms.tsc.ru [Institute of Strength Physics and Materials Science SB RAS, Tomsk, 634055 (Russian Federation); National Research Tomsk State University, Tomsk, 634050 (Russian Federation); National Research Tomsk Polytechnic University, Tomsk, 634050 (Russian Federation)

2014-11-14

The work studies ZrO{sub 2}(Me{sub x}O{sub y})-based porous ceramics produced from the powders consisting of hollow spherical particles. It was shown that the structure is represented by a cellular framework with bimodal porosity consisting of sphere-like large pores and pores that were not filled with the powder particles during the compaction. For such ceramics, the increase of pore volume is accompanied by the increased strain in an elastic area. It was also shown that the porous ZrO{sub 2} ceramics had no acute or chronic cytotoxicity. At the same time, ceramics possess the following osteoconductive properties: adhesion support, spreading, proliferation and osteogenic differentiation of MSCs.

The relative biological effectiveness of fractionated doses of fast neutrons (42 MeV sub d yields Be ) for normal tissues. Pt. 3; Effects on lung function

Energy Technology Data Exchange (ETDEWEB)

Rezvani, M.; Hopewell, J.W.; Robbins, M.E.C.; Hamlet, R. (Churchill Hospital, Oxford (UK)); Barnes, D.W.H.; Sansom, J.M.; Adams, P.J.V. (Medical Research Council, Harwell (UK). Radiobiological Research Unit)

1990-11-01

The effect of single and fractionated doses of fast neutrons (42 MeV{sub d{yields}Bc}) on the early and late radiation responses of the pig lung have been assessed by the measurement of changes in lung function using a {sup 133}Xe washout technique. The results obtained for irradiation schedules with fast neutrons have been compared with those after photon irradiation. There was no statistically significant difference between the values for the relative biological effectiveness (RBE) for the early and late radiation response of the lung. The RBE of the neutron beam increased with decreasing size of dose/fraction with an upper limit value of 4.39 {plus minus} 0.94 for infinitely small X-ray doses per fraction. (author).

Magnetic field induced low temperature upturn of magnetization in highly Ca-doped La{sub 0.1875}Ca{sub 0.8125}MnO{sub 3} polycrystalline compound

Energy Technology Data Exchange (ETDEWEB)

Das, Kalipada, E-mail: kalipadadasphysics@gmail.com [Indian Association for the Cultivation of Science, 2A and 2B Raja S. C. Mullick Road, Jadavpur, Kolkata 700032 (India); Dasgupta, P.; Poddar, A. [CMP Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700 064 (India)

2017-06-15

Highlights: • Magnetic field induced super paramagnetic nanoclusters formation. • Magnetic field dependent change of the curvature of the magnetization. • We report the training effect in polycrystalline La{sub 0.1875}Ca{sub 0.8125}MnO{sub 3} compound. - Abstract: In our present study we have reported the magnetic properties of highly Ca-doped polycrystalline compound La{sub 0.1875}Ca{sub 0.8125}MnO{sub 3}. Along with the conventional charge ordered antiferromagnetic ground state, a small ferromagnetic phase fraction is present at the low temperature. The effect of the external magnetic field markedly modifies the ground state of the compound. Our experimental results indicate that in addition to the ferromagnetic phase fraction, another field induced super paramagnetic phase grow at low temperature (T < 50 K) above H = 10 kOe magnetic field within the charge ordered antiferromagnetic matrix. The nature of the temperature dependent magnetization curves influenced by the external applied magnetic field was observed and analyzed using Langevin theory of super paramagnetism.

A Solution to the Fundamental Linear Fractional Order Differential Equation

Science.gov (United States)

Hartley, Tom T.; Lorenzo, Carl F.

1998-01-01

This paper provides a solution to the fundamental linear fractional order differential equation, namely, (sub c)d(sup q, sub t) + ax(t) = bu(t). The impulse response solution is shown to be a series, named the F-function, which generalizes the normal exponential function. The F-function provides the basis for a qth order "fractional pole". Complex plane behavior is elucidated and a simple example, the inductor terminated semi- infinite lossy line, is used to demonstrate the theory.

X-ray crystal and molecular structure of (eta/sup 5/C/sub 5/H/sub 5/)UCl/sub 3/. 2PPh/sub 3/O thf: trichloro (eta/sup 5/cyclopentadienyl)bis(triphenylphosphine oxide) uranium(IV). thf

Energy Technology Data Exchange (ETDEWEB)

Bombieri, G; De Paoli, G [Consiglio Nazionale delle Ricerche, Padua (Italy). Lab. di Chimica e Tecnologia dei Radioelementi; Del Pra, A; Bagnall, K W

1978-01-01

Following reports of the preparation of (eta/sup 5/C/sub 5/H/sub 5/)UCl/sub 3/.xL (x = 1, L = dimethoxyethane and x = 2, L = tetrahydrofuran (thf), a series of analogous oxygen-donor complexes were isolated. This paper describes the crystal and molecular structure of one of them, ((eta/sup 5/C/sub 5/H/sub 5/)UCl/sub 3/.2PPh/sub 3/O)thf.

Hexagonal perovskites with cationic vacancies. 8. Vibrational spectroscopic investigations on rhombohedral 18 L-stacking polytypes Ba/sub 6/B/sub 2/sup(III)vacantW/sub 3/sup(VI)O/sub 18/

Energy Technology Data Exchange (ETDEWEB)

Schittenhelm, H J; Fadini, A; Kemmler-Sack, S [Tuebingen Univ. (Germany, F.R.)

1979-10-01

The vibrational spectra of the 18 L stacking polytypes Ba/sub 6/B/sub 2/sup(III)vacant W/sub 3/O/sub 18/ (space group R3m; sequence (hhcccc)/sub 3/) with Bsup(III) = Lu, Y are reported. The octahedral net consists of W/sub 2/vacantO/sub 12/ and WO/sub 6/ groups, which are isolated from each other by the Ba and B ions. An assignment of the vibrational frequencies has been made with the aid of factor group analysis. For the W/sub 2/vacantO/sub 12/ block a complete force constant calculation is reported.

Isolation of 14{sub C} labelled amino acids by biosynthesis in maize plants (Zea mais L.); Obtencin de aminoacidos marcados con 14{sub C} por biosintesis en plantulas de maiz (Zea mais L)

Energy Technology Data Exchange (ETDEWEB)

Carreras, N; Mazon, M P

1983-07-01

A method of obtaining 14{sub C} labelled amino acids by biosynthesis in maize plants which had assimilated 14CO{sub 2}, has been assayed. The plants were labelled for 60 minutes with 14{sub C}O2 produced from Ba 14{sub C}O3 (specific activity of 148 KBq/{mu}mol). An extract of the soluble compounds was obtained with 80% ethanol and the amino acids were separated from the rest of the soluble compounds by ion exchange chromatography on column of Dowex 50-X8 resin. Finally, seventeen amino acids were isolated and identified from the purified extract. The acid amino acids were separated in anionic column (Dowex 1-X8) and the neutral and basic amino acids in cationic column (Dowex 50-X4). (Author) 56 refs.

Cellular uptake of folate-conjugated lipophilic superparamagnetic iron oxide nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Woo, Kyoungja [Nano-Materials Research Center, Korea Institute of Science and Technology, P. O. Box 131, Cheongryang, Seoul 130-650 (Korea, Republic of)], E-mail: kjwoo@kist.re.kr; Moon, Jihyung [Nano-Materials Research Center, Korea Institute of Science and Technology, P. O. Box 131, Cheongryang, Seoul 130-650 (Korea, Republic of); Department of Materials Science and Engineering, Korea University, 5-1, Anam-Dong, Sungbook-Ku, Seoul, 136-713 (Korea, Republic of); Choi, Kyu-Sil [Division of Molecular Imaging, Samsung Biomedical Research Institute, Samsung Medical Center, 50 Ilwon-Dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Seong, Tae-Yeon [Department of Materials Science and Engineering, Korea University, 5-1, Anam-Dong, Sungbook-Ku, Seoul, 136-713 (Korea, Republic of); Yoon, Kwon-Ha [Institute for Radiological Imaging Science, Wonkwang University School of Medicine, 344-2, Shinyong, Iksan, Jeonbuk 570-749 (Korea, Republic of)

2009-05-15

We prepared five folate-conjugated lipophilic superparamagnetic iron oxide nanoparticles (F{sub 5}-Liposuperparamagnetic iron oxide nanoparticles(SPIONs), 5.5 and 11 nm) and investigated their cellular uptake with KB cells, which is one of the representative folate-receptor over-expressing human epidermoid carcinoma cells, using MRI. The cellular uptake tests with the respective 5.5 and 11 nm F{sub 5}-LipoSPIONs at a fixed particle concentration showed appreciable amount of receptor-mediated uptakes and the specificity was higher in 5.5 nm SPIONs, due to its higher folic acid (FA) density, without inhibition. However, the numbers of the particles taken up under FA inhibition were similar, irrespective of their sizes.

Antibacterial and anti-inflammatory activities of an extract, fractions, and compounds isolated from Gochnatia pulchra aerial parts

Science.gov (United States)

Lucarini, R.; Tozatti, M.G.; Silva, M.L.A.; Gimenez, V.M.M.; Pauletti, P.M.; Groppo, M.; Turatti, I.C.C.; Cunha, W.R.; Martins, C.H.G.

2015-01-01

This paper reports on the in vitro antibacterial and in vivo anti-inflammatory properties of a hydroethanolic extract of the aerial parts of Gochnatia pulchra (HEGP). It also describes the antibacterial activity of HEGP fractions and of the isolated compounds genkwanin, scutellarin, apigenin, and 3,5-O-dicaffeoylquinic acid, as evaluated by a broth microdilution method. While HEGP and its fractions did not provide promising results, the isolated compounds exhibited pronounced antibacterial activity. The most sensitive microorganism was Streptococcus pyogenes, with minimum inhibitory concentration (MIC) values of 100, 50 and 25 µg/mL for genkwanin and the flavonoids apigenin and scutellarin, respectively. Genkwanin produced an MIC value of 25 µg/mL against Enterococcus faecalis. A paw edema model in rats and a pleurisy inflammation model in mice aided investigation of the anti-inflammatory effects of HEGP. This study also evaluated the ability of HEGP to modulate carrageenan-induced interleukin-1 beta (IL-1β), tumor necrosis factor alpha (TNF-α), and monocyte chemoattractant protein-1 (MCP-1) production. Orally administered HEGP (250 and 500 mg/kg) inhibited carrageenan-induced paw edema. Regarding carrageenan-induced pleurisy, HEGP at 50, 100, and 250 mg/kg diminished leukocyte migration by 71.43%, 69.24%, and 73.34% (P<0.05), respectively. HEGP suppressed IL-1β and MCP-1 production by 55% and 50% at 50 mg/kg (P<0.05) and 60% and 25% at 100 mg/kg (P<0.05), respectively. HEGP abated TNF-α production by macrophages by 6.6%, 33.3%, and 53.3% at 100, 250, and 500 mg/kg (P<0.05), respectively. HEGP probably exerts anti-inflammatory effects by inhibiting production of the pro-inflammatory cytokines TNF-α, IL-1β, and MCP-1. PMID:26200228

Hexagonal perovskites with cationic vacancies. 7. Vibrational spectroscopic investigations on the rhombohedral 12 L-stacking polytypes Ba/sub 4/Bsup(II)(Re/sub 2/vacantO/sub 12/) and Ba/sub 4/Bsub(2/3)sup(III)vacantsub(1/3)(Re/sub 2/vacantO/sub 12/)

Energy Technology Data Exchange (ETDEWEB)

Fadini, A; Kemmler-Sack, S; Schittenhelm, H J; Rother, H J; Treiber, U [Tuebingen Univ. (Germany, F.R.). Lehrstuhl fuer Anorganische Chemie 2

1979-07-01

For the rhombohedral 12 L stacking polytypes Ba/sub 4/Bsup(II)(Re/sub 2/vacantO/sub 12/) and Ba/sub 4/Bsub(2/3)sup(III)vacantsub(1/3)(Re/sub 2/vacantO/sub 12/), space group R3m, sequence (3)(1), the lattice consists of groups of three face sharing octahedra with the composition Re/sub 2/vacantO/sub 12/. They are isolated from each other by the Ba and B ions. The vibrational spectra are interpreted according to the factor group analysis. For the Re/sub 2/vacantO/sub 12/ unit (symmetry Dsub(3d) the results of a complete vibrational analysis and the calculation of the force constants are reported.

Temperature dependence of the coercive field of gas atomized Fe{sub 73.5}Si{sub 13.5}B{sub 9}Nb{sub 3}Cu{sub 1}

Energy Technology Data Exchange (ETDEWEB)

Garcia-Escorial, A., E-mail: age@cenim.csic.es [CENIM-CSIC, Avda, Gregorio del Amo, 8, 28040 Madrid (Spain); Lieblich, M. [CENIM-CSIC, Avda, Gregorio del Amo, 8, 28040 Madrid (Spain); Hernando, A.; Aragon, A.; Marin, P. [Instituto de Magnetismo Aplicado, IMA, P.O. Box 155, 28230 Madrid (Spain)

2012-09-25

Highlights: Black-Right-Pointing-Pointer An anomalous thermal dependence of the coercive field of gas atomized Fe{sub 73.5}Si{sub 13.5}B{sub 9}Nb{sub 3}Cu{sub 1} powder particles under 25 {mu}m powder particle, increasing Hc as temperature increases. Black-Right-Pointing-Pointer It is proposed that Cu rich regions at inter-grain boundaries could act as exchange decoupling regions contributing to the thermal increase of coercivity. Black-Right-Pointing-Pointer This anomalous thermal dependence points out that tailoring microstructure and size, by controlling the cooling rate of more adequate multiphase systems, could be a promising procedure to develop soft or hard magnets, avoiding Rare Earths metals that is nowadays an important target for the engineering of magnetic materials. - Abstract: In this work, the dependence of the coercive field of Fe{sub 73.5}Si{sub 13.5}B{sub 9}Nb{sub 3}Cu{sub 1} gas atomized powder with the temperature for different particle sizes has been studied, observing an anomalous behavior in the under 25 powder particle size fraction. This unusual behavior is related with the microstructure of the powder, and is attributed to the presence of a multiphase magnetic system, with non-magnetic regions decoupling the ferromagnetic domains.

Emission factors for CH{sub 4}, NO{sub x}, particulates and black carbon for domestic shipping in Norway, revision 1

Energy Technology Data Exchange (ETDEWEB)

Nielsen, Joergen Bremnes; Stenersen, Dag

2010-11-15

In this report new and updated emission factors for diesel, HFO and gas fuelled ships are presented and discussed as follows; NO{sub x} reduction factors from ships with NO{sub x} reduction measures; NO{sub x} emission factor from gas operated vessels; Methane emission factors for gas operated vessels; Updated emission factors for particulate emissions (PM) with a specific factor for the black carbon (BC) fraction of particulate emissions; A discussion on how low sulfur fuel will affect emissions of PM emissions and the BC fraction of PM is also included. (Author)

Computational fluid dynamics modeling and analysis of Pd-based membrane module for CO{sub 2} capture from H{sub 2}/CO{sub 2} binary gas mixture

Energy Technology Data Exchange (ETDEWEB)

Shin, Dong-Yoon; Park, Myung-June [Ajou University, Suwon (Korea, Republic of); Hwang, Kyung-Ran; Park, Jong-Soo [Korea Institute of Energy Research, Daejeon (Korea, Republic of)

2015-07-15

A Pd-based membrane module for the capture of CO{sub 2} from a H{sub 2}/CO{sub 2} binary gas mixture was considered, and computational fluid dynamics modeling was used to predict the module performance. Detailed models of momentum and mass balances, including local flux as a function of local linear velocity, satisfactorily described CO{sub 2} fraction in a retentate tube when compared to the experimental data under various feed flow rates. By using the model, several cases having different geometries, including the location and diameter of feed tube and the number and location of the feed and retentate tubes, were considered. Among tested geometries, the case of two feed tubes with each offset by an angle, θ, of 45° from the center line, and a feed tube diameter of 2.45mm showed the increase of the feed flow rate up to 11.80% compared to the reference case while a CO{sub 2} fraction of 90% in the retentate, which was the criterion for effective CO{sub 2} capture in the present study, was guaranteed. This would result in a plausible reduction in capital expenditures for the CO{sub 2} capture process.

Right Ventricular Ejection Fraction using ECG-Gated First Pass Cardioangiography

Energy Technology Data Exchange (ETDEWEB)

Moon, Young Hee; Lee, Hae Giu; Lee, Sung Yong; Park, Suk Min; Chung, Soo Kyo; Yim, Jeong Ik; Bahk, Yong Whee; Shinn, Kyung Sub; Kim, Young Gyun; Kwon, Soon Seog [Catholic University College of Medicine, Seoul (Korea, Republic of)

1993-03-15

Radionuclide cardioangiography has been widely applied and has played major roles in moninvasive assessment of cardiac function. Three techniques, first-pass gated first and gated equilibrium methods have commonly been used to evaluate right ventricular ejection fraction which usually abnormal in the patients with cardiopulmonary disease. It has been known that the gated first pass method is most accurate method among the three techniques in assessment of fight ventricular ejection fraction. The radionuclide right ventricular ejection fraction values were determined in 13 normal subjects and in 15 patients with chronic obstructive pulmonary disease by the gated first pass method and compared with those of the first pass method because there has been no published data of fight ejection fraction by the gated first pass method were compared with the defects from the pulmonary function test performed in the patients with chronic obstructive pulmomary disease. The results were as follows; 1) The values of fight ventricular ejection fraction by the gated first pass method were 50.1 +- 6.1% in normal subjects and 38.5 +- 8.5 in the patients with chronic obstructive pulmonary disease. There was statistically significant difference between the right ventricular ejection fraction of each of the two groups (p<0.05) 2) The right ventricular ejection fraction by the gated first pass method was not linearly correlated ith FEV{sub 1}, VC. DLCO. and FVC as well as P{sub a}O2 and P{sub a}CO2 of the patients with chronic obstructive pulmonary disease. We concluded that right ventricular ejection fraction by the gated first pass method using radionuclide cardioangiography may be useful in clinical assessment of the right ventricular function.

Simple numerical evaluation of modified Bessel functions Ksub(ν)(x) of fractional order and the integral ∫sup(infinitely)sub(x)Ksub(ν)(eta)d eta

International Nuclear Information System (INIS)

Kostroun, V.O.

1980-01-01

Theoretical expressions for the angular and spectral distributions of synchrotron radiation involve modified Bessel functions of fractional order and the integral ∫sup(infinitely)sub(x)Ksub(ν)(eta)d eta. A simple series expression for these quantities which can be evaluated numerically with hand-held programmable calculators is presented. (orig.)

Purification and characterization of the reconstitutively active P/sub i//H/sup +/ symporter from rat liver mitochondria

Energy Technology Data Exchange (ETDEWEB)

Kaplan, R.S.; Pratt, R.D.; Pedersen, P.L.

1986-05-01

A highly purified preparation of reconstitutively active P/sub i//H/sup +/ symporter has been obtained from rat liver mitochondria. The carrier is isolated by extraction of hypotonically shocked mitoplasts with Triton X-114 in the presence of cardiolipin followed by sequential chromatography on hydroxylapatite, DEAE-Sepharose CL-6B, and Affi-Gel 501. Upon incorporation of the final Affi-Gel eluate into phospholipid vesicles, an N-ethylmaleimide (NEM)-sensitive P/sub i//P/sub i/ exchange of greater than 15 ..mu..mol/min/mg protein has been measured. This exchange is characterized by a first order rate constant of 0.85 min/sup -1/ and a t/sub 1/2/ of 49 sec. Furthermore, /sup 32/P/sub i/ uptake into vesicles can be inhibited by SH reagents and by the lysine reactive reagent dansyl chloride. Coomassie-stained SDS polyacrylamide gradient gels verify the high purity of this fraction and indicate the presence of two bands, of nearly equivalent staining intensity, at 33 kDa and 35 kDa. A small amount of higher molecular weight material also appears at approx. 61 kDa. Alkylation of the purified fraction with NEM causes the two lower molecular weight protein bands to migrate as a single species at 35 kDa which binds (/sup 3/H)NEM. It is concluded that the purifed protein represents a nearly homogeneous form of the NEM-sensitive P/sub i//H/sup +/ symporter of rat liver mitochondria. Additionally, the purified carrier appears to contain cysteine and lysine residues that are essential for activity.

Syntheses, crystal structures and solid-state properties of the lanthanoid-containing nanoclusters [(Ln{sub 2}PW{sub 10}O{sub 38}){sub 4}(W{sub 3}O{sub 8})(OH){sub 4}(H{sub 2}O){sub 2}]{sup 26-}

Energy Technology Data Exchange (ETDEWEB)

Gupta, Rakesh; Saini, Mukesh Kumar; Hussain, Firasat [Department of Chemistry, University of Delhi (India)

2014-12-15

A series of lanthanoid-substituted polyoxometalates have been synthesized by a self-assembly process in potassium chloride solution by the reaction of dilacunary [P{sub 2}W{sub 19}O{sub 69}(H{sub 2}O)]{sup 14-} with mid- and late-lanthanoid Ln(NO{sub 3}){sub 3}.nH{sub 2}O salts leading to the formation of the tetrameric tungstophosphates [(Ln{sub 2}PW{sub 10}O{sub 38}){sub 4}(W{sub 3}O{sub 8})(OH){sub 4}(H{sub 2}O){sub 2}]{sup 26-} [Ln = Y{sup 3+} (1), Sm{sup 3+} (2), Eu{sup 3+} (3), Gd{sup 3+} (4), Tb{sup 3+} (5), Dy{sup 3+} (6), Ho{sup 3+} (7), Er{sup 3+} (8), Tm{sup 3+} (9), Yb{sup 3+} (10)]. The polyanions were isolated as potassium or mixed-alkali salts. Most of the compounds were characterized by single-crystal X-ray diffraction and various analytical techniques, such as FTIR, UV/Vis, {sup 31}P NMR and photoluminescence spectroscopy, magnetism, as well as thermogravimetric analysis. The FTIR spectra suggest that all the compounds are isomorphous. The crystal structures of these complexes consist of four A-[α-PW{sub 10}O{sub 36}]{sup 7-} units, each incorporating two Ln{sup III} ions to create four Keggin-like anions that further assemble with three additional tungstate units to form a tetramer species with C{sub 2} symmetry. The photoluminescent properties of 3a and 6a were investigated following photoexcitation at room temperature. The magnetic properties of 3a, 4a, 5a and 6a were investigated at room temperature, the complexes exhibiting paramagnetic behaviour. (Copyright copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Cation distribution in Ni-substituted Mn{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} nanoparticles: A Raman, Mössbauer, X-ray diffraction and electron spectroscopy study

Energy Technology Data Exchange (ETDEWEB)

Thota, Suneetha [Microwave Laboratory, Department of Physics, Indian Institute of Technology Delhi, New Delhi 110016 (India); Kashyap, Subhash C., E-mail: skashyap@physics.iitd.ac.in [Microwave Laboratory, Department of Physics, Indian Institute of Technology Delhi, New Delhi 110016 (India); Sharma, Shiv K. [Hawaii Institute of Geophysics and Planetology, University of Hawaii (UH), Honolulu, HI 96822 (United States); Reddy, V.R. [UGC-DAE Consortium for Scientific Research, Khandwa Road, Indore 452017 (India)

2016-04-15

Graphical abstract: - Highlights: • Synthesized Mn{sub 0.5−x}Ni{sub x}Zn{sub 0.5}Fe{sub 2}O{sub 4}, nanoparticles (0.05 ≤ x ≤ 0.45) at low temperature. • Raman studies established that Fe and Zn ions occupy A site in equal fraction. • {sup 57}Fe Mossbauer study revealed that Ni and Mn ions occupy nearly 25% of B sites. • Electron spectroscopy (XPS) confirmed that nearly 25% Fe{sup 3+} dwells at A sites. • Diffraction peak intensity (X-ray) quantified cations distribution at A- and B-sites. - Abstract: In this paper we report the structural, vibration, and electronic-structure parameters (bonding and valence of cations) of single phase cubic mixed spinel nanoparticles of (Zn{sub δ}Mn{sub γ}Fe{sub 1−(γ+δ)})[Ni{sub x}Zn{sub 0.5−δ}Mn{sub 0.5−γ−x}Fe{sub 1+(γ+δ)}]O{sub 4} where x = 0.05–0.45 with an aim to determine cation-distribution i.e. δ and γ in these samples. The Raman spectroscopy has established that only Fe and Zn cations occupy tetrahedral interstitial sites in a FCC anion lattice in nearly equal fraction, and Mössbauer spectra have shown that Fe{sup 3+} cations are present at both, tetrahedral and octahedral interstitial sites and Ni{sup 2+} cations are situated at the octahedral sites in all the substituted samples. The photoelectron spectra also revealed the presence of Fe{sup 3+} cations at both the interstitial sites. The best possible cationic distribution in Ni substituted Mn–Zn ferrites has been estimated by reiteratively calculating the intensity ratios of various pairs of X-ray diffraction peaks and matching with the observed intensity ratios.

Microstructural effects in drug release by solid and cellular polymeric dosage forms: A comparative study.

Science.gov (United States)

Blaesi, Aron H; Saka, Nannaji

2017-11-01

In recent studies, we have introduced melt-processed polymeric cellular dosage forms to achieve both immediate drug release and predictable manufacture. Dosage forms ranging from minimally-porous solids to highly porous, open-cell and thin-walled structures were prepared, and the drug release characteristics investigated as the volume fraction of cells and the excipient molecular weight were varied. In the present study, both minimally-porous solid and cellular dosage forms consisting of various weight fractions of Acetaminophen drug and polyethylene glycol (PEG) excipient are prepared and analyzed. Microstructures of the solid forms and the cell walls range from single-phase solid solutions of the excipient and a small amount of drug molecules to two-phase composites of the excipient and tightly packed drug particles. Results of dissolution experiments show that the minimally-porous solid forms disintegrate and release drug by slow surface erosion. The erosion rate decreases as the drug weight fraction is increased. By contrast, the open-cell structures disintegrate rapidly by viscous exfoliation, and the disintegration time is independent of drug weight fraction. Drug release models suggest that the solid forms erode by convective mass transfer of the faster-eroding excipient if the drug volume fraction is small. At larger drug volume fractions, however, the slower-eroding drug particles hinder access of the free-flowing fluid to the excipient, thus slowing down erosion of the composite. Conversely, the disintegration rate of the cellular forms is limited by diffusion of the dissolution fluid into the excipient phase of the thin cell walls. Because the wall thickness is of the order of the drug particle size, and the particles are enveloped by the excipient during melt-processing, the drug particles cannot hinder diffusion through the excipient across the walls. Thus the disintegration time of the cellular forms is mostly unaffected by the volume fraction of drug

Al/Fe isomorphic substitution versus Fe{sub 2}O{sub 3} clusters formation in Fe-doped aluminosilicate nanotubes (imogolite)

Energy Technology Data Exchange (ETDEWEB)

Shafia, Ehsan [Politecnico di Torino, Department of Applied Science and Technology and INSTM Unit of Torino-Politecnico (Italy); Esposito, Serena [Università degli Studi di Cassino e del Lazio Meridionale, Department of Civil and Mechanical Engineering (Italy); Manzoli, Maela; Chiesa, Mario [Università di Torino, Dipartimento di Chimica and Centro Interdipartimentale NIS (Italy); Tiberto, Paola [Electromagnetism, I.N.Ri.M. (Italy); Barrera, Gabriele [Università di Torino, Dipartimento di Chimica and Centro Interdipartimentale NIS (Italy); Menard, Gabriel [Harvard University, Department of Chemistry and Chemical Biology (United States); Allia, Paolo, E-mail: paolo.allia@polito.it [Politecnico di Torino, Department of Applied Science and Technology and INSTM Unit of Torino-Politecnico (Italy); Freyria, Francesca S. [Massachusetts Institute of Technology, Department of Chemistry (United States); Garrone, Edoardo; Bonelli, Barbara, E-mail: barbara.bonelli@polito.it [Politecnico di Torino, Department of Applied Science and Technology and INSTM Unit of Torino-Politecnico (Italy)

2015-08-15

Textural, magnetic and spectroscopic properties are reported of Fe-doped aluminosilicate nanotubes (NTs) of the imogolite type, IMO, with nominal composition (OH){sub 3}Al{sub 2−x}Fe{sub x}O{sub 3}SiOH (x = 0, 0.025, 0.050). Samples were obtained by either direct synthesis (Fe-0.025-IMO, Fe-0.050-IMO) or post-synthesis loading (Fe-L-IMO). The Fe content was either 1.4 wt% (both Fe-0.050-IMO and Fe-L-IMO) or 0.7 wt% (Fe-0.025-IMO). Textural properties were characterized by High-Resolution Transmission Electron Microscopy, X-ray diffraction and N{sub 2} adsorption/desorption isotherms at 77 K. The presence of different iron species was studied by magnetic moment measurements and three spectroscopies: Mössbauer, UV–Vis and electron paramagnetic resonance, respectively. Fe{sup 3+}/Al{sup 3+} isomorphic substitution (IS) at octahedral sites at the external surface of NTs is the main process occurring by direct synthesis at low Fe loadings, giving rise to the formation of isolated high-spin Fe{sup 3+} sites. Higher loadings give rise, besides IS, to the formation of Fe{sub 2}O{sub 3} clusters. IS occurs up to a limit of Al/Fe atomic ratio of ca. 60 (corresponding to x = 0.032). A fraction of the magnetism related to NCs is pinned by the surface anisotropy; also, clusters are magnetically interacting with each other. Post-synthesis loading leads to a system rather close to that obtained by direct synthesis, involving both IS and cluster formations. Slightly larger clusters than with direct synthesis samples, however, are formed. The occurrence of IS indicates a facile cleavage/sealing of Al–O–Al bonds: this opens the possibility to exchange Al{sup 3+} ions in pre-formed IMO NTs, a much simpler procedure compared with direct synthesis.

Phytochemical and anti-fungal activity of crude extracts, fractions ...

African Journals Online (AJOL)

The Minimum Inhibitory Concentrations (MIC) of the crude extracts, fractions and isolated compound were determined by agardilution. Bioassay-guided fractionation of the crude extracts was carried out using column chromatography. Results: The phytochemical screening revealed the presence of alkaloids, cardenolides, ...

Electronic structure and static dipole polarizability of C{sub 60}-C{sub 240}

Energy Technology Data Exchange (ETDEWEB)

Zope, Rajendra R [Department of Physics, University of Texas at El Paso, El Paso, TX 79958 (United States)

2008-04-28

The electronic structure of C{sub 60}-C{sub 240} and its first-order response to a static electric field is studied by an all-electron density functional theory calculation using large polarized Gaussian basis sets. Our results show that the outer C{sub 240} shell almost completely shields the inner C{sub 60} as inferred from the practically identical values of dipole polarizability of the C{sub 60}-C{sub 240} onion (449 A{sup 3}) and that of the isolated C{sub 240} fullerene (441 A{sup 3}). The C{sub 60}-C{sub 240} is thus a near-perfect Faraday cage.

Susceptibility of bacterial isolates from community-acquired infections in sub-Saharan Africa and Asia to macrolide antibiotics.

Science.gov (United States)

Lubell, Yoel; Turner, Paul; Ashley, Elizabeth A; White, Nicholas J

2011-10-01

To review the literature on the susceptibility of common community pathogens in sub-Saharan Africa and Asia to the macrolide antibiotics. Inclusion criteria required that isolates were collected since 2004 to ensure results were of contemporary relevance. The data were aggregated by region, age group and sterility of site of culture sample. A total of 51 studies were identified, which reported the macrolide antimicrobial susceptibilities of common bacterial pathogens isolated since 2004. In general, there was less macrolide resistance in African than in Asian isolates. Most African studies reported high levels of macrolide susceptibility in Streptococcus pneumoniae, whereas most Chinese studies reported high levels of resistance. There was very little information available for Gram-negative organisms. Susceptibility of the pneumococcus to macrolides in SSA remains high in many areas, and good activity of azithromycin has been shown against Salmonellae spp. in Asia. In urban areas where high antibiotic consumption is prevalent, there was evidence of increased resistance to macrolides. However, there is no information on susceptibility from large areas in both continents. © 2011 Blackwell Publishing Ltd.

Neutralization of pharmacological and toxic activities of Bothrops jararacussu snake venom and isolated myotoxins by Serjania erecta methanolic extract and its fractions

Directory of Open Access Journals (Sweden)

RS Fernandes

2011-01-01

Full Text Available Most of the snakebites recorded in Brazil are caused by the Bothrops genus. Given that the local tissue damage caused by this genus cannot be treated by antivenom therapy, numerous studies are focusing on supplementary alternatives, such as the use of medicinal plants. Serjania erecta has already demonstrated anti-inflammatory, antiseptic and healing properties. In the current study, the aerial parts of S. erecta were extracted with methanol, then submitted to chromatographic fractionation on a Sephadex LH20 column and eluted with methanol, which resulted in four main fractions. The crude extract and fractions neutralized the toxic activities of Bothrops jararacussu snake venom and isolated myotoxins (BthTX-I and II. Results showed that phospholipase A2, fibrinogenolytic, myotoxic and hemorrhagic activities were inhibited by the extract. Moreover, the myotoxic and edematous activities induced by BthTX-I, and phospholipase A2 activity induced by BthTX-II, were inhibited by the extract of S. erecta and its fraction. The clotting time on bovine plasma was significantly prolonged by the inhibitory action of fractions SF3 and SF4. This extract is a promising source of natural inhibitors, such as flavonoids and tannins, which act by forming complexes with metal ions and proteins, inhibiting the action of serineproteases, metalloproteases and phospholipases A2.

Inhibition of haemoglobin-mediated lipid oxidation in washed cod muscle and cod protein isolates by Fucus vesiculosus extract and fraction

DEFF Research Database (Denmark)

Wang, Tao; Jonsdottir, Rosa; Kristinsson, Hordur

2010-01-01

washed cod muscle and protein isolates, phlorotannin-enriched ethyl acetate (EtOAc) fraction showed higher inhibitory effect than crude 80% ethanol (EtOH) extract. The addition of oligomeric phlorotannin-rich subfraction (LH-2) separated by Sephadex LH-20 chromatography, completely inhibited...... similar level of TPC and chemical antioxidant activities as oligomeric subfraction LH-2, it was far less efficient in model systems. These results suggest that other factors rather than the intrinsic reactivity toward radicals could be responsible for the inhibitory effect of phlorotannins on lipid...

Final Report for Fractionation and Separation of Polydisperse Nanoparticles into Distinct Monodisperse Fractions Using CO2 Expanded Liquids

Energy Technology Data Exchange (ETDEWEB)

Chistopher Roberts

2007-08-31

The overall objective of this project was to facilitate efficient fractionation and separation of polydisperse metal nanoparticle populations into distinct monodisperse fractions using the tunable solvent properties of gas expanded liquids. Specifically, the dispersibility of ligand-stabilized nanoparticles in an organic solution was controlled by altering the ligand-solvent interaction (solvation) by the addition of carbon dioxide (CO{sub 2}) gas as an antisolvent (thereby tailoring the bulk solvent strength) in a custom high pressure apparatus developed in our lab. This was accomplished by adjusting the CO{sub 2} pressure over the liquid dispersion, resulting in a simple means of tuning the nanoparticle precipitation by size. Overall, this work utilized the highly tunable solvent properties of organic/CO{sub 2} solvent mixtures to selectively size-separate dispersions of polydisperse nanoparticles (ranging from 1 to 20 nm in size) into monodisperse fractions ({+-}1nm). Specifically, three primary tasks were performed to meet the overall objective. Task 1 involved the investigation of the effects of various operating parameters (such as temperature, pressure, ligand length and ligand type) on the efficiency of separation and fractionation of Ag nanoparticles. In addition, a thermodynamic interaction energy model was developed to predict the dispersibility of different sized nanoparticles in the gas expanded liquids at various conditions. Task 2 involved the extension of the experimental procedures identified in task 1 to the separation of other metal particles used in catalysis such as Au as well as other materials such as semiconductor particles (e.g. CdSe). Task 3 involved using the optimal conditions identified in tasks 1 and 2 to scale up the process to handle sample sizes of greater than 1 g. An experimental system was designed to allow nanoparticles of increasingly smaller sizes to be precipitated sequentially in a vertical series of high pressure vessels by