Irrigation strategies that use cutout for optimum boll maturation and yield where growing season duration is limited

Science.gov (United States)

Irrigation water availability is decreasing due to declining water sources and greater competition. Many producers must now comply with annual pumping restrictions that may limit overall productivity of crops like corn (Zea mays L.). Cotton [Gossypium hirsutum (L.)] water demand is less than corn, b...

CORN (Zea mays L. ADAPTATION STUDIES UNDER IRRIGATED CONDITIONS OF SOUTHEASTERN ANATOLIA REGION OF TURKEY

Directory of Open Access Journals (Sweden)

A. Öktem

2000-12-01

Full Text Available Southeastern Anatolia region of Turkey has a great agricultural potential. When the Southeastern Anatolia Project (GAP is complete, 1.7 million hectare area will be irrigated. Corn has a great importance due to have high-yield and being a secondary crop at GAP region which has suitable soil and climate conditions for corn production. The main goal of this study was to determine the suitable corn varieties for GAP region. This research was conducted with 14 hybrid dent corn varieties at Agriculture Faculty in Şanlıurfa province during the growth season of 1997-1998. At this study grain yield, tassel flowering date, plant height, ear length, kernel number of ear, grain weight of ear, 1000 seeds weight and grain moisture at harvest were investigated. Variance analysis results showed that there were significant differences (P<0.01 in grain yield and yield characteristics among tested varieties. According to the average of two years, grain yield varied between 8.83 (Alimax and 13.92 (Rx.770 t /ha and grain moisture at harvest varied from 15.81% (Antbey to 25.92% (P.3394. Antbey had the highest tassel flowering date value (62.3 day and the lowest value was obtained from C.6127 (55.5 day genotype. Plant height varied between 190.5 cm (C.6127 and 243.4 cm (Antbey. Ear length ranged from 18.9 cm (Alimax to 21.8 cm (Tambre. Kernel number of ear varied from 439.0 number/ear (Antbey to 670.9 number/ear (P.3279. The highest grain weight of ear value was obtained from Rx.770 genotype (239.5 g and also the lowest value was 162.1 g (Antbey. 1000 seed weight ranged from 328.9 g (P.3279 to 383.0 g (Tambre. All tested varieties gave over 10 t /ha yield except Alimax, Sele and Antbey varieties.

Nitrogen source effects on nitrous oxide emissions from irrigated no-till corn.

Science.gov (United States)

Halvorson, Ardell D; Del Grosso, Stephen J; Francesco, Alluvione

2010-01-01

Nitrogen fertilization is essential for optimizing crop yields; however, it may potentially increase nitrous oxide (N2O) emissions. The study objective was to assess the ability of commercially available enhanced-efficiency N fertilizers to reduce N2O emissions following their application in comparison with conventional dry granular urea and liquid urea-ammonium nitrate (UAN) fertilizers in an irrigated no-till (NT) corn (Zea mays L.) production system. Four enhanced-efficiency fertilizers were evaluated: two polymer-coated urea products (ESN and Duration III) and two fertilizers containing nitrification and urease inhibitors (SuperU and UAN+AgrotainPlus). Nitrous oxide fluxes were measured during two growing seasons using static, vented chambers and a gas chromatograph analyzer. Enhanced-efficiency fertilizers significantly reduced growing-season N2O-N emissions in comparison with urea, including UAN. SuperU and UAN+AgrotainPlus had significantly lower N2O-N emissions than UAN. Compared with urea, SuperU reduced N2O-N emissions 48%, ESN 34%, Duration III 31%, UAN 27%, and UAN+AgrotainPlus 53% averaged over 2 yr. Compared with UAN, UAN+AgrotainPlus reduced N2O emissions 35% and SuperU 29% averaged over 2 yr. The N2O-N loss as a percentage of N applied was 0.3% for urea, with all other N sources having significantly lower losses. Grain production was not reduced by the use of alternative N sources. This work shows that enhanced-efficiency N fertilizers can potentially reduce N2O-N emissions without affecting yields from irrigated NT corn systems in the semiarid central Great Plains.

Crop response to biochar under differing irrigation levels in the southeastern USA

Science.gov (United States)

Application of biochar to soils is hypothesized to increase crop yield. Crop productivity impacts of biochar application in Southeastern cropping systems consisting of peanut (Arachis hypogaea L.), corn (Zea mays L.), and cotton (Gossypium hirsutum L.) produced under varying rates of irrigation have...

Corn yield and economic return with nitrogen applied through drip tubing

Science.gov (United States)

A two year project was established to determine corn (Zea mays, L) yield response to subsurface (SSDI) and surface (SDI) drip irrigation systems at various nitrogen fertilizer rates. Nitrogen was applied through the drip system at two nitrogen levels in three split applications. Supplemental dry N ...

Compounds formed by treatment of corn (Zea mays) with nitrous acid.

Science.gov (United States)

Archer, M C; Hansen, T J; Tannenbaum, S R

1980-01-01

Nitrohexane has been identified as a major product formed following treatment of corn (Zea mays) with nitrous acid. Preliminary evidence suggests that another compound isolated from the nitrosated corn is an unsaturated nitrolic acid. As an aid to the analysis of N-nitro compounds, we have characterized the response of a chemiluminescence detector (Thermal Energy Analyzer) as a function of pyrolysis chamber temperature for several nitrosamines and for an aliphatic C-nitroso compound, an aromatic C-nitro compound, a nitramine and an alkyl nitrite. The response-temperature profiles are valuable in distinguishing among the various compounds and in optimizing the sensitivity of the detector for use in chromatography. Other tests, including photolysis and stability toward nitrite-scavenging reagents, further aid in distinguishing among the various compounds.

Stover removal effects on seasonal soil water availability under full and deficit irrigation

Science.gov (United States)

Removing corn (Zea mays L.) stover for livestock feed or bioenergy feedstock may impact water availability in the soil profile to support crop growth. The role of stover in affecting soil profile water availability will depend on annual rainfall inputs as well as irrigation level. To assess how res...

Effect of Emamectin Benzoate on Mortality, Proboscis Extension, Gustation and Reproduction of the Corn Earworm, Helicoverpa zea

OpenAIRE

López, Juan D.; Latheef, M. A.; Hoffmann, W. C.

2010-01-01

Newly emerged corn earworm adults, Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae) require a carbohydrate source from plant or other exudates and nectars for dispersal and reproduction. Adults actively seek and forage at feeding sites upon eclosion in the habitat of the larval host plant or during dispersal to, or colonization of, a suitable reproductive habitat. This nocturnal behavior of H. zea has potential for exploitation as a pest management strategy for suppression using an adult fee...

Aphrodisiac Activity of the Aqueous Crude Extract of Purple Corn ( Zea mays) in Male Rats.

Science.gov (United States)

Carro-Juárez, Miguel; Rodríguez-Santiago, Magdalena G; Franco, Miguel Angel; Hueletl-Soto, María Eugenia

2017-10-01

In the present study, the aphrodisiac properties of the purple corn ( Zea mays) in male rats were analyzed. The aqueous crude extract of purple corn (at 25, 50, and 75 mg/kg) was administered to ( a) copulating male rats and ( b) anesthetized and spinal cord transected male rats. Behavioral parameters of copulatory behavior and parameters of the genital motor pattern of ejaculation previous to its inhibition, under the influence of the purple corn extract, are described. Administration of the aqueous crude extract of purple corn significantly facilitates the arousal and execution of male rat sexual behavior without significant influences on the ambulatory behavior. In addition, purple corn extract elicit a significant increase in the number of discharges of the ejaculatory motor patterns and in the total number of genital motor patterns evoked in spinal rats. The present findings show that the aqueous crude extract of purple corn possesses aphrodisiac activity.

Carbon Balance in an Irrigated Corn Field after Inorganic Fertilizer or Manure Application

Science.gov (United States)

Lentz, R. D.; Lehrsch, G. A.

2014-12-01

Little is known about inorganic fertilizer or manure effects on organic carbon (OC) and inorganic C (IC) losses from a furrow irrigated field, particularly in the context of other system C gains or losses. In 2003 and 2004, we measured dissolved organic and inorganic C (DOC, DIC), particulate OC and IC (POC, PIC) concentrations in irrigation inflow, runoff, and percolation waters (6-7 irrigations/y); C inputs from soil amendments and crop biomass; harvested C; and gaseous C emissions from field plots cropped to silage corn (Zea mays L.) in southern Idaho. Annual treatments included: (M) 13 (y 1) and 34 Mg/ha (y 2) stockpiled dairy manure; (F) 78 (yr 1) and 195 kg N/ha (y 2) inorganic N fertilizer; or (NA) no amendment--control. The mean annual total C input into M plots averaged 16.1 Mg/ha, 1.4-times greater than that for NA (11.5 Mg/ha) or F (11.1 Mg/ha), while total C outputs for the three treatments were similar, averaging 11.8 Mg/ha. Thus, the manure plots ended each growing season with an average net gain of 3.8 Mg C/ha (a positive net C flux), while the control (-0.5 Mg C/ha) and fertilizer (-0.4 Mg C/ha) treatments finished the season with a net C loss. Atmospheric CO2 incorporated into the crop biomass contributed 96% of the mean annual C input to NA and F plots but only 68% to M plots. We conclude that nutrient amendments substantially influence the short-term carbon balance of our furrow-irrigated system. Amendments had both direct and indirect influences on individual C components, such as the losses of DIC and POC in runoff and DOC in percolation water, producing temporally complex outcomes which may depend on environmental conditions external to the field.

Molecular cloning and functional characterization of the diapause hormone receptor in the corn earworm Helicoverpa zea

Science.gov (United States)

The diapause hormone (DH) in the heliothine moth has shown its activity in termination of pupal diapause, while the orthology in the silkworm is known to induce embryonic diapause. In the current study, we cloned the diapause hormone receptor from the corn earworm Helicoverpa zea (HzDHr) and tested ...

Comparisons of Herbicide Treated and Cultivated Herbicide-Resistant Corn

OpenAIRE

H. Arnold Bruns; Hamed K. Abbas

2010-01-01

Four glyphosate resistant corn (Zea mays L.) hybrids, a glufosinate-ammonium resistant hybrid, and a conventional atrazine resistant hybrid gown at Stoneville, MS in 2005, 2006, and 2007 with furrow irrigation were treated with their respective herbicides and their growth, yield, and mycotoxin incidence were compared with untreated cultivated plots. Leaf area index (LAI) and dry matter accumulation (DMA) were collected on a weekly basis beginning at growth stage V3 and terminating at anthesi...

Comparison of corn and switchgrass on marginal soils for bioenergy

Energy Technology Data Exchange (ETDEWEB)

Varvel, G.E.; Vogel, K.P.; Mitchell, R.B. [USDA-ARS, 344 Keim Hall, University of Nebraska-Lincoln, P.O. Box 830937, Lincoln, NE 68583-0937 (United States); Follett, R.F. [USDA-ARS, Room S-100, 2150 Centre Avenue Building D, Ft. Collins, CO 80526-8119 (United States); Kimble, J.M. [USDA-NRCS, National Soil Survey Center, 100 Centennial Mall North, Lincoln, NE 68508-3866 (United States)

2008-01-15

Crop residues such as corn (Zea mays L.) stover are viewed as an abundant and inexpensive source of biomass that can be removed from fields to produce bioenergy. Assumptions include that with minimum or no-tillage farming methods, there will be no deleterious production or environmental effects. A long-term field study was established in eastern Nebraska, USA, to compare the switchgrass managed as a biomass energy crop versus no-till corn on a non-irrigated site, marginal for row-crop production, in the western Corn Belt. Our objective in this paper is to report on corn stover removal effects on corn grain yields and potential ethanol production in both cropping systems. Corn, under no-till management, and switchgrass were grown at three N fertilizer levels. In the first 5 years (2001-2005), removal of half the available stover significantly reduced corn yields. During that same time period, the potential ethanol yield for switchgrass was equal to or greater than the potential total ethanol yield of corn grain and harvested stover fertilized at the same optimum N rate. The effect of crop residue removal on crop productivity needs to be investigated in other agro-ecosystems and the potential use of dedicated perennial biomass energy crops should remain a viable renewable energy option on non-irrigated marginal croplands. (author)

Using deficit irrigation with treated wastewater to improve crop water productivity of sweet corn, chickpea, faba bean and quinoa

Directory of Open Access Journals (Sweden)

Abdelaziz HIRICH

2014-07-01

Full Text Available Several experiments were conducted in the south of Morocco (IAV-CHA, Agadir during two seasons 2010 and 2011 in order to evaluate the effect of deficit irrigation with treated wastewater on several crops (quinoa, sweet corn, faba bean and chickpeas. During the first season (2010 three crops were tested, quinoa, chickpeas and sweet corn applying 6 deficit irrigation treatments during all crop stages alternating 100% of full irrigation as non-stress condition and 50% of full irrigation as water deficit condition applied during vegetative growth, flowering and grain filling stage. For all crops, the highest water productivity and yield were obtained when deficit irrigation was applied during the vegetative growth stage. During the second season (2011 two cultivars of quinoa, faba bean and sweet corn have been cultivated applying 6 deficit irrigation treatments (rainfed, 0, 25, 50, 75 and 100% of full irrigation only during the vegetative growth stage, while in the rest of crop cycle full irrigation was provided except for rainfed treatment. For quinoa and faba bean, treatment receiving 50% of full irrigation during vegetative growth stage recorded the highest yield and water productivity, while for sweet corn applying 75% of full irrigation was the optimal treatment in terms of yield and water productivity.

Characteristics and functional properties of purple corn (Zea mays L. var. subnigroviolaceo

Directory of Open Access Journals (Sweden)

Jhoseline Guillén-Sánchez

2014-09-01

Full Text Available Zea Mays L. variety purple (purple corn is a plant native of America, which has the episperm seeds (grains and the cobs (cob in purple, which gives special characteristics to the pigments that have (between 1.5% and 6.0%, called anthocyanins, which belong to the group of flavonoids. Due to its high content of anthocyanins (cianin C3G-3-glucose as its main color and phenolic compounds act as powerful natural antioxidant and anticancer, Further having functional properties due to these bioactive compounds. The purple corn also provides significant amounts of starch, about 80% (complex carbohydrate, 10% of sugars provide sweetness, up to 11% protein, up to 2% minerals and B vitamins and ascorbic acid, concentrated in endosperm (grain free envelope. Also the nutritional value, the purple corn has a rich composition of phytochemicals, which have beneficial effects on our body, such as neutralize free radicals and act as antimutagenic. His review paper aimed to collect information on the studies undertaken to purple corn as an alternative to artificial food dyes and health benefits when included in the diet. Benefits such as cardiovascular diseases (hypertension, lowering cholesterol, fighting diabetes, being the most remarkable antioxidant action (wrinkle.

Value of Neonicotinoid Insecticide Seed Treatments in Mid-South Corn (Zea mays) Production Systems.

Science.gov (United States)

North, J H; Gore, J; Catchot, A L; Stewart, S D; Lorenz, G M; Musser, F R; Cook, D R; Kerns, D L; Leonard, B R; Dodds, D M

2018-02-09

Neonicotinoid seed treatments are one of several effective control options used in corn, Zea mays L., production in the Mid-South for early season insect pests. An analysis was performed on 91 insecticide seed treatment trials from Arkansas, Louisiana, Mississippi, and Tennessee to determine the value of neonicotinoids in corn production systems. The analysis compared neonicotinoid insecticide treated seed plus a fungicide to seed only with the same fungicide. When analyzed by state, corn yields were significantly higher when neonicotinoid seed treatments were used compared to fungicide only treated seed in Louisiana and Mississippi. Corn seed treated with neonicotinoid seed treatments yielded 111, 1,093, 416, and 140 kg/ha, higher than fungicide only treatments for Arkansas, Louisiana, Mississippi, and Tennessee, respectively. Across all states, neonicotinoid seed treatments resulted in a 700 kg/ha advantage compared to fungicide only treated corn seed. Net returns for corn treated with neonicotinoid seed treatment were $1,446/ha compared with $1,390/ha for fungicide only treated corn seed across the Mid-South. Economic returns for neonicotinoid seed treated corn were significantly greater than fungicide-only-treated corn seed in 8 out of 14 yr. When analyzed by state, economic returns for neonicotinoid seed treatments were significantly greater than fungicide-only-treated seed in Louisiana. In some areas, dependent on year, neonicotinoid seed treatments provide significant yield and economic benefits in Mid-South corn. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Phytochemical screening, total phenolic content and phytotoxic activity of corn (Zea mays) extracts against some indicator species.

Science.gov (United States)

Ahmed, Hiwa M

2018-03-01

Allelopathic effects of corn (Zea mays) extracts was studied, against seed germination and seedling growth of Phalaris minor, Helianthus annuus, Triticumaestivum, Sorghum halepense, Z. mays. Bioassay results showed that aqueous extracts of corn root and shoot, markedly affected seed germination, and other parameters compared with related controls. Preliminary phytochemical screening revealed the presence of various phytochemicals such as tannins, phlobatannins, flavonoids, terpenoids and alkaloids in both roots and shoot aqueous extracts. However, saponins were only present in the shoot aqueous extract, while in shoot ethanol extracts, only terpenoids and alkaloids were detected. Additionally, total polyphenolic (TPC) content in aqueous extracts of corn root and shoot, plus ethanol extracts of corn shoot were determined using an Ultraviolet-visible spectroscopy. Results revealed TPC content of the corn shoot aqueous extract showed the highest yield, compared to other extracts. These findings suggest that phytochemicals present in Z. mays extracts may contribute to allelopathy effect.

Characteristics of Analog Rice From Potato Flour (Solanum Tuberosom L.) Corn Flour (Zea Mays L.) and Sago Flour (Arenga Microcarpa Beccari)

OpenAIRE

Korompis, Olga S; Mamuaja, Christine F; Mandey, Lucia C

2016-01-01

Potato (Solanum tuberosum L.), corn (Zea mays L.) and sago (Arenga microcarpa Beccari) are crops containing high carbohydrate, as source of calory food, and those can be made into rice analog. This study aimed: (1) to determine the formulations by organoleptic test in manufacture analog rice from potato flour, corn flour and sago flour, and (2) to analyze the physical properties, chemical properties of rice analog from potato flour with the addition of corn flour and sago flour. The research ...

Long-term no-till and stover retention each decrease the global warming potential of irrigated continuous corn.

Science.gov (United States)

Jin, Virginia L; Schmer, Marty R; Stewart, Catherine E; Sindelar, Aaron J; Varvel, Gary E; Wienhold, Brian J

2017-07-01

Over the last 50 years, the most increase in cultivated land area globally has been due to a doubling of irrigated land. Long-term agronomic management impacts on soil organic carbon (SOC) stocks, soil greenhouse gas (GHG) emissions, and global warming potential (GWP) in irrigated systems, however, remain relatively unknown. Here, residue and tillage management effects were quantified by measuring soil nitrous oxide (N 2 O) and methane (CH 4 ) fluxes and SOC changes (ΔSOC) at a long-term, irrigated continuous corn (Zea mays L.) system in eastern Nebraska, United States. Management treatments began in 2002, and measured treatments included no or high stover removal (0 or 6.8 Mg DM ha -1  yr -1 , respectively) under no-till (NT) or conventional disk tillage (CT) with full irrigation (n = 4). Soil N 2 O and CH 4 fluxes were measured for five crop-years (2011-2015), and ΔSOC was determined on an equivalent mass basis to ~30 cm soil depth. Both area- and yield-scaled soil N 2 O emissions were greater with stover retention compared to removal and for CT compared to NT, with no interaction between stover and tillage practices. Methane comprised <1% of total emissions, with NT being CH 4 neutral and CT a CH 4 source. Surface SOC decreased with stover removal and with CT after 14 years of management. When ΔSOC, soil GHG emissions, and agronomic energy usage were used to calculate system GWP, all management systems were net GHG sources. Conservation practices (NT, stover retention) each decreased system GWP compared to conventional practices (CT, stover removal), but pairing conservation practices conferred no additional mitigation benefit. Although cropping system, management equipment/timing/history, soil type, location, weather, and the depth to which ΔSOC is measured affect the GWP outcomes of irrigated systems at large, this long-term irrigated study provides valuable empirical evidence of how management decisions can impact soil GHG emissions and surface

Intraear Compensation of Field Corn, Zea mays, from Simulated and Naturally Occurring Injury by Ear-Feeding Larvae.

Science.gov (United States)

Steckel, S; Stewart, S D

2015-06-01

Ear-feeding larvae, such as corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), can be important insect pests of field corn, Zea mays L., by feeding on kernels. Recently introduced, stacked Bacillus thuringiensis (Bt) traits provide improved protection from ear-feeding larvae. Thus, our objective was to evaluate how injury to kernels in the ear tip might affect yield when this injury was inflicted at the blister and milk stages. In 2010, simulated corn earworm injury reduced total kernel weight (i.e., yield) at both the blister and milk stage. In 2011, injury to ear tips at the milk stage affected total kernel weight. No differences in total kernel weight were found in 2013, regardless of when or how much injury was inflicted. Our data suggested that kernels within the same ear could compensate for injury to ear tips by increasing in size, but this increase was not always statistically significant or sufficient to overcome high levels of kernel injury. For naturally occurring injury observed on multiple corn hybrids during 2011 and 2012, our analyses showed either no or a minimal relationship between number of kernels injured by ear-feeding larvae and the total number of kernels per ear, total kernel weight, or the size of individual kernels. The results indicate that intraear compensation for kernel injury to ear tips can occur under at least some conditions. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Promoting Student Inquiry Using "Zea Mays" (Corn) Cultivars for Hypothesis-Driven Experimentation in a Majors Introductory Biology Course

Science.gov (United States)

Blair, Amy C.; Peters, Brenda J.; Bendixen, Conrad W.

2014-01-01

The AAAS Vision and Change report (2011) recommends incorporating student research experiences into the biology curriculum at the undergraduate level. This article describes, in detail, how "Zea mays" (corn) cultivars were used as a model for a hypothesis-driven short-term research project in an introductory biology course at a small…

Euxesta spp. NEW PEST IN Zea mays L. VAR. rugosa: ASSOCIATION WITH Heliothis zea ATTACKS IN SPRING AND SUMMER SEEDS

Directory of Open Access Journals (Sweden)

María Cecilia Curis

2015-12-01

Full Text Available The "corn silk fly" of maize (Euxesta spp. Loew, 1868 appeared in 2005 in Santa Fe (Argentina, causing damage to the ears. The attacks are related to temperature, crop growth stage and previous attack of other pests. For this new pest, we determined the species present, the damage on Bt sweet corn plantings in two seasons (August and February, the association of attacks with Heliothis zea (Boddie, 1850 and the presence of parasitoids. Larvae counts of H. zea and Euxesta spp. began in the phenological stage of R2 and ended in R5 and consisted of removing at random from each batch (three for each planting season four ears. In laboratory we determined the percentage of damage on the ears and number of larvae of Euxesta spp. and H. zea, discriminated by size. Fly was identified as E. eluta, damage was greatest in the early spring planting corn. Attacks were correlated with H. zea.

Performance of irrigated green corn cultivars in different plant populations at sowing

Directory of Open Access Journals (Sweden)

José C. Soares Neto

Full Text Available ABSTRACT This study aimed to evaluate the yield of green corn hybrids grown under irrigation in different plant populations at sowing. The assay was carried out in the experimental area located in the city of Arapiraca, Alagoas State, Brazil, from November 2015 to January 2016. A randomized complete block design (RCBD was used, in a 2 x 5 factorial scheme with four replicates. A double- and a single-cross hybrid (AG 1051 and BM 3061, which are suitable for green corn production, were cultivated in five spacings between plants at sowing (15.0, 17.5, 20.0, 22.5 and 25.0 cm. The characteristics photosynthetic rate (PR, ear length with rusk (HEL and without husk (UEL, husked ear weight (HEW, unhusked ear weight (UEW, percentage of marketable ears (%ME and weight of husk (HW were evaluated. The double- and single-cross hybrids AG 1051 and BM 3061 showed green ears with commercial standard. The cultivar BM 3061 showed the best results for most of the characteristics related to the performance of green corn (PR, HEL, UEL, UEW, HEW, %ME. The spacing of 17.5 cm between plants at sowing was the most indicated for irrigated green corn cultivation.

Efecto de variante de riego en la producción de maíz (zea mays l. En la Comuna Río Verde, cantón Santa Elena, Ecuador.

Directory of Open Access Journals (Sweden)

Ángel León

2016-11-01

Effect of irrigation variant in the corn production (Zea mays L. at Río Verde commune, Santa Elena, Ecuador. The test was conducted at the Production and Practice Center Río Verde, owned by the Santa Elena Peninsula State University, located in Río Verde commune, Santa Elena canton, the research aimed to evaluate the effect of irrigation variations into agronomic performance of corn under different irrigation sheets using as measuring tool evaporation A class Pan. The treatments were five doses of irrigation 60, 70, 80, 90 and 100% of evapotranspiration, treatments were placed in a complete randomized design of blocks with four replications, the averages compared with the Tukey test (p> 0.05. The regression analysis fits a quadratic equation and the coefficient of determination R2 0,91 which shows the high degree of dependence of results based on irrigation variants. The highest production was obtained by the treatment with 90% with 12,18 t.ha-1.

Spray particle drift mitigation using field corn (Zea mays L.) as a drift barrier.

Science.gov (United States)

Vieira, Bruno C; Butts, Thomas R; Rodrigues, Andre O; Golus, Jeffrey A; Schroeder, Kasey; Kruger, Greg R

2018-04-24

Herbicide particle drift reduces application efficacy and can cause severe impacts on nearby vegetation depending on the herbicide mode-of-action, exposure level, and tolerance to the herbicide. A particle drift mitigation effort placing windbreaks or barriers on the field boundaries to reduce off-target movement of spray particles has been utilized in the past. The objective of this research was to evaluate the effectiveness of field corn (Zea mays L.) at different heights as a particle drift barrier. Applications with a non-air inclusion flat fan nozzle (ER11004) resulted in greater particle drift when compared to an air inclusion nozzle (TTI11004). Eight rows of corn were used as barriers (0.91, 1.22, and 1.98 m height) which reduced the particle drift for both nozzles, especially at shorter downwind distances. Applications with the ER11004 nozzle without corn barriers had 1% of the applied rate (D 99 ) predicted to deposit at 14.8 m downwind, whereas this distance was reduced (up to 7-fold) when applications were performed with corn barriers. The combination of corn drift barriers and nozzle selection (TTI11004) provided satisfactory particle drift reduction when the D 99 estimates were compared to applications with the ER11004 nozzle without corn barriers (up to 10-fold difference). The corn drift barriers were effective in reducing particle drift from applications with the ER11004 and the TTI11004 nozzles (Fine and Ultra Coarse spray classifications, respectively). The corn drift barrier had appropriate porosity and width as the airborne spray was captured within its canopy instead of deflecting up and over it. This article is protected by copyright. All rights reserved.

Extração de corantes de milho (Zea mays L. Extraction of corn colorants (Zea mays L.

Directory of Open Access Journals (Sweden)

Felix Martin Cabajal Gamarra

2009-03-01

Full Text Available Os corantes naturais foram amplamente utilizados de forma artesanal até antes do surgimento dos corantes sintéticos. O estudo e uso dos corantes naturais voltaram a ter importância nestes últimos anos devido aos questionamentos dos organismos internacionais da saúde e dos consumidores pelo uso indiscriminado dos corantes sintéticos, ligados ao desenvolvimento de doenças degenerativas e ao impacto ambiental. O corante extraído do milho roxo (Zea mays L. tem sido utilizado ao longo da história pela civilização Inca na preparação de alimentos e no tingimento de fibras têxteis. Neste trabalho, os pigmentos do grupo das antocianinas foram extraídos das variedades de milho roxo e do milho vermelho (Z. mays L. e depois foram caracterizados. Três métodos de extração foram utilizados: imersão, lixiviação com algumas modificações e extração supercrítica (ESC. O melhor método para extração foi o da lixiviação que alcançou 88% (m/m de rendimento, em função da massa do corante extraído e da matéria-prima. Também utilizando a lixiviação modificada, foi possível concentrar em 3% os compostos acilados, assim como recuperar 85% dos solventes utilizados. Um indicador de pH foi obtido pela fixação das antocianinas num papel de filtro, com base na estabilidade das antocianinas, ferramenta que pode ser utilizada em laboratórios de ensino de química.Natural colorants were craftly made and widely used before the discovery of the synthetic colorants. The study and the use of natural colorants have become important again in the last few years due to questions raised by the international health organizations and consumers related to the indiscriminate use of synthetic colorants which were linked to the development of degenerative illnesses and environmental impact. The colorant extracted from purple corn (Zea Mays L. was used by the Inca civilization to prepare food and to dye textile fibers. In this work, pigments from the

Water stress and nitrogen limitation effects on corn (Zea mays L.) competition with a C3 and a C4 weed.

Science.gov (United States)

Zand, E; Soufizadeh, S; Eskandari, A

2006-01-01

To examine how drought and nitrogen limitation might affect crop competitive ability with C3 or C4 weeds, a two year experiment was conducted at the research field of Plant Pest and Disease Research Institute, Karaj, in 2002 and 2003. Irrigation interval (every 7d and 14d (moderate drought stress)), nitrogen rate (recommended and 1/4 recommended), and crop-weed competition (corn, corn-common lambsquarters (Chenopodium album L.), corn-redroot pigweed (Amaranthus retroflexus L.), and corn-common lambsquarters-redroot pigweed) were studied in a split-factorial design with 4 replications, with irrigation interval as the main plot, and factorial combination of the other two factors as the sub-plot. Grain yield, harvest index (HI), water and nitrogen use efficiencies (WUE and NUE, respectively) were measured at harvest. Drought and nitrogen deficiency reduced corn grain yield and HI (except for corn-redroot pigweed and corn-common lambsquarters treatments under drought stress). Redroot pigweed was found inhibitorier to corn compared to common lambsquarters in all irrigation and nitrogen levels. Corn WUE reduced under drought condition and competition, but drought caused less reduction in corn WUE when it competed with common lambsquarters compared to redroot pigweed. This shows that drought has more negative effect on C3 weeds (probably due to higher reduction in stomatal conductance and increment in photo-respiration under these conditions compared to a C4 plant). The same result was obtained for corn NUE under nitrogen limitation and competition. In other words, nitrogen deficiency had more inhibitory effect on common lambsquarters competitive ability compared with redroot pigweed. Totally, it was concluded that drought stress and nitrogen deficiency, as the two results of climate change, had more negative effect on C3 weeds compared with C4.

THE EFFECT OF FORMULATION HUMIC SUBSTANCE AND Trichoderma sp TO INCREASE PRODUCTION AND GROWTH OF CORN (Zea Mays,L

Directory of Open Access Journals (Sweden)

Ruly Eko Kusuma Kurniawan

2017-06-01

Full Text Available Research to determine of formulation humic subtance and Trichoderma sp to increase the production and growth of corn (zea mays,L. This research was conducted by extracting humic substance with fractionation organic matter method from cattle manure organic material. Trichoderma sp grow on corn medium and harvested after reaching a density of 1015 cfu. Created this compound formulation with mixing humic substance and Trichoderma sp. Indicator plant with F1 sweet corn Jago varieties. Aplication used humic substance in range 8%, 16%, and 32% on the recommended use NPK fertilizer for corn, as well as control without humic substance. The result showed application use 8% humic substance most good for plant growth and harvest. Additionally, nutrient uptake NPK fertilizer efficiency is increased and more effective than control and use of the formulation 16% and 32% humic substance.

Field-Evolved Resistance in Corn Earworm to Cry Proteins Expressed by Transgenic Sweet Corn

Science.gov (United States)

Dively, Galen P.; Finkenbinder, Chad

2016-01-01

Background Transgenic corn engineered with genes expressing insecticidal toxins from the bacterium Bacillus thuringiensis (Berliner) (Bt) are now a major tool in insect pest management. With its widespread use, insect resistance is a major threat to the sustainability of the Bt transgenic technology. For all Bt corn expressing Cry toxins, the high dose requirement for resistance management is not achieved for corn earworm, Helicoverpa zea (Boddie), which is more tolerant to the Bt toxins. Methodology/Major Findings We present field monitoring data using Cry1Ab (1996–2016) and Cry1A.105+Cry2Ab2 (2010–2016) expressing sweet corn hybrids as in-field screens to measure changes in field efficacy and Cry toxin susceptibility to H. zea. Larvae successfully damaged an increasing proportion of ears, consumed more kernel area, and reached later developmental stages (4th - 6th instars) in both types of Bt hybrids (Cry1Ab—event Bt11, and Cry1A.105+Cry2Ab2—event MON89034) since their commercial introduction. Yearly patterns of H. zea population abundance were unrelated to reductions in control efficacy. There was no evidence of field efficacy or tissue toxicity differences among different Cry1Ab hybrids that could contribute to the decline in control efficacy. Supportive data from laboratory bioassays demonstrate significant differences in weight gain and fitness characteristics between the Maryland H. zea strain and a susceptible strain. In bioassays with Cry1Ab expressing green leaf tissue, Maryland H. zea strain gained more weight than the susceptible strain at all concentrations tested. Fitness of the Maryland H. zea strain was significantly lower than that of the susceptible strain as indicated by lower hatch rate, longer time to adult eclosion, lower pupal weight, and reduced survival to adulthood. Conclusions/Significance After ruling out possible contributing factors, the rapid change in field efficacy in recent years and decreased susceptibility of H. zea to Bt

Potential of kenaf (Hibiscus cannabinus L.) and corn (Zea mays L.) for phytoremediation of dredging sludge contaminated by trace metals.

Science.gov (United States)

Arbaoui, Sarra; Evlard, Aricia; Mhamdi, Mohamed El Wafi; Campanella, Bruno; Paul, Roger; Bettaieb, Taoufik

2013-07-01

The potential of kenaf (Hibiscus cannabinus L.) and corn (Zea mays L.) for accumulation of cadmium and zinc was investigated. Plants have been grown in lysimetres containing dredging sludge, a substratum naturally rich in trace metals. Biomass production was determined. Sludge and water percolating from lysimeters were analyzed by atomic absorption spectrometry. No visible symptoms of toxicity were observed during the three- month culture. Kenaf and corn tolerate trace metals content in sludge. Results showed that Zn and Cd were found in corn and kenaf shoots at different levels, 2.49 mg/kg of Cd and 82.5 mg/kg of Zn in kenaf shoots and 2.1 mg/kg of Cd and 10.19 mg/kg in corn shoots. Quantities of extracted trace metals showed that decontamination of Zn and Cd polluted substrates is possible by corn and kenaf crops. Tolerance and bioaccumulation factors indicated that both species could be used in phytoremediation.

ent-Kaurane Diterpenoids with Neuroprotective Properties from Corn Silk ( Zea mays).

Science.gov (United States)

Qi, Xiao-Li; Zhang, Ying-Ying; Zhao, Peng; Zhou, Le; Wang, Xiao-Bo; Huang, Xiao-Xiao; Lin, Bin; Song, Shao-Jiang

2018-05-25

Thirteen new ent-kaurane diterpenoids, stigmaydenes A-M (1-13), together with two known compounds (14, 15), were isolated from the crude extract of corn silk ( Zea mays). The structures of the compounds were confirmed by comprehensive spectroscopic analyses. The absolute configuration of compound 1 was defined by single-crystal X-ray diffraction. The absolute configurations of the compounds were also confirmed by comparison of experimental and calculated specific rotations. The compounds were evaluated for their neuroprotective effects against H 2 O 2 -induced SH-SY5Y cell injury, and compound 8 was active at 100 μM, as determined by flow cytometry (annexin V-FITC/PI staining) and Hoechst 33258 staining. The results suggested that compound 8 could protect neuronal cells from H 2 O 2 -induced injury by inhibiting apoptosis in SH-SY5Y cells.

Evaluation of the Effect of Different Irrigation Levels of Drip Irrigation (Tape on Yield and Yield Components of Corn

Directory of Open Access Journals (Sweden)

mohammad karimi

2016-02-01

Full Text Available Introduction: One of the serious problems in the further development of maize cultivation is increasing irrigation efficiency. Using conventional irrigation causes a shortage of water resources to increase the acreage of the crop. With regard to the development of maize cultivation, agronomic and executable methods must be studied to reduce water consumption. Using drip irrigation system is most suitable for row crops. Hamedi et al. (2005 compared drip (tape and surface irrigation systems on yield of maize in different levels of water requirement and indicated that drip irrigation increases the amount of yield to 2015 kg/ha and water use efficiency to 3 time. Kohi et al. (2005 investigated the effects of deficit irrigation use of drip (tape irrigation on water use efficiency on maize in planting of one and two rows. The results showed that maximum water use efficiency related to crop density, water requirement and planting pattern 85000, 125% and two rows, respectively with 1.46 kg/m3. Jafari and Ashrafi (2011 studied the effects of irrigation levels, plant density and planting pattern in drip irrigation (tape on corn. The results showed that the amount of irrigation water and crop density on the level of 1% and their interactions and method of planting were significant at the 5 and 10% on water use efficiency, respectively. The yield was measured under different levels of irrigation, crop density and method of planting and the difference was significant on the level of 1%. Lamm et al. (1995 studied water requirement of maize in field with silt loam texture under sub drip irrigation and reported that water use reduced to 75%; but yield of maize remained at maximum amount of 12.5 t/ha. The objective of this study was to evaluate the drip (tape irrigation method for corn production practices in the Qazvin province in Iran. Materials and Methods: In this study, yield and yield components of corn (SC 704 were investigated under different levels of

Effect of emamectin benzoate on mortality, proboscis extension, gustation and reproduction of the corn earworm, Helicoverpa zea.

Science.gov (United States)

López, Juan D; Latheef, M A; Hoffmann, W C

2010-01-01

Newly emerged corn earworm adults, Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae) require a carbohydrate source from plant or other exudates and nectars for dispersal and reproduction. Adults actively seek and forage at feeding sites upon eclosion in the habitat of the larval host plant or during dispersal to, or colonization of, a suitable reproductive habitat. This nocturnal behavior of H. zea has potential for exploitation as a pest management strategy for suppression using an adult feeding approach. This approach entails the use of a feeding attractant and stimulant in combination with a toxicant that when ingested by the adult will either reduce fecundity/fertility at sub-lethal dosages or kill the adult. The intent of this study was to assess reproductive inhibition and toxicity of emamectin benzoate on H. zea when ingested by the adults when mixed in ppm active ingredient (wt:vol) with 2.5 M sucrose as a feeding stimulant. Because the mixture has to be ingested to function, the effect of emamectin benzoate was also evaluated at sub-lethal and lethal concentrations on proboscis extension and gustatory response of H. zea in the laboratory. Feral males captured in sex pheromone-baited traps in the field were used for toxicity evaluations because they were readily available and were more representative of the field populations than laboratory-reared adults. Laboratory-reared female moths were used for reproduction effects because it is very difficult to collect newly emerged feral females from the field. Emamectin benzoate was highly toxic to feral H. zea males with LC(50) values (95% CL) being 0.718 (0.532-0.878), 0.525 (0.316-0.751), and 0.182 (0.06-0.294) ppm for 24, 48 and 72 h responses, respectively. Sub-lethal concentrations of emamectin benzoate did not significantly reduce proboscis extension response of feral males and gustatory response of female H. zea. Sublethal concentrations of emamectin benzoate significantly reduced percent larval hatch of

Effects Of Irrigation With Saline Water, And Soil Type On Germination And Seedling Growth Of Sweet Maize (Zea Mays L.)

International Nuclear Information System (INIS)

Mostafa, A.Z.; Amato, M.; Hamdi, A.; Mostafa, A.Z.; Galal, Y.G.M.; Lotfy, S.M.

2012-01-01

Germination and early growth of maize Sweet Maize (Zea mays L.), var. (SEL. CONETA) under irrigation with saline water were investigated in a pot experiment with different soil types. Seven salinity levels of irrigation water up to 12 dS/m were used on a Clay soil (C) and a Sandy-Loam (SL). Emergence of maize was delayed under irrigation with saline water, and the final percentage of germination was reduced only at 8 dS/m or above. Seedling shoot and root growth were reduced starting at 4 dS/m of irrigation water. Salts accumulated more in the C soil but reductions in final germination rate and seedling growth were larger in the SL soil, although differences were not always significant. Data indicate that germination is rather tolerant to salinity level in var. SEL. CONETA whereas seedling growth is reduced at moderate salinity levels, and that soil type affects plant performance under irrigation with saline water

Banding urea and lignosulfonate in corn (Zea mays L.) production and 15N recovery

International Nuclear Information System (INIS)

Alkanani, T.; MacKenzie, A.F.

1996-01-01

The use of urea in corn (Zea mays L.) production is common. Under current N fertilizer recommendations for corn, urea may have adverse effects on corn growth when applied in a band. The effects of ammonium lignosulfonate (LS) on corn growth and on N uptake from the banded application of urea and diammonium phosphate (DAP) mixtures were investigated on two soils from eastern Quebec. Field experiments were initiated in the first week of May 1991 on an Ormstown silty clay and a Ste. Rosalie clay soils (fine, mixed, nonacid, mesic Typic Humaquepts). Treatments were two rates of urea (30 and 90 kg urea-N ha -1 ) in a combination with DAP (14kg N ha 1 ), with or without banded fertilizer solutions of LS (8 kg N ha -1 ) applied at planting 5 cm to the side and 3 cm below the seed. A no treatment control was included. The low rate of urea compared with the unfertilized plots. When compared with the unfertilized treatment, the high rate of urea and DAP (no LS added) caused 10% increase in grain yield. However, addition of LS to the high rate of urea and DAP increase grain yield by band 20%. In general, LS significantly increased corn N uptake from urea on both soils. Separate 15 N field experiments were initiated in June 1991. Mean recovery of 15 N ranged from 17.8% to 30.9% of the applied labelled urea. The rate of urea-N banded had no significant effect on immobilization, but LS resulted in significantly less 15 N immobilized. These observations suggest that LS can reduce the biological immobilization of urea-N and increase the efficiency of urea fertilizer by reducing the negative effects of banding high levels of urea, while attaining benefits of band placement. (author). 29 refs., 6 tabs

Comparison of different extraction methods for giberelic acid obtention from corn (Zea mays L. germinated seeds

Directory of Open Access Journals (Sweden)

Juan David Rivera

2017-05-01

Full Text Available Corn (Zea mays L. is the second most cultivated cereal in the world and is use as raw material for different kind of industries. To date no reports about obtaining giberellic acid (GA3 from corn have been found. In the present study two methods for extracting solid samples were evaluated: lixiviation and dynamic sonication-assisted solvent extraction (DSASE, for obtaining giberellic acid from corn germinated seeds. In lixiviation, the physical method (agitation and sonication, solvent, and time were the parameters analyzed; while in DSASE the variables were: solvent, flow, and time. The most efficient technique was DSASE employing acetonitrile-formic acid 5% (80:20, v:v as solvent at a flow of 0.4 mL/min for 25,0 min, obtaining a concentration 30.012 mg/kg giberellic acid. The identification and quantification were performed by high performance liquid chromatography (HPLC with diode array detector (DAD. These results showed that dynamic sonication-assisted solvent extraction (DSASE is a novel and powerful alternative technique for obtaining giberellic acid, because of its high efficiency; low solvent consumption and simplicity in obtaining the extract.

Magnitude differences in agronomic, chemical, nutritional, and structural features among different varieties of forage corn grown on dry land and irrigated land.

Science.gov (United States)

Xin, Hangshu; Abeysekara, Samen; Zhang, Xuewei; Yu, Peiqiang

2015-03-11

In this study, eight varieties of corn forage grown in semiarid western Canada (including Pioneer P2501, Pioneer P39m26, Pioneer P7443, Hyland HL3085, Hyland HLBaxxos, Hyland HLR219, Hyland HLSR22, and Pickseed Silex BT) were selected to explore the effect of irrigation implementation in comparison with nonirrigation on (1) agronomic characteristics, (2) basic chemical profiles explored by using a near-infrared reflectance (NIR) system, and (3) protein and carbohydrate internal structural parameters revealed by using an attenuated total reflectance-Fourier transform infrared spectroscopy (ATR-FTIR) system. Also, principal component analysis (PCA) was performed on spectroscopic data for clarification of differences in molecular structural makeup among the varieties. The results showed that irrigation treatment significantly increased (P forages. Significant interactions of irrigation treatment and corn variety were observed on most agronomic characteristics (DM yield, T/ha, days to tasseling, days to silking) and crude fiber (CF) and ether extract (EE) contents as well as some spectral data such as cellulosic compounds (CELC) peak intensity, peak ratios of CHO third peak to CELC, α-helix to β-sheet, and CHO third peak to amide I. Additionally, the spectral ratios of chemical functional groups that related to structural and nonstructural carbohydrates and protein polymers in forages did not remain constant over corn varieties cultivated with and without water treatment. Moreover, different cultivars had different growth, structure, and nutrition performances in this study. Although significant differences could be found in peak intensities, PCA results indicated some structural similarities existed between two treated corn forages with the exception of HL3085 and HLBaxxos. In conclusion, irrigation and corn variety had interaction effects on agronomic, chemical, nutritional, and structural features. Further study on the optimum level of irrigation for corn forage

7 CFR 810.401 - Definition of corn.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of corn. 810.401 Section 810.401... GRAIN United States Standards for Corn Terms Defined § 810.401 Definition of corn. Grain that consists of 50 percent or more of whole kernels of shelled dent corn and/or shelled flint corn (Zea mays L...

Impact of Corn Earworm (Lepidoptera: Noctuidae) on Field Corn (Poales: Poaceae) Yield and Grain Quality.

Science.gov (United States)

Bibb, Jenny L; Cook, Donald; Catchot, Angus; Musser, Fred; Stewart, Scott D; Leonard, Billy Rogers; Buntin, G David; Kerns, David; Allen, Tom W; Gore, Jeffrey

2018-05-28

Corn earworm, Helicoverpa zea (Boddie), commonly infests field corn, Zea mays (L.). The combination of corn plant biology, corn earworm behavior in corn ecosystems, and field corn value renders corn earworm management with foliar insecticides noneconomical. Corn technologies containing Bacillus thuringiensis (Bt) Berliner (Bacillales: Bacillaceae) were introduced that exhibit substantial efficacy against corn earworm and may reduce mycotoxin contamination in grain. The first generation Bt traits in field corn demonstrated limited activity on corn earworm feeding on grain. The pyramided corn technologies have greater cumulative protein concentrations and higher expression throughout the plant, so these corn traits should provide effective management of this pest. Additionally, reduced kernel injury may affect physical grain quality. Experiments were conducted during 2011-2012 to investigate corn earworm impact on field corn yield and grain quality. Treatments included field corn hybrids expressing the Herculex, YieldGard, and Genuity VT Triple Pro technologies. Supplemental insecticide treatments were applied every 1-2 d from silk emergence until silk senescence to create a range of injured kernels for each technology. No significant relationship between the number of corn earworm damaged kernels and yield was observed for any technology/hybrid. In these studies, corn earworm larvae did not cause enough damage to impact yield. Additionally, no consistent relationship between corn earworm damage and aflatoxin contamination was observed. Based on these data, the economic value of pyramided Bt corn traits to corn producers, in the southern United States, appears to be from management of other lepidopteran insect pests including European and southwestern corn borer.

Effect of Irrigation Timing on Root Zone Soil Temperature, Root Growth and Grain Yield and Chemical Composition in Corn

Directory of Open Access Journals (Sweden)

Xuejun Dong

2016-05-01

Full Text Available High air temperatures during the crop growing season can reduce harvestable yields in major agronomic crops worldwide. Repeated and prolonged high night air temperature stress may compromise plant growth and yield. Crop varieties with improved heat tolerance traits as well as crop management strategies at the farm scale are thus needed for climate change mitigation. Crop yield is especially sensitive to night-time warming trends. Current studies are mostly directed to the elevated night-time air temperature and its impact on crop growth and yield, but less attention is given to the understanding of night-time soil temperature management. Delivering irrigation water through drip early evening may reduce soil temperature and thus improve plant growth. In addition, corn growers typically use high-stature varieties that inevitably incur excessive respiratory carbon loss from roots and transpiration water loss under high night temperature conditions. The main objective of this study was to see if root-zone soil temperature can be reduced through drip irrigation applied at night-time, vs. daytime, using three corn hybrids of different above-ground architecture in Uvalde, TX where day and night temperatures during corn growing season are above U.S. averages. The experiment was conducted in 2014. Our results suggested that delivering well-water at night-time through drip irrigation reduced root-zone soil temperature by 0.6 °C, increase root length five folds, plant height 2%, and marginally increased grain yield by 10%. However, irrigation timing did not significantly affect leaf chlorophyll level and kernel crude protein, phosphorous, fat and starch concentrations. Different from our hypothesis, the shorter, more compact corn hybrid did not exhibit a higher yield and growth as compared with taller hybrids. As adjusting irrigation timing would not incur an extra cost for farmers, the finding reported here had immediate practical implications for farm

Geographic information systems in corn rootworm management

Science.gov (United States)

Corn rootworms (Diabrotica spp. Coleoptera: Chrysomelidae) are serious pests of corn (Zea mays) in the United States and Europe. Control measures for corn rootworms (CRW) were historically based upon chemical pesticides and crop rotation. Pesticide use created environmental and economic concerns. In...

Evaluation of seed yield and competition indices of corn (Zea mays L. intercropped with different bean (Phaseolus spp. types

Directory of Open Access Journals (Sweden)

Hakime Ziaei

2016-05-01

Full Text Available In order to evaluate the intercropping of corn (Zea mays L. and bean cultivars (Phaseolus spp. an experiment was carried out in a randomized complete block design with three replicaties at Sari Agricultural Sciences and Natural Resources University during growing season of 2010. The experimental treatments consisted of sole cropping of corn, white bean, bush bean, red bean, pinto bean and sword bean and 50:50 ratio of corn and bean types. In this experiment, the corn-bush bean and corn-pinto bean intercropping had the highest seed yield (5734.4 and 5674.3 kg/ha-1, respectively and land equivalent ratio (LER=1.13 and 1.21, respectively. Evaluated intercropping indices indicated that red bean (k= 1.85, pinto bean (k= 2.41 and sword bean (k= 2.80 had the highest crowding coefficient whereas the maximum aggressivity value was belonged to pinto bean intercropped with corn (A= -0.02. Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.

Corn Culture: A Story of Intelligent Design

Science.gov (United States)

Todd, Jude

2008-01-01

Scientists are not sure of how corn was created. There were two competing genetic theories about how corn came to be. One theory maintains that corn had been teased out of a wheatlike grass called teosinte (genus Zea), and the other contends that one now-extinct ancestor of corn had crossed with another grass, "Tripsacum," several millennia ago.…

Identification and characterization of endophytic bacteria from corn (Zea mays L.) roots with biotechnological potential in agriculture.

Science.gov (United States)

Szilagyi-Zecchin, Vivian Jaskiw; Ikeda, Angela Cristina; Hungria, Mariangela; Adamoski, Douglas; Kava-Cordeiro, Vanessa; Glienke, Chirlei; Galli-Terasawa, Lygia Vitória

2014-01-01

Six endophytic bacteria of corn roots were identified as Bacillus sp. and as Enterobacter sp, by sequencing of the 16S rRNA gene. Four of the strains, CNPSo 2476, CNPSo 2477, CNPSo 2478 and CNPSo 2480 were positive for the nitrogen fixation ability evaluated through the acetylene reduction assay and amplification of nifH gene. Two Bacillus strains (CNPSo 2477 and CNPSo 2478) showed outstanding skills for the production of IAA, siderophores and lytic enzymes, but were not good candidates as growth promoters, because they reduced seed germination. However, the same strains were antagonists against the pathogenic fungi Fusarium verticillioides, Colletotrichum graminicola, Bipolaris maydis and Cercospora zea-maydis. As an indication of favorable bacterial action, Enterobacter sp. CNPSo 2480 and Bacillus sp. CNPSo 2481 increased the root volume by 44% and 39%, respectively, and the seed germination by 47% and 56%, respectively. Therefore, these two strains are good candidates for future testing as biological inoculants for corn.

The effects of use self-propelled rain guns (typhone) in irrigation of corn (Zea mays L.)

OpenAIRE

Kresović, Branka; Dragičević, Vesna; Gajić, Boško; Tapanrova, Angelina; Pejić, Borivoje

2012-01-01

The aim of this study was to use results of experimental work to analyse effects of maize irrigation and to quantify basic parameters that are included into exploitation costs of a long-ranged self-propelled sprayer, so called typhoon sprinkler. The four-replicate trial was carried out according to a randomised block design in the experimental fields of the Maize Research Institute, Zemun Polje, during the 2002-2008 period. The irrigation was applied in all years but 2004 in which the precipi...

Comparisons of Herbicide Treated and Cultivated Herbicide-Resistant Corn

Directory of Open Access Journals (Sweden)

H. Arnold Bruns

2010-01-01

Full Text Available Four glyphosate resistant corn (Zea mays L. hybrids, a glufosinate-ammonium resistant hybrid, and a conventional atrazine resistant hybrid gown at Stoneville, MS in 2005, 2006, and 2007 with furrow irrigation were treated with their respective herbicides and their growth, yield, and mycotoxin incidence were compared with untreated cultivated plots. Leaf area index (LAI and dry matter accumulation (DMA were collected on a weekly basis beginning at growth stage V3 and terminating at anthesis. Crop growth rates (CRGs and relative growth rates (RGRs were calculated. Plots were later harvested, yield and yield component data collected, and kernel samples analyzed for aflatoxin and fumonisin. Leaf area index, DMA, CRG, and RGR were not different among the herbicide treated plots and from those that were cultivated. Curves for LAI and DMA were similar to those previously reported. Aflatoxin and fumonisin were relatively low in all plots. Herbicide application or the lack thereof had no negative impact on the incidence of kernel contamination by these two mycotoxins. Herbicides, especially glyphosate on resistant hybrids, have no negative effects on corn yields or kernel quality in corn produced in a humid subtropical environment.

Assessing corn water stress using spectral reflectance

Science.gov (United States)

Mefford, Brenna S.

Multiple remote sensing techniques have been developed to identify crop water stress, but some methods may be difficult for farmers to apply. Unlike most techniques, shortwave vegetation indices can be calculated using satellite, aerial, or ground imagery from the green (525-600 nm), red (625-700 nm), and near infrared (750-900 nm) spectral bands. If vegetation indices can be used to monitor crop water stress, growers could use this information as a quick low-cost guideline for irrigation management, thus helping save water by preventing over irrigating. This study occurred in the 2013 growing season near Greeley, CO, where pressurized drip irrigation was used to irrigate twelve corn ( Zea mays L.) treatments of varying water deficit. Multispectral data was collected and four different vegetation indices were evaluated: Normalized Difference Vegetation Index (NDVI), Optimized Soil-Adjusted Vegetation Index (OSAVI), Green Normalized Difference Vegetation Index (GNDVI), and the Wide Dynamic Range Vegetation Index (WDRVI). The four vegetation indices were compared to corn water stress as indicated by the stress coefficient (Ks) and water deficit in the root zone, calculated by using a water balance that monitors crop evapotranspiration (ET), irrigation events, precipitation events, and deep percolation. ET for the water balance was calculated using two different methods for comparison purposes: (1) calculation of the stress coefficient (Ks) using FAO-56 standard procedures; (2) use of canopy temperature ratio (Tc ratio) of a stressed crop to a non-stressed crop to calculate Ks. It was found that obtaining Ks from Tc ratio is a viable option, and requires less data to obtain than Ks from FAO-56. In order to compare the indices to Ks, vegetation ratios were developed in the process of normalization. Vegetation ratios are defined as the non-stressed vegetation index divided by the stressed vegetation index. Results showed that vegetation ratios were sensitive to water

Determination of the genotoxic effects of Convolvulus arvensis extracts on corn (Zea mays L.) seeds.

Science.gov (United States)

Sunar, Serap; Yildirim, Nalan; Aksakal, Ozkan; Agar, Guleray

2013-06-01

In this research, the methanolic extracts of Convolvulus arvensis were tested for genotoxic and inhibitor activity on the total soluble protein content and the genomic template stability against corn Zea mays L. seed. The methanol extracts of leaf, stem and root of C. arvensis were diluted to 50, 75 and 100 μl concentrations and applied to corn seed. The total soluble protein and genomic template stability results were compared with the control. The results showed that especially 100 μl extracts of diluted leaf, stem and root had a strong inhibitory activity on the genomic template stability. The changes occurred in random amplification of polymorphic DNA (RAPD) profiles of C. arvensis extract treatment included variation in band intensity, loss of bands and appearance of new bands compared with control. Also, the results obtained from this study revealed that the increase in the concentrations of C. arvensis extract increased the total soluble protein content in maize. The results suggested that RAPD analysis and total protein analysis could be applied as a suitable biomarker assay for the detection of genotoxic effects of plant allelochemicals.

Corn residue utilization by livestock in the USA

Science.gov (United States)

Corn (Zea mays L.) residue grazing or harvest provides a simple and economical practice to integrate crops and livestock. Limited information is available on how widespread corn residue utilization is practiced by US producers. In 2010, the USDA-ERS surveyed producers from 19 states on corn grain ...

Climate change, transgenic corn adoption and field-evolved resistance in corn earworm.

Science.gov (United States)

Venugopal, P Dilip; Dively, Galen P

2017-06-01

Increased temperature anomaly during the twenty-first century coincides with the proliferation of transgenic crops containing the bacterium Bacillus thuringiensis (Berliner) (Bt) to express insecticidal Cry proteins. Increasing temperatures profoundly affect insect life histories and agricultural pest management. However, the implications of climate change on Bt crop-pest interactions and insect resistance to Bt crops remains unexamined. We analysed the relationship of temperature anomaly and Bt adoption with field-evolved resistance to Cry1Ab Bt sweet corn in a major pest, Helicoverpa zea (Boddie). Increased Bt adoption during 1996-2016 suppressed H. zea populations, but increased temperature anomaly buffers population reduction. Temperature anomaly and its interaction with elevated selection pressure from high Bt acreage probably accelerated the Bt-resistance development. Helicoverpa zea damage to corn ears, kernel area consumed, mean instars and proportion of late instars in Bt varieties increased with Bt adoption and temperature anomaly, through additive or interactive effects. Risk of Bt-resistant H. zea spreading is high given extensive Bt adoption, and the expected increase in overwintering and migration. Our study highlights the challenges posed by climate change for Bt biotechnology-based agricultural pest management, and the need to incorporate evolutionary processes affected by climate change into Bt-resistance management programmes.

Evaluation of the Effect of Seed Priming and Seedbed on Characteristic of Transplant Sweet Corn (Zea Mays L.

Directory of Open Access Journals (Sweden)

A Manzari-Tavakkoli

2016-10-01

Full Text Available Introduction Corn (Zea mays L. is one of the main cereals in the tropical and temperate regions of the world. Sweet corn obtained from a genetic mutation on chromosome 4 locus SU conventional maize resulting accumulation of sugars and polysaccharides which are soluble in seed endosperm. Unlike other types of corn, sweet corn endosperm contains a lot of sugar to starch, which is called Amylodextrin and it is soluble in water. Producing healthy and uniform plants is one of the requirements of modern agriculture. Considering the unsuitable climatic condition in Iran (arid and semiarid transplantation is one of the requirements for sustainable agriculture particularly in sweet corn production with high water requirement where transplantation is able to save at least 2-3 times of irrigations. Therefore, producing high quality transplants is an important practice for successful seedling establishment. Hence, the objective of this study was to evaluate the effects of seed priming and substrate types on the characteristics of sweet corn transplants. Materials and Methods This experiment was conducted as factorial based on a completely randomized design with three replications. Treatments were three levels of seeds pretreatment: no priming (p1, hydropriming (p2 and biopriming (p3, and another factor was seedbeds types in seven levels including: vermicompost (b1, perlite (b2, cocopeat(b3, vermicompost+perlite(b4, vermicompost+ cocopeat (b5, perlite+ cocopeat (b6 and vermicompost+ cocopeat +perlite (b7. Biopriming using bioaminopalis biological fertilizer applied on the seeds for 24hours in a solution containing micro-organisms such azotobacter and Pseudomonas. Then the non-primed and the primed seeds were sown in the plastic pots and grown in a greenhouse with average temperature of 22-25° C. Samples were taken three weeks after planting. Results and Discussion Mean emergence time Emergence is shoot elongation and growth leading the shoots out of the

Effects inoculation of mycorhizae species and irrigation levels impacts on growth criteria, yield and water use efficiency of corb (Zea mays L.

Directory of Open Access Journals (Sweden)

M.R. Amerian

2016-05-01

Full Text Available Water deficiency is one of the most important factors for limiting crop yield in arid and semiarid regions. Symbiosis with a variety of microorganisms in these regions is one of the modern ecological approaches for sustainable agriculture to reduce damages caused by environmental stresses. Symbiotic of arbuscular mycorrhizal fungi (AM with the roots of crops has shown positive effects on agricultural systems. In order to study the effects of inoculation with two species of mycorrhizal fungi and irrigation levels on root growth criteria and water use efficiency of corn, an experiment was performed as split plots based on a complete randomized block design with three replications at the Agricultural Research Station, Ferdowsi University of Mashhad during growing season of 2008-2009. Treatments included two mycorhizae inoculation (Glomus mosseae and G. intraradices and control and four irrigation levels (25, 50, 75 and 100% of water requirement. Grain yield, root specific length, the percentage of root colonization and water use efficiency based on grain yield of corn were measured. The results showed that the effect of mycorrhizae inoculation was significant on (p≤0.05 root specific length, grain yield and water use efficiency of corn. Mycorrhizae species had no significant effect on root colonization percentage of corn. Different irrigation levels had significant effect on grain yield, special length root, the percentage of root colonization, and water use efficiency of corn (p≤0.05. Generally, the results showed that mycorrhizae inoculation in water deficiency conditions, can increase the uptake of water and nutrients by developing the root and increasing the absorbing surface. In this way, not only the plant tolerance against the water deficiency increases, but also more yield will be produced for a specific value of water, which means the water use efficiency increases. Furthermore, the use of water will be decreased.

Sorghum seed maturity affects the weight and feeding duration of immature corn earworm, Helicoverpa zea, and fall armyworm, Spodoptera frugiperda, in the laboratory.

Science.gov (United States)

Soper, Alysha M; Whitworth, R Jeff; McCornack, Brian P

2013-01-01

Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed.

Sorghum Seed Maturity Affects the Weight and Feeding Duration of Immature Corn Earworm, Helicoverpa zea, and Fall Armyworm, Spodoptera frugiperda, in the Laboratory

Science.gov (United States)

Soper, Alysha M.; Whitworth, R. Jeff; McCornack, Brian P.

2013-01-01

Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed. PMID:24219328

Nuclear techniques to evaluate the water use of field crops irrigated in different stages of their cycles

International Nuclear Information System (INIS)

Libardi, P.L.; Moraes, S.O.; Saad, M.A.; Jong Van Lier, Q.; Vieira, O.; Luis Tuon, R.

1995-01-01

The search for soil - water management systems that rationalize the water use of field crops should always be emphasized. The present coordinated research programme of the joint division FAO/ AEA has the objective to contribute to a better understanding of this subject by improving the use efficiency of water resources in irrigated agriculture. This project is a contribution to this programme and consisted in the identification of specified development stages of bean ( phaseolus vulgaris, L ) and corn (Zea mays, L ) crops in which plants are less sensitive to water deficit. Experiments were carried out in a tropical soil of agricultural importance in a traditional irrigation field site of the state of Sao Paulo, Brazil. Neutron probe tensiometers were used to determine the soil water balance in different treatments. 3 tabs, 16 refs, (Author)

Effect of eastern gamagrass on fall armyworm and corn earworm development

Science.gov (United States)

The fall armyworm, Spodoptera frugiperda (J.E. Smith) and the corn earworm, Helicoverpa zea (Boddie) are two important corn pests in the southern U.S. states. Effect of the leaves from the corn relative, the Eastern gamagrass (Tripsacum dactyloides L.) on fall armyworm and corn earworm development ...

Effect of specific plant-growth-promoting rhizobacteria (PGPR) on growth and uptake of neonicotinoid insecticide thiamethoxam in corn (Zea mays L.) seedlings.

Science.gov (United States)

Myresiotis, Charalampos K; Vryzas, Zisis; Papadopoulou-Mourkidou, Euphemia

2015-09-01

Corn (Zea mays L.) is one of the most important cereal crops in the world and is used for food, feed and energy. Inoculation with plant-growth-promoting rhizobacteria (PGPR) would reduce the use of chemical fertilisers and pesticides and could be suggested as an alternative practice for sustainable production of corn in modern agricultural systems. In this study, the effect of two Bacillus PGPR formulated products, Companion (B. subtilis GB03) and FZB24 (B. subtilis FZB24), on corn growth and root uptake of insecticide thiamethoxam was investigated. All bacterial treatments enhanced root biomass production by 38-65% compared with the uninoculated control, with no stimulatory effect of PGPR on above-ground biomass of corn. The uptake results revealed that, in plants inoculated with the PGPR B. subtilis FZB24 and B. subtilis GB03, singly or in combination, the uptake and/or systemic translocation of thiamethoxam in the above-ground corn parts was significantly higher at the different growth ages compared with the control receiving no bacterial treatment. The findings suggest that the PGPR-elicited enhanced uptake of thiamethoxam could lead to improved efficiency of thiamethoxam using reduced rates of pesticides in combination with PGPR as an alternative crop protection technique. © 2014 Society of Chemical Industry.

The effect of different crop plant densities on radiation absorption and use efficiency by corn (Zea mays L. and bean (Phaseolus vulgaris L. intercropped canopy

Directory of Open Access Journals (Sweden)

L. Rostami

2016-05-01

Full Text Available In order to determinate the effects of plant densities in intercropped corn (Zea mays L. and bean (Phaseolus vulgaris L. on radiation absorption and use efficiency, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad, Iran during growing season of 2007-2008. This experiment was conducted in low input system. A randomized complete block design with three replications was used. Treatments were included bean intercropping with corn in normal density of bean plus 10%, 20% and 30% excess bean C (B+10%, C (B+20%, C (B+30%, increasing in density bean intercropping with corn in normal density of corn plus 10%, 20% and 30% excess corn B (C+10%, B (C+20%, B (C+30% and sole crops of corn (C and bean (B. Results indicated that leaf area index, radiation absorption, total dry matter and radiation use efficiency of corn increased in all intercropped treatments compared to sole cropping, but it reversed for bean. It seems that complementary and facilitative effects of intercropping were more for corn. Range of corn and bean radiation use efficiency was from 1.92 g.MJ-1 (in sole cropping and 0.72 g.MJ-1 {in (C+30% (B+30%} to 2.30 g.MJ-1 {in C (B+30%} and 1.45 g.MJ-1 (in sole cropping, respectively.

Phytotoxicity of ZnO nanoparticles and the released Zn(II) ion to corn (Zea mays L.) and cucumber (Cucumis sativus L.) during germination.

Science.gov (United States)

Zhang, Ruichang; Zhang, Haibo; Tu, Chen; Hu, Xuefeng; Li, Lianzhen; Luo, Yongming; Christie, Peter

2015-07-01

Toxicity of engineered nanoparticles on organisms is of concern worldwide due to their extensive use and unique properties. The impacts of ZnO nanoparticles (ZnO NPs) on seed germination and root elongation of corn (Zea mays L.) and cucumber (Cucumis sativus L.) were investigated in this study. The role of seed coats of corn in the mitigation toxicity of nanoparticles was also evaluated. ZnO NPs (1,000 mg L(-1)) reduced root length of corn and cucumber by 17 % (p < 0.05) and 51 % (p < 0.05), respectively, but exhibited no effects on germination. In comparison with Zn(2+), toxicity of ZnO NPs on the root elongation of corn could be attributed to the nanoparticulate ZnO, while released Zn ion from ZnO could solely contribute to the inhibition of root elongation of cucumber. Zn uptake in corn exposed to ZnO NPs during germination was much higher than that in corn exposed to Zn(2+), whereas Zn uptake in cucumber was significantly correlated with soluble Zn in suspension. It could be inferred that Zn was taken up by corn and cucumber mainly in the form of ZnO NPs and soluble Zn, respectively. Transmission electron microscope confirmed the uptake of ZnO NPs into root of corn. Although isolation of the seed coats might not be the principal factor that achieved avoidance from toxicity on germination, seed coats of corn were found to mitigate the toxicity of ZnO NPs on root elongation and prevent approximately half of the Zn from entering into root and endosperm.

Distinguishing nitrogen fertilization levels in field corn (Zea mays L.) with actively induced fluorescence and passive reflectance measurements

International Nuclear Information System (INIS)

McMurtrey, J.E. III; Chappelle, E.W.; Kim, M.S.; Meisinger, J.J.; Corp, L.A

1994-01-01

Laser-induced fluorescence (LIF) is an active sensing technique capable of capturing immediate and specific indications of changes in plant physiology and metabolism as they relate to the concentration and photosynthetic activity of the plant pigments. Reflectance is a passive sensing technique that can capture differences in the concentration of the primary plant pigments. Fluorescence and reflectance were compared for their ability to measure levels of plant stress that are of agronomic importance in corn (Zea mays L.) crops. Laboratory LIF and reflectance spectra were made on excised leaves from field grown corn. Changes in the visible region of the spectrum were compared between groups of plants fertilized with seven different levels of nitrogen (N) fertilization. A pulsed nitrogen laser emitting photons at a wavelength of 337 nm was used as a fluorescence excitation source. Differences in maximum intensity of fluorescence occurred at 440 nm, 525 nm, 685 nm, and 740 nm. Significant separations were found between levels of N fertilization at several LIF wavelength ratios. Several reflectance algorithms also produced significant separations between certain levels of N fertilization

Phenology and biomass production of adapted and non-adapted tropical corn populations in Central Iowa

Science.gov (United States)

Biofuel production in the Midwestern United States has largely focused on corn (Zea mays L.) grain for ethanol production and more recently, corn stover for lignocellulosic ethanol. As an alternative to conventional corn, tropical corn populations have been evaluated. Tropical corn is the term used ...

In silico identification of transcription factors associated with the biosynthesis of carotenoids in corn ( Zea mays L.

Directory of Open Access Journals (Sweden)

Zahra Zinati

2017-05-01

Full Text Available Carotenoids, a diverse group of colorful pigments, contribute to the development, light harvesting and photoprotection in plants as well as human health. Due to the interesting properties of carotenoids, enhanced carotenoid biosynthesis has been of ongoing interest. Recent advances in computational biology and bioinformatics make it more feasible to understand the transcriptional regulatory network underlying carotenoid biosynthesis. Studies on carotenoid biosynthesis in corn ( Zea mays L. have indicated the pivotal role of the phytoene synthase gene PSY1 (accession: GRMZM2G300348 in endosperm color and carotenoid accumulation in corn kernels. Computational approaches such as Genomatix, PlantPAN, PlantCARE, PlantTFDB and IGDE6 have been used for promoter prediction, regulatory features and transcription factor identification, as well as pairwise promoter comparisons. Four transcripts have been identified for the PSY1 gene. Based on Genomatix and PlantPAN, the promoter predicted for GRMZM2G300348_T01 was different from that predicted for the other three transcripts (GRMZM2G300348_T02, GRMZM2G300348_T03 and GRMZM2G300348_T04. The results indiated that the promoter of GRMZM2G300348_T01 has more diverse motifs involved in hormonal/environmental stress responses. The most significant result obtained from this study is the discovery of two transcription factors belonging to the HB family that are co-expressed with all four transcripts of PSY1 under environmental stresses. It is, therefore, likely that these transcription factors may act as critical regulators of PSY1 gene expression in corn. Identification of the proteins acting upstream of PSY1 within corn will shed light on the fine tuning of PSY1 expression regulation. Such an understanding would also contribute to metabolic engineering aimed at enhanced carotenoid biosynthesis.

Evaluation of growth traits and yield of new forage corn (Zea mays L. single cross combinations

Directory of Open Access Journals (Sweden)

S. Khavari Khorasani

2016-04-01

Full Text Available In this study 18 forage corn (Zea mays L. hybrid varieties were evaluated based on RCBD with four replications in Khorasan Razavi Agricultural and Natural Resources Research Centre, Iran, on 2008-2009. Result of analysis of variance showed that there was significantly difference between hybrids in forage yield, ear weight and ear to biomass ratio. Results of hybrids mean comparison with Duncan’s multiple range test showed that SC700 was higher than other investigated hybrids in forage yield trait. But hybrid 3 with 85.31 forage yield was the best hybrid in weight of ear and ear to biomass ratio. Though the SC704 hybrid was better than others for stem dry weight, ear dry weight and leaf area but there was not any significant difference between this hybrid and hybrid 3.

Impact of transgenic sweet corn silks to two noctuid pests

Science.gov (United States)

Eight Bacillus thuringiensis (Bt) transgenic sweet corn hybrids were evaluated (with two controls) for their efficacy against two ear-feeding insects; the corn earworm [Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae)], and the fall armyworm (Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuid...

Evaluating Corn (Zea Mays L.) N Variability Via Remote Sensed Data

Science.gov (United States)

Sullivan, D. G.; Shaw, J. N.; Mask, P. L.; Rickman, D.; Luvall, J.; Wersinger, J. M.

2003-01-01

Transformations and losses of nitrogen (N) throughout the growing season can be costly. Methods in place to improve N management and facilitate split N applications during the growing season can be time consuming and logistically difficult. Remote sensing (RS) may be a method to rapidly assess temporal changes in crop N status and promote more efficient N management. This study was designed to evaluate the ability of three different RS platforms to predict N variability in corn (Zea mays L.) leaves during vegetative and early reproductive growth stages. Plots (15 x 15m) were established in the Coastal Plain (CP) and Appalachian Plateau (AP) physiographic regions each spring from 2000 to 2002 in a completely randomized design. Treatments consisted of four N rates (0, 56, 112, and 168 kg N/ha) applied as ammonium nitrate (NH4N03) replicated four time. Spectral measurements were acquired via spectroradiometer (lambda = 350 - 1050 nm), Airborne Terrestrial Applications Sensor (ATLAS) (lambda = 400 - 12,500 nm), and the IKONOS satellite (lambda = 450 - 900 nm). Spectroradiometer data were collected on a biweekly basis from V4 through R1. Due to the nature of - satellite and aircraft acquisitions, these data were acquired per availability. Chlorophyll meter (SPAD) and tissue N were collected as ancillary data along with each RS acquisition. Results showed vegetation indices derived from hand-held spectroradiometer measurements as early as V6-V8 were linearly related to yield and tissue N content. ATLAS data was correlated with tissue N at the AP site during the V6 stage (r2 = 0.66), but no significant relationships were observed at the CP site. No significant relationships were observed between plant N and IKONOS imagery. Using a combination of the greenness vegetation index (GNDVI) and the normalized difference vegetation index (NDVI), RS data acquired via ATLAS and the spectroradiometer could be used to evaluate tissue N variability and estimate corn yield variability

Quantitative analysis of allantoin in Iranian corn silk

OpenAIRE

E. Khanpour*; M. Modarresi

2017-01-01

Background and objectives: Zea mays is cultivated in different parts of Iran and corn silk is used in traditional medicine. Allantoin is one of the major compounds in corn silk. The purpose of this research was the quantitatve analysis of allantoin in corn silks belonging to several regions of Iran. Methods: The samples of corn silk were prepared from three provinces of Iran (Kermanshah, Fars and Razavi Khorasan). The dried plant materials were infused in boiling distilled water with a temper...

Evaluation of Sowing Date, Plant Density and Harvest Method on Growth, Yield and Yield Components of Baby Corn (Zea mays L. var. SC403su

Directory of Open Access Journals (Sweden)

A. Rahmani

2014-12-01

Full Text Available Considering importance of baby corn, the study was consisted of sowing date (14th June, 3th July and 24th July as main Plots and plant densities (6.5, 8.5 and 10.5. plant m-2 as sub Plots and two harvest methods (baby corn, as first harvest sweet corn and next ear as baby corn on Growth parameter and yield of baby corn (Zea mays L. Var SC403su in agricultural Research Center and Natural Resources of Khorasan Razavi Province, Mashhad on 2009. The experiment was carried out in a factorial split plot design based on randomized completely block design with 4 replications. The results showed the highest plant height on sowing date 3thJuly with average 168.6 cm. Also the highest standard ear percentage that one of the important factors for food manufactory had on sowing date 24th July with plant density 10.5 plants plant m-2, by harvesting method baby corn with 63.9 percentages. Also The results showed the highest substandard ear percentage of baby corn was belonged to sowing date 24th July with 8.5 plant m-2, by harvesting method (baby corn sweet corn with 74.6%. The highest harvest ear index was belonged to sowing date14thJune, by harvesting method (baby corn sweet corn with 35.29 percentages. Therefore, sowing date 3thJuly for forage production with average 4 kg m-2 by harvesting method baby corn are recommended for lateral produce production. Considering to Mashhad weather conditions, producing the highest and best standard ear percentage, density, 10.5 plants per square meter and 24th July planting is recommended.

Separating heat stress from moisture stress: analyzing yield response to high temperature in irrigated maize

Science.gov (United States)

Carter, Elizabeth K.; Melkonian, Jeff; Riha, Susan J.; Shaw, Stephen B.

2016-09-01

Several recent studies have indicated that high air temperatures are limiting maize (Zea mays L.) yields in the US Corn Belt and project significant yield losses with expected increases in growing season temperatures. Further work has suggested that high air temperatures are indicative of high evaporative demand, and that decreases in maize yields which correlate to high temperatures and vapor pressure deficits (VPD) likely reflect underlying soil moisture limitations. It remains unclear whether direct high temperature impacts on yields, independent of moisture stress, can be observed under current temperature regimes. Given that projected high temperature and moisture may not co-vary the same way as they have historically, quantitative analyzes of direct temperature impacts are critical for accurate yield projections and targeted mitigation strategies under shifting temperature regimes. To evaluate yield response to above optimum temperatures independent of soil moisture stress, we analyzed climate impacts on irrigated maize yields obtained from the National Corn Growers Association (NCGA) corn yield contests for Nebraska, Kansas and Missouri. In irrigated maize, we found no evidence of a direct negative impact on yield by daytime air temperature, calculated canopy temperature, or VPD when analyzed seasonally. Solar radiation was the primary yield-limiting climate variable. Our analyses suggested that elevated night temperature impacted yield by increasing rates of phenological development. High temperatures during grain-fill significantly interacted with yields, but this effect was often beneficial and included evidence of acquired thermo-tolerance. Furthermore, genetics and management—information uniquely available in the NCGA contest data—explained more yield variability than climate, and significantly modified crop response to climate. Thermo-acclimation, improved genetics and changes to management practices have the potential to partially or completely

Heavy metal accumulation in soils and grains, and health risks associated with use of treated municipal wastewater in subsurface drip irrigation

Science.gov (United States)

Asgari, Kamran; Najafi, Payam; Cornelis, Wim M.

2014-05-01

Constant use of treated wastewater for irrigation over long periods may cause buildup of heavy metals up to toxic levels for plants, animals, and entails environmental hazards in different aspects. However, application of treated wastewater on agricultural land might be an effective and sustainable strategy in arid and semi-arid countries where fresh water resources are under great pressure, as long as potential harmful effects on the environment including soil, plants, and fresh water resources, and health risks to humans are minimized. The aim of this study was to assess the effect of using a deep emitter installation on lowering the potential heavy metal accumulation in soils and grains, and health risk under drip irrigation with treated municipal wastewater. A field experiment was conducted according to a split block design with two treatments (fresh and wastewater) and three sub treatments (0, 15 and 30 cm depth of emitters) in four replicates on a sandy loam soil, in Esfahan, Iran. The annual rainfall is about 123 mm, mean annual ETo is 1457 mm, and the elevation is 1590 m a.s.l.. A two-crop rotation of wheat [Triticum spp.] and corn [Zea mays]) was established on each plot with wheat growing from February to June and corn from July to September. Soil samples were collected before planting (initial value) and after harvesting (final value) for each crop in each year. Edible grain samples of corn and wheat were also collected. Elemental concentrations (Cu, Zn, Cd, Pb, Cr, Ni) in soil and grains were determined using an atomic absorption spectrophotometer. The concentrations of heavy metals in the wastewater-irrigated soils were not significantly different (P>0.05) compared with the freshwater-irrigated soils. The results showed no significant difference (P>0.05) of soil heavy metal content between different depths of emitters. A pollution load index PLI showed that there was not substantial buildup of heavy metals in the wastewater-irrigated soils compared to

Exogenous melatonin improves corn (Zea mays L.) embryo proteome in seeds subjected to chilling stress.

Science.gov (United States)

Kołodziejczyk, Izabela; Dzitko, Katarzyna; Szewczyk, Rafał; Posmyk, Małgorzata M

2016-04-01

Melatonin (MEL; N-acetyl-5-methoxytryptamine) plays an important role in plant stress defense. Various plant species rich in this indoleamine have shown a higher capacity for stress tolerance. Moreover, it has great potential for plant biostimulation, is biodegradable and non-toxic for the environment. All this indicates that our concept of seed enrichment with exogenous MEL is justified. This work concerns the effects of corn (Zea mays L.) seed pre-sowing treatments supplemented with MEL. Non-treated seeds (nt), and those hydroprimed with water (H) or with MEL solutions 50 and 500 μM (HMel50, HMel500) were compared. Positive effects of seed priming are particularly apparent during germination under suboptimal conditions. The impact of MEL applied by priming on seed protein profiles during imbibition/germination at low temperature has not been investigated to date. In order to identify changes in the corn seed proteome after applying hydropriming techniques, purified protein extracts of chilling stressed seed embryos (14 days, 5°C) were separated by two-dimensional electrophoresis. Then proteome maps were graphically and statistically compared and selected protein spots were qualitatively analyzed using mass spectrometry techniques and identified. This study aimed to analyze the priming-induced changes in maize embryo proteome and at identifying priming-associated and MEL-associated proteins in maize seeds subjected to chilling. We attempt to explain how MEL expands plant capacity for stress tolerance. Copyright © 2016 Elsevier GmbH. All rights reserved.

Costs of jasmonic acid induced defense in aboveground and belowground parts of corn (Zea mays L.).

Science.gov (United States)

Feng, Yuanjiao; Wang, Jianwu; Luo, Shiming; Fan, Huizhi; Jin, Qiong

2012-08-01

Costs of jasmonic acid (JA) induced plant defense have gained increasing attention. In this study, JA was applied continuously to the aboveground (AG) or belowground (BG) parts, or AG plus BG parts of corn (Zea mays L.) to investigate whether JA exposure in one part of the plant would affect defense responses in another part, and whether or not JA induced defense would incur allocation costs. The results indicated that continuous JA application to AG parts systemically affected the quantities of defense chemicals in the roots, and vice versa. Quantities of DIMBOA and total amounts of phenolic compounds in leaves or roots generally increased 2 or 4 wk after the JA treatment to different plant parts. In the first 2 wk after application, the increase of defense chemicals in leaves and roots was accompanied by a significant decrease of root length, root surface area, and root biomass. Four weeks after the JA application, however, no such costs for the increase of defense chemicals in leaves and roots were detected. Instead, shoot biomass and root biomass increased. The results suggest that JA as a defense signal can be transferred from AG parts to BG parts of corn, and vice versa. Costs for induced defense elicited by continuous JA application were found in the early 2 wk, while distinct benefits were observed later, i.e., 4 wk after JA treatment.

The effect of triazole induced photosynthetic pigments and biochemical constituents of Zea mays L. (Maize) under drought stress

Science.gov (United States)

Rajasekar, Mahalingam; Rabert, Gabriel Amalan; Manivannan, Paramasivam

2016-06-01

In this investigation, pot culture experiment was carried out to estimate the ameliorating effect of triazole compounds, namely Triadimefon (TDM), Tebuconazole (TBZ), and Propiconazole (PCZ) on drought stress, photosynthetic pigments, and biochemical constituents of Zea mays L. (Maize). From 30 days after sowing (DAS), the plants were subjected to 4 days interval drought (DID) stress and drought with TDM at 15 mg l-1, TBZ at 10 mg l-1, and PCZ at 15 mg l-1. Irrigation at 1-day interval was kept as control. Irrigation performed on alternative day. The plant samples were collected on 40, 50, and 60 DAS and separated into root, stem, and leaf for estimating the photosynthetic pigments and biochemical constituents. Drought and drought with triazole compounds treatment increased the biochemical glycine betaine content, whereas the protein and the pigments contents chlorophyll-a, chlorophyll-b, total chlorophyll, carotenoid, and anthocyanin decreased when compared to control. The triazole treatment mitigated the adverse effects of drought stress by increasing the biochemical potentials and paved the way to overcome drought stress in corn plant.

Assesment of corn (zea mays l.) genotypes in relation to nitrogen fertilization under irrigated cropping conditions in Turkey

International Nuclear Information System (INIS)

Ibrikci, H.; Ulger, A.C.; Buyuk, G.; Korkmaz, K.; Ryan, J.; Karnez, E.; Cakir, B.; Konuskan, O.

2012-01-01

Efficient nitrogen (N) fertilizer management in crop production is based on supplying adequate amounts of the nutrient for optimum economic yield, while minimizing losses to the environment. Exploiting genotypic differences in N use is an additional consideration in achieving nutrient-use efficiency. Thus, in order to identify N-efficient corn genotypes, we established N-response field trials at 2 locations (University Research Farm, and Cutaem) for 2 years (1999, 2000) in the Cukurova region of Turkey. Ten corn genotypes, commonly grown in the region, were fertilized with N at application rates of 160, 240, 320 and 400kg N ha/sup -1/. The optimum N fertilizer rate was probably in the 160-240 kg N ha/sup -1/ rate based on response data. There were no significant or consistent differences between genotypes and N application for grain yield and N uptake. The average agronomic efficiency ranged between 20 to 65% across the genotypes and decreased with increasing N application rates. The pattern was similar for other efficiency indices with decreases with applied N, but little or no genotype differences. It is apparent that the genotypes used were bred for N as well as yield. There was little evidence of differences between genotypes or their response to N. Thus, while genotypic selection of corn can be one of the suitable potential N management practices in the Mediterranean region where genetic diversity exists, it is not appropriate considering genotypes are homogenous with respect to N use. (author)

7 CFR 319.56-43 - Baby corn and baby carrots from Zambia.

Science.gov (United States)

2010-01-01

... § 319.56-43 Baby corn and baby carrots from Zambia. (a) Immature, dehusked “baby” sweet corn (Zea mays L... consignments only. (b) Immature “baby” carrots (Daucus carota L. ssp. sativus) for consumption measuring 10 to...

Integration of biological control and transgenic insect protection for mitigation of mycotoxins in corn

Science.gov (United States)

Biological control is known to be effective in reducing aflatoxin contamination of corn and some transgenic corn hybrids incur greatly reduced damage from corn earworm (Helicoverpa zea). We conducted seven field trials over two years to test the hypothesis that transgenic insect protection and biol...

Aracnidae diversity in soil cultivated with corn (Zea mays

Directory of Open Access Journals (Sweden)

Lígia Vanessa da Silva

2014-09-01

Full Text Available Studies carried out on the diversity and abundance of spiders may provide a rich information base on the degree of integrity of agricultural systems where they are found. In transgenic corn, Bacillus thuringiensis proteins are expressed in great amounts in plant tissues and may affect arthropod communities. Thus, the main goal of this work was to identify the spider diversity associated to transgenic and conventional corn hybrids. Pitfall collections were performed in conventional and transgenic corn plots during the 2010/2011 crop season, at the experimental field of the Agronomy Course of the University of Cruz Alta, RS. A total of 559 spiders were collected, from which 263 were adults and 296 young individuals. In the transgenic corn 266 spiders were collected and in the conventional one 293. Eleven families were determined and the adult individuals grouped in 27 morphospecies. Families with the largest number of representatives were Linyphiidae (29.70%, Theridiidae (5.72% and Lycosidae (5.01%. The most abundant morphospecies were Lyniphiidae sp. with 77 individuals, Erigone sp. with 40 individuals, Lynyphiidae sp. with 33 individuals, Theridiidae sp. with 21 individuals, Lycosa erythrognatha with 14 individuals and Lycosidae sp. with 13 individuals. The Shannon Diversity Index was higher for transgenic corn (H” =1.01 in February and smaller (H’=0.54 in the December collection in the conventional corn, and the Margaleff Richness Index showed higher diversity in December and February for the conventional corn (M=18.3, and smaller diversity for the transgenic corn in November (M=11.3. Families were classified in five guilds; two weavers: Irregular web builders and sheet web builders, and three hunter guilds: Night soil runners, ambush spiders and aerial night runners. The relative proportion of the spiders morphospecies found in this research, as well as the guilds, suggest that this group may not have been affected by the genetically

Deposition of insecticides on corn silks applied at high and low spray rates for control of corn earworm

Science.gov (United States)

Corn earworm is a major pest of sweet corn, especially when grown organically. Aerial application of insecticides is important for both conventionally- and organically-grown sweet corn production as sweet corn is frequently irrigated to assure return on investment given the high production costs. ...

Multi-state trials of Bt sweet corn varieties for control of the corn earworm (Lepidoptera: Noctuidae).

Science.gov (United States)

Shelton, A M; Olmstead, D L; Burkness, E C; Hutchison, W D; Dively, G; Welty, C; Sparks, A N

2013-10-01

Field tests in 2010-2011 were performed in New York, Minnesota, Maryland, Ohio, and Georgia to compare Bt sweet corn lines expressing Cry1A.105 + Cry2Ab2 and Cry1Ab with their non-Bt isolines, with and without the use of foliar insecticides. The primary insect pest in all locations during the trial years was Heliocoverpa zea (Boddie), which is becoming the most serious insect pest of sweet corn in the United States. At harvest, the ears were measured for marketability according to fresh market and processing standards. For fresh market and processing, least squares regression showed significant effects of protein expression, state, and insecticide frequency. There was a significant effect of year for fresh market but not for processing. The model also showed significant effects of H. zea per ear by protein expression. Sweet corn containing two genes (Cry1A.105 + Cry2Ab2) and a single gene (Cry1Ab) provided high marketability, and both Bt varieties significantly outperformed the traditional non-Bt isolines in nearly all cases regardless of insecticide application frequency. For pest suppression of H. zea, plants expressing Bt proteins consistently performed better than non-Bt isoline plants, even those sprayed at conventional insecticide frequencies. Where comparisons in the same state were made between Cry1A.105 + Cry2Ab2 and Cry1Ab plants for fresh market, the product expressing Cry1A.105 + Cry2Ab2 provided better protection and resulted in less variability in control. Overall, these results indicate Cry1A.105 + Cry2Ab2 and Cry1Ab plants are suitable for fresh market and processing corn production across a diversity of growing regions and years. Our results demonstrate that Bt sweet corn has the potential to significantly reduce the use of conventional insecticides against lepidopteran pests and, in turn, reduce occupational and environmental risks that arise from intensive insecticide use.

Using in situ pore water concentrations to estimate the phytotoxicity of nicosulfuron in soils to corn (Zea mays L.).

Science.gov (United States)

Liu, Kailin; Cao, Zhengya; Pan, Xiong; Yu, Yunlong

2012-08-01

The phytotoxicity of an herbicide in soil is typically dependent on the soil characteristics. To obtain a comparable value of the concentration that inhibits growth by 50% (IC50), 0.01 M CaCl(2) , excess pore water (EPW) and in situ pore water (IPW) were used to extract the bioavailable fraction of nicosulfuron from five different soils to estimate the nicosulfuron phytotoxicity to corn (Zea mays L.). The results indicated that the phytotoxicity of nicosulfuron in soils to corn depended on the soil type, and the IC50 values calculated based on the amended concentration of nicosulfuron ranged from 0.77 to 9.77 mg/kg among the five tested soils. The range of variation in IC50 values for nicosulfuron was smaller when the concentrations of nicosulfuron extracted with 0.01 M CaCl(2) and EPW were used instead of the amended concentration. No significant difference was observed among the IC50 values calculated from the IPW concentrations of nicosulfuron in the five tested soils, suggesting that the concentration of nicosulfuron in IPW could be used to estimate the phytotoxicity of residual nicosulfuron in soils. Copyright © 2012 SETAC.

Effect of Different Alternate Irrigation Strategies using Saline and Non-Saline Water on Corn Yield, Salinity and Moisture Distribution in Soil Profile

Directory of Open Access Journals (Sweden)

Ali Reza Kiani

2017-01-01

Full Text Available Introduction: Lack of water and deterioration in the quality of soil and water resources are considered to be the prime cause of reduced crop yield in arid and semi-arid regions ‘More crop per drop’ by trickle irrigation, deficit irrigation, and uncommon water are the best strategies for mitigating water crises. Different irrigation management strategies are needed to increase production in different areas. In areas where sufficient water is available, a full irrigation strategy could be a suitable option, while in areas where water is limited, deficit irrigation would be an appropriate method, and finally in areas where water resources are saline, management strategies for achieving sustainable production as well as economic yields would be suitable. Maize is the third most important grain crop in the world following wheat and rice and it is the main source of nutrition for humans and animals. Because of the importance of maize in the world, increasing maize production under environmental stresses is a big challenge for agricultural scientists. Different methods of irrigation and the use of saline water that had satisfactory results for increasing agricultural production have been studied by several investigators . The main objective of this study was to establish an efficient use of limited water resources as well as to explore the possibility of replacing saline water with fresh water using different management techniques. Materials and Methods: A field experiment was conducted over two maize cropping seasons (2012–2013 in northern Iran (Gorgan Agricultural Research Station to compare different alternate irrigation scenarios using saline water on corn yield, salinity and soil moisture distribution in a randomized complete block design with three replications. Treatments were: T1 and T2 = 100 and 50 % of crop water requirement with non-saline water, respectively; T3 and T4 = variable and fixed full irrigation with saline and non

Descriptive and hedonic analyses of low-Phe food formulations containing corn (Zea mays) seedling roots: toward development of a dietary supplement for individuals with phenylketonuria.

Science.gov (United States)

Cliff, Margaret A; Law, Jessica R; Lücker, Joost; Scaman, Christine H; Kermode, Allison R

2016-01-15

Seedling roots of anthocyanin-rich corn (Zea mays) cultivars contain high levels of phenylalanine ammonia lyase (PAL) activity. The development of a natural dietary supplement containing corn roots could provide the means to improve the restrictive diet of phenylketonuria (PKU) patients by increasing their tolerance to dietary phenylalanine (Phe). Therefore this research was undertaken to explore the sensory characteristics of roots of four corn cultivars as well as to develop and evaluate food products (cereal bar, beverage, jam-like spread) to which roots had been added. Sensory profiles of corn roots were investigated using ten trained judges. Roots of Japanese Striped corn seedlings were more bitter, pungent and astringent than those of white and yellow cultivars, while roots from the Blue Jade cultivar had a more pronounced earthy/mushroom aroma. Consumer research using 24 untrained panelists provided hedonic (degree-of-liking) assessments for products with and without roots (controls). The former had lower mean scores than the controls; however, the cereal bar had scores above 5 on the nine-point scale for all hedonic assessments compared with the other treated products. By evaluating low-Phe food products containing corn roots, this research ascertained that the root-containing low-Phe cereal bar was an acceptable 'natural' dietary supplement for PKU-affected individuals. © 2015 Her Majesty the Queen in Right of Canada. Journal of the Science of Food and Agriculture © 2015 Society of Chemical Industry.

Effect of Integrated Weed Management Methods on Yield and Yield Components of Corn (Zea mays L. in Kermanshah Province, Iran

Directory of Open Access Journals (Sweden)

R. Amini

2017-08-01

Full Text Available Introduction: Corn (Zea mays L. is cultivated widely throughout the world and has the highest production among the cerealsafter rice and wheat. In Iran the total production of corn in 2013 was more than 2540000 tons. Weeds are one of the greatest limiting factors to decrease corn yield in Iran as the average yield loss due to weeds in the fields of Kermanshah in 2009 was 17.32 %. The herbicides are the main weed control method in conventional cropping systems but their application has been increased herbicide resistant weeds and environmental pollution. Integrated weed management combines all applicable including chemical and non-chemical methods to reduce the effect of weeds in the cropping systems. Thus, Weed control strategies such as tillage, mulch, cover crops and intercropping could be used for integrated weed management of corn. Previous studies showed that crop residues such as rye (Secale sereal L., wheat (Triticum aestivum L., barley (Hordeum vulgare L. and clover (Trifolium sp., cover crops and living mulch could inhibit weed germination and growth. Therefore the objective of this study was evaluating the effects of some integrated weed management treatments on weed characteristics, yield components and grain yield of corn. Materials and methods: In order to evaluate the effect of some weed management treatments on corn (Zea mays L. yield an experiment was conducted in 2014 in Ravansar, Kermanshah, Iran. This study was arranged based on randomized complete block design with 10 treatments and three replications. The weed management treatments were including 1-chemical control followed by mechanical control (application of nicosulfuron at a dose of 80 g.a.i.ha-1 + cultivator 40 days after emergence 2- chemical control followed by mechanical control (application of 2,4-D+MCPA at a dose of 675 g.a.i.ha-1 + cultivator 40 days after emergence 3- cultural control followed by mechanical control (planting hairy vetch (Vicia villosa in the fall

Effect of atrazine applications on weed growth and yield at different ...

African Journals Online (AJOL)

Corn (Zea mays L.), for silage, is very important in animal feeding because winter seasonal conditions last longer in Eastern Turkey. Corn yield components were investigated in plots, in which herbicide had been applied and also not applied at different irrigation levels in this study. The study lasted for two years and ...

Movement and leaching losses of N-CO(15NH2)2 fertilizer in a alfisol under a corn crop (Zea mays, L.)

International Nuclear Information System (INIS)

Araujo Silva, J.C. de.

1982-01-01

In an oxid Paleudalf (Terra Roxa Estruturada) the nitrogen leaching losses are studied in a corn crop (Zea mays, L.) during one growing cycle (from 1979 October to 1980 February), through the study of soil water dynamics. The complete crop water balance is established using Hg manometer tensiometers. The variations of the NO - 3 -N concentration with the time and soil depth (60, 90 and 120cm) were followed by ceramic porous cup samples, some suggestions about the use of tensiometers and oil solutions samplers are presented, as well as, an apendice methodology used to determine the soil water conduction coefficients. (M.A.C.) [pt

Extract of corn silk (stigma of Zea mays) inhibits the tumour necrosis factor-alpha- and bacterial lipopolysaccharide-induced cell adhesion and ICAM-1 expression.

Science.gov (United States)

Habtemariam, S

1998-05-01

Treatment of human endothelial cells with cytokines such as tumour necrosis factor-alpha (TNF) or E. coli lipopolysaccharide (LPS) induces the expression of several adhesion molecules and enhances leukocyte adhesion to endothelial cell surface. Interfering with this leukocyte adhesion or adhesion molecules upregulation is an important therapeutic target for the treatment of bacterial sepsis and various inflammatory diseases. In the course of screening marketed European anti-inflammatory herbal drugs for TNF antagonistic activity, a crude ethanolic extract of corn silk (stigma of Zea mays) exhibited significant activity. The extract at concentrations of 9-250 micrograms/ml effectively inhibited the TNF- and LPS-induced adhesiveness of EAhy 926 endothelial cells to monocytic U937 cells. Similar concentration ranges of corn silk extract did also block the TNF and LPS but not the phorbol 12-myristate 13-acetate-induced ICAM-1 expression on EAhy 926 endothelial cell surface. The extract did not alter the production of TNF by LPS-activated macrophages and failed to inhibit the cytotoxic activity of TNF. It is concluded that corn silk possesses important therapeutic potential for TNF- and LPS-mediated leukocyte adhesion and trafficking.

IDENTIFICATION OF LECTINS OF ZEA MAYS RAW MATERIAL AND THE STUDY OF LECTIN ACTIVITY

Directory of Open Access Journals (Sweden)

Karpiuk UV

2013-03-01

Full Text Available The aime of the study was to identify lectins in the Zea mays raw material: roots, stems, heads, leaves and corn silk and study their activity. Lectins activity has been studied using the biological method of ratuserytroagglutination. This method is based on formation of aggregates of lectins and rats erythrocytes. The activity unit was the floor amount of lectins that agglutinate erythrocytes. The protein nature of extracts that agglutinate has been determined using Bradford method. The lectins activity of Zea mays roots was 6,21±0,11 unit/mg of protein; of heads – 2,61±0,17 unit/mg of protein; of leaves – 0,62 ±0,05 unit/mg of protein; of corn silk – 1,06±0,08 unit/mg of protein; of stems – 0,97±0,09 unit/mg of protein. The greatest lectins activity was in leaves, stems and corn silk.

genome-wide association and metabolic pathway analysis of corn earworm resistance in maize

Science.gov (United States)

Marilyn L. Warburton; Erika D. Womack; Juliet D. Tang; Adam Thrash; J. Spencer Smith; Wenwei Xu; Seth C. Murray; W. Paul Williams

2018-01-01

Maize (Zea mays mays L.) is a staple crop of economic, industrial, and food security importance. Damage to the growing ears by corn earworm [Helicoverpa zea (Boddie)] is a major economic burden and increases secondary fungal infections and mycotoxin levels. To identify biochemical pathways associated with native resistance mechanisms, a genome-wide...

In-vitro morphogenesis of corn (Zea mays L.) : I. Differentiation of multiple shoot clumps and somatic embryos from shoot tips.

Science.gov (United States)

Zhong, H; Srinivasan, C; Sticklen, M B

1992-07-01

In-vitro methods have been developed to regenerate clumps of multiple shoots and somatic embryos at high frequency from shoot tips of aseptically-grown seedlings as well as from shoot apices of precociously-germinated immature zygotic embryos of corn (Zea mays L.). About 500 shoots were produced from a shoot tip after eight weeks of culture (primary culture and one subculture of four weeks) in darkness on Murashige and Skoog basal medium (MS) supplemented with 500 mg/L casein hydrolysate (CH) and 9 μM N(6)-benzyladenine (BA). In this medium, shoots formed in shoot tips as tightly packed "multiple shoot clumps" (MSC), which were composed of some axillary shoots and many adventitious shoots. When the shoot tips were cultured on MS medium containing 500 mg/L CH, 9 μM BA and 2.25 μM 2,4-dichlorophenoxyacetic acid (2,4-D), most of the shoots in the clumps were adventitious in origin. Similar shoot tips cultured on MS medium containing 500 mg/L CH, 4.5 μM BA and 2.25 μM 2,4-D regenerated many somatic embryos within eight weeks of culture. Somatic embryos were produced either directly from the shoot apical meristems or from calli derived from the shoots apices. Both the MSC and the embryos produced normal shoots on MS medium containing 2.25 μM BA and 1.8 μM indole-3-butyric acid (IBA). These shoots were rooted on MS medium containing 3.6 μM IBA, and fertile corn plants were grown in the greenhouse. The sweet-corn genotype, Honey N Pearl, was used for the experiments described above, but shoot-tip cultures from all of 19 other corn genotypes tested also formed MSC on MS medium containing 500 mg/L CH and 9 μM BA.

Enhanced fodder yield of maize genotypes under saline irrigation is ...

African Journals Online (AJOL)

Poor quality irrigation water adversely affects the growth and yield of crops. This study was designed to evaluate the growth, fodder yield and ionic concentration of three promising maize (Zea mays L.) genotypes under the influence of varying quality irrigation water, with different salinity levels. The genotypes, such as ...

Blue-green fluorescence and visible-infrared reflectance of corn (Zea mays L.) grain for in situ field detection of nitrogen supply

International Nuclear Information System (INIS)

McMurtrey, J.E. III; Chappelle, E.W.; Kim, M.S.; Corp, L.A.; Daughtry, C.S.T.

1996-01-01

The sensing of spectral attributes of corn (Zea mays L.) grain from site specific areas of the field during the harvest process may be useful in managing agronomic inputs and production practices on those areas of the field in subsequent growing seasons. Eight levels of nitrogen (N) fertilization were applied to field grown corn at Beltsville, Maryland. These N treatments produced a range of chlorophyll levels, biomass and physiological condition in the live plant canopies. After harvest, spectra were obtained in the laboratory on whole grain samples. Fluorescence emissions were acquired from 400 to 600 nm and percent reflectance were measured in the visible (VIS) near infrared (NIR) and mid-infrared (MIR) regions from 400 nm to 2400 nm. A ultraviolet (UV) excitation band centered at 385 nm was the most effective in producing fluorescence emission differences in the blue-green region of the fluorescence spectrum with maxima centered from 430-470nm in the blue and with an intense shoulder centered at around 530-560 nm in the green region. Reflectance showed the most spectral differences in the NIR and MIR (970-2330 nm) regions

Induction of infection in Teosinte (Zea diploperennis through the phytopathogen Ustilago maydis.

Directory of Open Access Journals (Sweden)

Martha Concepción Pérez Díaz

2017-01-01

Full Text Available Introduction: The corn and teosinte share morphological and molecular similarities latter being those that support the theory of teosinte (Zea parviglumis as its predecessor, both species are attacked by specific pathogens like Ustilago maydis. Objective: To analyze the infectious process that presents U. maydis on the variety of the teosinte Zea diploperennis. Materials and Methods: We used the strain of U. maydis FB-D12, which was kept a culture media rich in nutrients (CPES pH 7.0. Viable cells without morphological alterations to the inoculation method of puncture in teosinte seedlings were used. Monitoring of infection was carried out every 24 hours by measuring concentration of chlorophyll and plant tissue through microscopic observation Results: In the seedlings of Zea diploperennis inoculated with U. maydis the symptoms of the infection were presented, wilt and chlorosis in the leaves; The chlorosis was confirmed with the low concentration of chlorophyll 12 days later to the inoculation. In the microscopic observation of cuts of the tissue plant was found mycelium long and branched from the third day of the inoculation, until the appearance of tumors in seedlings of 45 days. Conclusions: The typical signs of infection with Ustilago maydis in the variety of teosinte Zea diploperennis do not differ from those reported for corn. Ustilago maydis presents its full life cycle within the plant, confirming that the diploperennis variety is susceptible.

The use of corn (ZEA MAYS) biomass in drying process

International Nuclear Information System (INIS)

Kricka, T.; Pliestic, S.

1996-01-01

The most important agricultural crop in the world, besides wheat and rice is corn. In the last 10 years, Republic of Croatia has produced about 2000000 tons of corn. Most of that is used for food and feed and for seed production and it is 1000000 tons in quantity. This quantity demands between 35000 to 40000 tons of oil. For the reason, this paper describes the possibilities of the substitution of oil with corn biomass after harvesting. (author)

Effects of Irrigation and Nitrogen Application Rates on Yield and Yield Components of Corn, Sesame and Sugar beet in Mashhad Climatic Condition

Directory of Open Access Journals (Sweden)

R Heydari Pour

2015-07-01

Full Text Available In many crops, incorrect management of nitrogen and water is one of the most important factors in the resources productivity such as water and nitrogen. In order to evaluate the effects of different nitrogen levels (zero, 50, 100 and 150 kg ha-1 and irrigation application rates (100, 75 and 50% of water requirement per species on corn, sesame and sugar beet, three separate experiments was conducted in Agricultural Research Station of Ferdowsi University of Mashhad, Iran, in 2009-2010 growing season. Three separate experiments were arranged by strip plots in randomized complete block design, with three replications. The results showed that effect of irrigation application rates on biological yield and grain number per ear and interaction effects of water × nitrogen on plant height, 100 grain weight and grain yield of corn was significant. With decreasing irrigation over 25 % water requirements, the highest grain yield (4.93 ton ha-1 in corn observed by applying nitrogen equal to 50 kg.ha-1. In addition, the highest maize yield (9.41 ton.ha-1 in mentioned was obtained by supplying 100 % water requirements. Effects of Irrigation levels on plant height and the interaction effects of water × nitrogen on 1000 grain weight in sesame was significant. Under no water stress, the highest grain yield (1.22 ton ha-1 in sesame was obtained with applying 50kg nitrogen per ha. With supplying 75% water requirements plus 50 kg nitrogen per hactar, maximum yield of sesame (820 kg ha-1 was obtained. Results of this study indicated that interaction between studied factors had insignificant effect on economic and biological yield in sugar beet. With supplying 25% water requirements plus 50 kg nitrogen per ha, maximum yield of sugar beet (58.37 ton ha-1 was achieved. It seems that suitable nitrogen management can be considered as approach in optimize the water consuming.

Effect of salt stress on some sweet corn (Zea mays L. var. saccharata genotypes

Directory of Open Access Journals (Sweden)

Shtereva Lydia A.

2015-01-01

Full Text Available An experiment was carried out hydroponically under laboratory conditions to investigate the effect of salt stress on several physiological and biochemical parameters of three sweet corn (Zea mays L. var. saccharata genotypes: lines 6-13, C-6 (pollen source and their heterotic F1 hybrid “Zaharina”. The degree of salinity tolerance among these genotypes was evaluated at three different sodium chloride (NaCl concentrations: 0 mM, 100 mM, 125 mM and 150 mM. Seed germination, plant growth and biochemical stress determining parameters such as malondialdehyde (MDA, proline content and hydrogen peroxide (H2O2 levels were compared between seedlings of lines and hybrid. The obtained results indicated that both lines and hybrid have similar responses at different salinity levels for all examined traits. All the seedlings’ growth parameters, such as germination percentage, root length, shoot length, root and shoot fresh and dry weight, decreased with increasing salinity level. MDA, proline and H2O2 increased at different saline conditions in comparison to the control. Based on the results, of the three genotypes examined, the hybrid Zaharina, followed by line C-6, was more salt-sensitive than line 6-13 in salt stress condition.

Asian corn borer (ACB) and non-ACB pests in GM corn (Zea mays L.) in the Philippines.

Science.gov (United States)

Afidchao, Miladis M; Musters, C J M; de Snoo, Geert R

2013-07-01

The Asian corn borer (ACB), Ostrinia furnacalis (Guenée), has become the most damaging pest in corn in south-east Asia. Corn farmers in the Philippines have incurred great yield losses in the past decades because of ACB infestation. Bacillus thuringiensis (Bt) and Bt herbicide-tolerant (BtHT) corns have been developed to reduce borer attacks worldwide. This study assessed the extent of ACB and non-ACB pest infestations in both GM and non-GM corn in Isabela Province, the Philippines. Specific aims were to reinvestigate the efficacy of Bt corn in controlling ACB, to evaluate what parts of Bt corn plants are susceptible to ACB, to monitor the potential development of ACB resistance and to evaluate whether secondary pests dominate in an ACB-free Bt corn environment. The study involved preparatory interviews with farmers, site selection, field scouting and visual inspection of 200 plants along 200 m transect lines through 198 cornfields. Bt corn can efficiently reduce the ACB pest problem and reduce borer damage by 44%, to damage levels in Bt and BtHT corn of 6.8 and 7% respectively. The leaves of Bt corn were more susceptible, while cobs of Bt corn were less affected by ACB. Non-ACB pests were common in Bt toxin-free cornfields and reduced in non-GM cornfields where ACB was abundant. No secondary pest outbreaks were found in ACB-free Bt cornfields. Bt and BtHT corn hybrids containing the Cry1Ab protein performed well in Isabela Province. Reduced cob damage by ACB on Bt fields could mean smaller economic losses even with ACB infestation. The occurrence of ACB in Bt and BtHT cornfields, although at a moderate and insignificant level, could imply the potential development of resistance to Bt toxin. © 2012 Society of Chemical Industry.

Efficacy of silk channel injections with insecticides for management of Lepidopteran pests of sweet corn

Science.gov (United States)

The primary Lepidopteran pests of sweet corn in Georgia are the corn earworm, Helicoverpa zea (Boddie), and the fall armyworm, Spodoptera frugiperda (J.E. Smith). Control of these pests typically requires multiple insecticide applications from first silking until harvest, with commercial growers fre...

Results of mycological and mycotoxicological investigations of corn-based feed for dairy cow diet

Directory of Open Access Journals (Sweden)

Škrinjar Marija

2011-01-01

Full Text Available In this study, fungal contamination was determined as well as total aflatoxin B1(AB1, ochratoxin A (OTA and zearalenon (ZEA levels in corn-based feed samples obtained from four different farms in Serbia (n=35 during one year. Mycotoxins were detected in feed using the VICAM fluorometric method. It was determined that 97.14% of all samples were contaminated with moulds which belonged to following genera: Absidia, Acremonium, Aspergillus, Cladosporium, Geotrichum, Eurotium, Fusarium, Mucor, Mortierella, Oidiodendron, Penicillium, Rhizopus, Scopulariopsis, Syncephalastrum, Trichoderma, Ulocladium and Wallrothiella. A total of 58 different species were identified. Total mould count per 1 g ranged from 1.00 log cfu/g (dried corn silage - autumn, fresh corn silage - summer and corn grain silage - spring to 7.32 log cfu/g (dried corn silage - winter. Mycotoxins were isolated from 28.5% of samples: ZEA was found in summer (220-240 μg/kg and in spring (240 μg/kg in concentrate samples; OTA was detected in winter in dried corn silage (16 μg/kg and in spring (12 μg/kg; all samples were AB1 free.

Caractérisation de la mycoflore de grains de maïs ( Zea mays ...

African Journals Online (AJOL)

English Title: Characterization of the fungal flora of maize grains (Zea mays) ... Corn kernels disinfected with alcohol were seeded in sterile Petri dishes with ... Fusarium oxysporum (22.05%) and Aspergillus niger (17.78%) are the most ...

Granules morphology and rheological behavior of green banana (Musa cavendishii and corn (Zea mays starch gels Morfologia dos grânulos e comportamento reológico dos géis de amido de banana verde (Musa cavendishii e milho (Zea mays

Directory of Open Access Journals (Sweden)

Dayane Rosalyn Izidoro

2007-10-01

Full Text Available In this work, it was used starch obtained from green banana (Musa cavendishii and commercial corn (Zea mays starch in order to compare the granule morphology and the rheological behavior of these gel-starches. Images of starch granules morphology were obtained from scanning electron microscope (SEM. The banana starch granules presented an oval and ellipsoidal shape with irregular diameters. Neverthless, the granules of corn starch showed a poliedric shape, with different sizes. The rheological behavior of gel starch solutions showed a non-newtonian character with a pseudoplastic behavior. Herschel-Bulkley model gave a good description on the rheological behavior of the gel starch. Banana gel-starch solutions showed higher values of shear stress and apparent viscosity when compared with corn gel-starch solutions. A progressive decrease in shear stress and viscosity occurred with the addition of sodium chloride and sucrose.No presente trabalho foi utilizado amido obtido de banana verde (Musa cavendishii e amido de milho (Zea mays comercial, com o objetivo de comparar a morfologia dos grânulos e o comportamento reológico dos géis. As imagens da morfologia dos grânulos foram obtidas por microscopia eletrônica de varredura. Os grânulos de amido da banana apresentaram forma oval e elipsoidal com diâmetros irregulares, todavia, os grânulos do amido de milho mostraram forma poliédrica e diferentes tamanhos. As análises reológicas dos géis das soluções de amido mostraram caráter não-newtoniano, pseudoplástico. O modelo de Herschel-Bulkley foi o que melhor representou comportamento reológico dos géis. O gel de amido de banana verde obteve maiores valores de tensão de cisalhamento e viscosidade aparente quando comparada ao gel de amido de milho. Ocorreu um decréscimo progressivo na tensão de cisalhamento e na viscosidade com a adição de cloreto de sódio e sacarose aos géis.

Is the lack of water the reason for declining corn yield in Eastern Colorado since 1990?

Science.gov (United States)

Phillips, T. P.

2013-12-01

According to the World Agriculture Report published in 2012, a growth in cereal yield of 1.6% per year is necessary to cover the predicted global demand by 2050. Because corn is heavily subsidized in the United States, it is being planted in large quantities in the Midwest. Its need for large amounts of water means that it is unsuited for this dry region. Since the early 1950s the average yield per acre has increased linearly at 1.5% per year due to improvements in the seed production and protection until the early 1990s. Since 1993 however, there has still been an increase albeit at a much lower 0.3%. For this study the corn yield data made available by the United States Department of Agriculture (USDA) for the regions of the South and North Platte River, as well as the Upper Mississippi are divided into two sets: those for irrigated areas and those for non-irrigated areas. We compare the annual yield trend since 2003 to local precipitation and the variation in water aquifer levels measured using the Gravity Recovery and Climate Experiment (GRACE) satellite gravity data to analyze the importance of water. Our results indicate that, up until 1990, both areas show an annual growth, whereby the growth of non-irrigated corn yield is half that of irrigated corn. After 1993 the non-irrigated corn shows a negative annual yield trend, whereas the irrigated corn yield still increases. Furthermore the non-irrigated corn yield is highly correlated to the negative trend of the GRACE mass measurements for the region. We therefore conclude, that water is the most important variable for the successful harvest of corn and irrigation is therefore essential for dry regions. As the aquifer water level is clearly declining in the region as indicated by GRACE as well as field well measurements, yield for irrigated corn will be affected once the water drops below a certain level. Serious consideration should therefore be given to planting a different, more suitable crop in those

Physicochemical, Thermal, and Sensory Properties of Blue Corn (Zea Mays L.).

Science.gov (United States)

Mutlu, Ceren; Arslan-Tontul, Sultan; Candal, Cihadiye; Kilic, Ozlem; Erbas, Mustafa

2018-01-01

The aim of this study was to investigate some physicochemical and sensory properties of blue corn cultivated in Turkey. The length and width of the cob with kernels, hectoliter, and 1000-kernel weight of blue corn were measured as 7.66, 2.02 mm, 84.40 kg/100 L, and 44.27 g, respectively. The gelatinization onset, peak, and end temperatures were measured as 61.12 °C, 64.35 °C, and 75.65 °C, respectively. The water activity, moisture content, total protein, lipid, and crude fiber contents of the blue corn sample were detected as 0.44, 9.39%, 13.13%, 4.30%, and 2.68%, respectively. Total starch and resistant starch contents of blue corn were determined as 63.94% and 8.89%, respectively. Also, total monomeric anthocyanin content and antioxidant capacity of blue corn were detected as 915.43 mg CGE/kg and 7.99 μmol TE/g, respectively. Additionally, the major fatty acids detected in blue corn samples were palmitic, stearic, oleic, and linoleic acids. Blue corn can be utilized in the production of enjoyable and healthier snacks, such as popcorn and chips, because of its color and high phenolic, anthocyanin, and fiber contents. © 2017 Institute of Food Technologists®.

Growing ethanol sector drives corn supply chain shift for the last decade

Science.gov (United States)

Kim, T.; Schmitt, J.; Brauman, K. A.; Smith, T. M.; Suh, K.

2017-12-01

The US is the largest producer in the world, 89% of corn production uses in domestic demands in 2012. Carbon emission and irrigated water usage in the corn farming stage are hot-spot in the meat production sectors, comprise 37% of all US corn demand. The annual capacity of the ethanol sector increases from 6.5 billion gallons to 15.3 billion gallons for the last decade. The growth of corn demand in ethanol sector makes corn supply chain shift. Most of the ethanol plants located in the Mid-west where is the top 12 corn producing states. Therefore animal feeds take more supply from the other states. The purpose of this study is to estimate environmental impacts and water scarcity associated embedded corn by the temporal and spatial corn supply chain model based on a cost minimization. We use publicly available county-level data on corn production, feed demands, aggregative carbon emission and irrigated water usage in farming state, and a water depletion index as a metric for determining water scarcity. The water stressed counties produce 23.3% of US total corn production in 2012, and the irrigated corn is 14.2%. We simulated the corn supply chain using linear programming and developed the web-based visualization tools called FoodS3 (Food Systems Supply-chain Sustainability tool, http://foods3.org).

Nutrient content in maize fertilized with tannery sludge vermicompost and irrigated with domestic wastewater

Directory of Open Access Journals (Sweden)

Guilherme Malafaia

2016-11-01

Full Text Available This study analyzed the macro and micronutrient content of maize leaves (Zea mays L. grown in soil containing tannery sludge vermicomposting and irrigated with wastewater. The arrangement of the treatments consisted of a factorial 2x6 (two types of irrigation and six kinds of fertilizer in a completely randomized design, with five repetitions, totaling sixty experimental units. The following experimental units, irrigated with supply water (A and household wastewater (R, were established: (T1 Control Soil, with no chemical fertilization and no vermicomposting; (T2 Soil + NPK; (T3 Soil + primary sludge vermicompost; (T4 Soil + P + primary sludge vermicompost; (T5 Soil + P + liming sludge vermicompost; and (T6 Soil + liming sludge vermicompost. For the leaf-tissue analysis, the opposite whole leaf below the first (upper ear was collected from each plant, excluding the midrib at the onset of the female inflorescence. The results showed that both wastewater and the tannery sludge vermicomposts can be a good source of nutrients for maize plants, since the macro and micronutrients in the leaves of plants were satisfactory and no signs or symptoms of toxicity were observed. While leaf analysis alone is insufficient to assess the nutritional status of plants, this study innovatively suggests the potential beneficial use of a combination of wastewater and tannery sludge vermicompost in the cultivation of corn, motivating new research.

Elevated carbon dioxide reduces emission of herbivore induced volatiles in Zea mays

Science.gov (United States)

Terpene volatiles produced by sweet corn (Zea mays) upon infestation with pests such as beet armyworm (Spodoptera exigua) function as part of an indirect defense mechanism by attracting parasitoid wasps; yet little is known about the impact of atmospheric changes on this form of plant defense. To in...

Effect of Coated Urea Fertilizer on Yield and Yield Components of Sweet Corn (KSC 403 under Deficit Irrigation

Directory of Open Access Journals (Sweden)

N Farid

2017-11-01

Full Text Available This study was carried out to assess the effect of coated urea fertilizer on yield and yield components of sweet corn (KSC 403 under different irrigation regimes, in Ramin Agriculture and Natural Sciences University, Iran by using strip split plot in a randomized complete block design with four replications. Three levels of deficit irrigation (100%, 80 and 60% of calculated water requirement of sweet corn were assigned as vertical factor and six sources of urea fertilizer (without urea, un-coated urea, sulfur-coated urea fertilizer, starch-coated urea, agar-coated urea and chitin-coated urea were assigned to horizontal factor. Effects of deficit water and source of fertilizer were statistically significant on plant height, 1000 kernel weight, ear diameter, and number of rows per ear, ear yield, biological yield and harvest index. Maximum of plant height (153.23 cm, 1000 kernel weight (104.51 g, grain yield (9853.3 kg/ha and biological yield (12471.6 kg/ha were obtained in chitin coated urea fertilizer. Maximum of ear diameter (4.67 cm and number of row per ear (13.22 were achieved in agar coated urea fertilizer and that of harvest index (45.79% was indicated by starch-coated urea. Maximum of length of ear, number of kernels per row and grain yield were 23.65cm, 25.83 and 7142 kg/ha, respectively, and were obtained with the using of chitin-coated urea fertilizer and 100% water requirement. Minimum values of these traits were 13.54 cm, 5.56 and 871 kg/ha, respectively, and were obtained by using of control (no urea application and 60% water requirement. Results showed that biopolymer coated urea is potent to improve some morphological characteristics and increase grain yield of sweet corn.

Influence of s-Triazines on Some Enzymes of Carbohydrates and Nitrogen Metabolism in Leaves of Pea (Pisum sativum L.) and Sweet Corn (Zea mays L.)

Science.gov (United States)

Wu, M. T.; Singh, B.; Salunkhe, D. K.

1971-01-01

Foliar applications of 2 milligrams per liter of 2-chloro-4,6-bis (ethylamino)-s-triazine, 2-methylmercapto-4-ethylamino-6-isobutylamino-s-triazine, and 2-methoxy-4-isopropylamino-6-butylamino-s-triazine caused increases in the activities of starch phosphorylase, pyruvate kinase, cytochrome oxidase, and glutamate dehydrogenase 5, 10, and 15 days after treatment in the leaves of 3-week-old seedlings of pea (Pisum sativum L.) and sweet corn (Zea mays L.). The results indicate that sublethal concentrations of s-triazine compounds affect the physiological and biochemical events in plants which favor more utilization of carbohydrates for nitrate reduction and synthesis of amino acids and proteins. PMID:16657830

Corn in consortium with forages

Directory of Open Access Journals (Sweden)

Cássia Maria de Paula Garcia

2013-12-01

Full Text Available The basic premises for sustainable agricultural development with focus on rural producers are reducing the costs of production and aggregation of values through the use crop-livestock system (CLS throughout the year. The CLS is based on the consortium of grain crops, especially corn with tropical forages, mainly of the genus Panicum and Urochloa. The study aimed to evaluate the grain yield of irrigated corn crop intercropped with forage of the genus Panicum and Urochloa. The experiment was conducted at the Fazenda de Ensino, Pesquisa e Extensão – FEPE  of the Faculdade de Engenharia - UNESP, Ilha Solteira in an Oxisol in savannah conditions and in the autumn winter of 2009. The experimental area was irrigated by a center pivot and had a history of no-tillage system for 8 years. The corn hybrid used was simple DKB 390 YG at distances of 0.90 m. The seeds of grasses were sown in 0.34 m spacing in the amount of 5 kg ha-1, they were mixed with fertilizer minutes before sowing  and placed in a compartment fertilizer seeder and fertilizers were mechanically deposited in the soil at a depth of 0.03 m. The experimental design used was a randomized block with four replications and five treatments: Panicum maximum cv. Tanzania sown during the nitrogen fertilization (CTD of the corn; Panicum maximum cv. Mombaça sown during the nitrogen fertilization (CMD of the corn; Urochloa brizantha cv. Xaraés sown during the occasion of nitrogen fertilization (CBD of the corn; Urochloa ruziziensis cv. Comumsown during the nitrogen fertilization (CRD of the corn and single corn (control. The production components of corn: plant population per hectare (PlPo, number of ears per hectare (NE ha-1, number of rows per ear (NRE, number of kernels per row on the cob (NKR, number of grain in the ear (NGE and mass of 100 grains (M100G were not influenced by consortium with forage. Comparing grain yield (GY single corn and maize intercropped with forage of the genus Panicum

Milk line as an indicator of the harvesting time of three hybrid seeds of corn (Zea mays L.

Directory of Open Access Journals (Sweden)

Célio Trzeciak dos Santos

2005-03-01

Full Text Available The experiment was carried out to evaluate the time for harvesting seeds of three hybrids of corn (Zea mays L. at their best physiological quality and the use of the milk line as an indicator of the physiological seed maturity. Single hybrids CD 1723 and CD 5501 and double hybrid OC 705 seeds were collected for 59 days, every four days, starting 23 days after female flowering. Seed dry weight, moisture content, germination, vigour (cold and accelerated aging tests, black layer formation and seed milk line development were analysed. The harvesting time started 47 days after female flowering with high physiological quality of the seeds identified by a joint analysis of those seven characteristics of them. The milk line at stage 4 proved to be the best indicator of the time to harvest corn seeds for maximum physiological quality, because different stages of milk line development in corn seeds could be easily identified in the filed without any special equipment.O experimento foi conduzido durante o ano agrícola de 1996/97 em área experimental da Cooperativa de Desenvolvimento Econômico e Tecnológico (Coodetec, em Cascavel, Paraná, com o objetivo de avaliar o efeito da época de colheita de três híbridos de milho (Zea mays L. na qualidade fisiológica das sementes e o uso da linha de solidificação do endosperma como indicativo da maturidade fisiológica das sementes. O plantio foi realizado em 30 de setembro de 1996. Amostras de sementes dos híbridos simples CD 1723 e CD 5501, bem como do híbrido duplo OC 705, foram colhidas em intervalos de quatro dias, durante 59 dias, iniciando-se a colheita no vigésimo terceiro dia após o florescimento feminino. As características avaliadas nas sementes foram o acúmulo de matéria seca, o conteúdo de umidade, a germinação, o vigor (pelos testes de frio e de envelhecimento acelerado, a formação da camada preta e o desenvolvimento da linha de solidificação do endosperma. A colheita dos tr

Uptake and distribution of cadmium in corn

International Nuclear Information System (INIS)

Peel, J.W.; Vetter, R.J.; Christian, J.E.; Kessler, W.V.; McFee, W.W.

1978-01-01

The uptake and distribution of cadmium in corn (Zea mays) treated at various time intervals after planting and sampled at various times after treatment were measured. Cadmium was found to accumulate in all parts sampled. As shown in field studies, stems and leaves generally concentrated more cadmium than did husks, cobs, kernels, silks, or tassels. Samples of stems and leaves from corn treated 23 days after planting and sampled 5 days later exhibited higher concentrations of cadmium than samples taken 25, 45, 65, or 85 days after treatment. Concentrations generally decreased with time. Greenhouse studies showed that corn exposed to cadmium for the longest period of time accumulated the greatest total cadmium. The highest cadmium concentrations were found in the base or lowest leaves sampled 45 days after planting; this suggests a useful technique for quick screening corn crops for cadmium pollution

The use of corn (ZEA MAYS) biomass in drying process; Upotreba biomase kukuruza (ZEA MAYS) u procesu susenja

Energy Technology Data Exchange (ETDEWEB)

Kricka, T; Pliestic, S [Agronomski fakultet, Zavod za poljoprivrednu tehnologiju, skladistenje i transport, Zagreb (Croatia)

1997-12-31

The most important agricultural crop in the world, besides wheat and rice is corn. In the last 10 years, Republic of Croatia has produced about 2000000 tons of corn. Most of that is used for food and feed and for seed production and it is 1000000 tons in quantity. This quantity demands between 35000 to 40000 tons of oil. For the reason, this paper describes the possibilities of the substitution of oil with corn biomass after harvesting. (author). 3 tabs., 13 refs.

Role of transpiration reduction during center-pivot sprinkler irrigation in application efficiency

OpenAIRE

Urrego Pereira, Yenny Fernanda; Cavero Campo, José; Medina Pueyo, Eva Teresa; Martínez-Cob, Antonio

2013-01-01

The magnitude and duration of corn transpiration reduction during center-pivot sprinkler irrigation was analyzed on a commercial plot. The irrigation event was defined as the period during which the pivot arm was passing over the transect AC and water droplets were moistening the plants (moist treatment). Corn transpiration rates were measured at three spots of that transect and simultaneously at another spot (dry treatment) located approximately 270 m east from the transect AC. Corn transpir...

Derivation of a regional active-optical reflectance sensor corn algorithm

Science.gov (United States)

Active-optical reflectance sensor (AORS) algorithms developed for in-season corn (Zea mays L.) N management have traditionally been derived using sub-regional scale information. However, studies have shown these previously developed AORS algorithms are not consistently accurate when used on a region...

Purple Corn (Zea mays L.) Phenolic Compounds Profile and Its Assessment as an Agent Against Oxidative Stress in Isolated Mouse Organs

Science.gov (United States)

Ramos-Escudero, Fernando; Muñoz, Ana María; Alvarado-Ortíz, Carlos; Alvarado, Ángel

2012-01-01

Abstract This study was designed to determine the contents of total polyphenols, flavonoids, flavonols, flavanols, and anthocyanins of purple corn (Zea mays L.) extracts obtained with different methanol:water concentrations, acidified with 1% HCl (1 N). Another objective was to determine the antioxidant activity by 1,1-diphenyl-2-picrylhydrazyl (DPPH), 2,2′-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), ferric reducing antioxidant power (FRAP), and deoxyribose assay, individual phenolic compounds by high-performance liquid chromatography (HPLC), and endogenous antioxidant enzyme (superoxide dismutase [SOD], catalase [CAT], and total peroxidase [TPX]) activity and lipid peroxidation activity (thiobarbituric acid–reactive substances [TBARS] assay) in isolated mouse organs. Overall, the highest total content of polyphenols, anthocyanins, flavonoids, flavonols, and flavanols was obtained with the 80:20 methanol:water extract, acidified with 1% HCl (1 N). The 50% inhibitory concentration values obtained by the DPPH and ABTS assays with this extract were 66.3 μg/mL and 250 μg/mL, respectively. The antioxidant activity by the FRAP assay was 26.1 μM Trolox equivalents/g, whereas the deoxyribose assay presented 93.6% inhibition. Because of these results, the 80:20 methanol:water extract, acidified with 1% HCl (1 N), was used for the remaining tests. Eight phenolic compounds were identified by HPLC: chlorogenic acid, caffeic acid, rutin, ferulic acid, morin, quercetin, naringenin, and kaempferol. Furthermore, it was observed that the purple corn extract was capable of significantly reducing lipid peroxidation (lower malondialdehyde [MDA] concentrations by the TBARS assay) and at the same time increasing endogenous antioxidant enzyme (CAT, TPX, and SOD) activities in isolated mouse kidney, liver, and brain. On the basis of the results, it was concluded that the purple corn extract contained various bioactive phenolic compounds that exhibited

Purple corn (Zea mays L.) phenolic compounds profile and its assessment as an agent against oxidative stress in isolated mouse organs.

Science.gov (United States)

Ramos-Escudero, Fernando; Muñoz, Ana María; Alvarado-Ortíz, Carlos; Alvarado, Ángel; Yáñez, Jaime A

2012-02-01

This study was designed to determine the contents of total polyphenols, flavonoids, flavonols, flavanols, and anthocyanins of purple corn (Zea mays L.) extracts obtained with different methanol:water concentrations, acidified with 1% HCl (1 N). Another objective was to determine the antioxidant activity by 1,1-diphenyl-2-picrylhydrazyl (DPPH), 2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), ferric reducing antioxidant power (FRAP), and deoxyribose assay, individual phenolic compounds by high-performance liquid chromatography (HPLC), and endogenous antioxidant enzyme (superoxide dismutase [SOD], catalase [CAT], and total peroxidase [TPX]) activity and lipid peroxidation activity (thiobarbituric acid-reactive substances [TBARS] assay) in isolated mouse organs. Overall, the highest total content of polyphenols, anthocyanins, flavonoids, flavonols, and flavanols was obtained with the 80:20 methanol:water extract, acidified with 1% HCl (1 N). The 50% inhibitory concentration values obtained by the DPPH and ABTS assays with this extract were 66.3 μg/mL and 250 μg/mL, respectively. The antioxidant activity by the FRAP assay was 26.1 μM Trolox equivalents/g, whereas the deoxyribose assay presented 93.6% inhibition. Because of these results, the 80:20 methanol:water extract, acidified with 1% HCl (1 N), was used for the remaining tests. Eight phenolic compounds were identified by HPLC: chlorogenic acid, caffeic acid, rutin, ferulic acid, morin, quercetin, naringenin, and kaempferol. Furthermore, it was observed that the purple corn extract was capable of significantly reducing lipid peroxidation (lower malondialdehyde [MDA] concentrations by the TBARS assay) and at the same time increasing endogenous antioxidant enzyme (CAT, TPX, and SOD) activities in isolated mouse kidney, liver, and brain. On the basis of the results, it was concluded that the purple corn extract contained various bioactive phenolic compounds that exhibited considerable in vitro

Fumonisins in corn (Zea mays L.) from Southern Brazil.

Science.gov (United States)

Scussel, Vildes M; Savi, Geovana D; Costas, Lea Luzia Freitas; Xavier, José Junior Mendonça; Manfio, Daniel; Bittencourt, Karoline O; Aguiar, Kin; Stein, Stephanie M

2014-01-01

A total of 232 samples of corn commercialised in Santa Catarina state, Southern Brazil (temperate zone climate), were evaluated from 2007 to 2012 for fumonisins (FBs: FB1 and FB2). Before performing this study, a FBs method with liquid chromatography and fluorescence detection (ex. 335; em. 440 nm) was validated first. FBs were detected in 46.6% (108 samples), with values ranging from 66 to 7832 µg kg(-1) for FB1 and 110 to 1201 µg kg(-1) for FB2. The number of contaminated corn samples for FB1 and FB2 varied and often presented contamination of FB1 only. Per year of analysis, the numbers were: n = 22/8(FB1/FB2), 44/5(FB1/FB2), 25/12(FB1/FB2), 4(FB1), 6(FB1) and 7(FB1) in 2007, 2008, 2009, 2010, 2011 and 2012, respectively. The contamination percentage was 42.3/15.4, 59.5/6.8, 43.8/21.1, 36.4, 35.3 and 33.3%, respectively, during these years. Consumers can be exposed to these mycotoxins and their health can be at risk through the consumption of contaminated corn.

Establishment and function of cover crops interseeded into corn

Science.gov (United States)

Cover crops can provide ecological services and improve the resiliency of annual cropping systems; however, cover crop use is low in corn (Zea mays L.)-soybean [Glycine max (L.) Merr.] rotations in the upper Midwest due to challenges with establishment. Our objective was to compare three planting me...

Effects of planting method on agronomic characteristics, yield and yield components of sweet and super sweet corn (Zea mays L. varieties under saline conditions

Directory of Open Access Journals (Sweden)

F. Faridi

2016-05-01

Full Text Available In order to evaluate the effects of planting pattern on morphological, Phonological, yield and yield components of sweet and super sweet corn (Zea mays L. varieties under saline conditions, a field experiment was conducted as split plots based on a randomized complete block design with four replications. Planting pattern in 3 levels included one row in ridge, two row in ridge and furrow planting, as a main plot and varieties in 4 levels sweet corn with 2 types (KSc 403 su, Merit and super sweet with two types (Basin, obsession as sub plots. The results showed that planting pattern had significant differences on plant height, ear height, leaf length, leaf width, number of kernel per row, number of rows per ear and 1000-kernel weight. but had no significant effects on the length of tassel, number of leaf/plant, number of leaf per plant above ear, stem diameter, time of anthesis, time of silking, anthesis silking interval ASI, grain yield, biological yield and harvest index. Different varieties had significant effects on the total characteristics studied except number of leaf above ear and stem diameter. Most of the conservable grain yield and harvest index was in Obsession variety (10 kg and 39%, respectively and the least was seen in Basin (4 kg and 20%, respectively. The result showed that use of furrow planting pattern for sweet and super sweet corn in saline conditions can effects result in higher yield.

Impact of applying edible oils to silk channels on ear pests of sweet corn.

Science.gov (United States)

Ni, Xinzhi; Sparks, Alton N; Riley, David G; Li, Xianchun

2011-06-01

The impact of applying edible oils to corn silks on ear-feeding insects in sweet corn, Zea mays L., production was evaluated in 2006 and 2007. Six edible oils used in this experiment were canola, corn, olive, peanut, sesame, and soybean. Water and two commercial insecticidal oils (Neemix neem oil and nC21 Sunspray Ultrafine, a horticultural mineral oil) were used as the controls for the experiment. Six parameters evaluated in this experiment were corn earworm [Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae)] damage rating, the number of sap beetle [Carpophilus spp. (Coleoptera: Nitidulidae)] adults and larvae, the number of corn silk fly (or picture-winged fly) (Diptera: Ulidiidae) larvae, common smut [Ustilago maydis (D.C.) Corda] infection rate, and corn husk coverage. Among the two control treatments, neem oil reduced corn earworm damage at both pre- and postpollination applications in 2006, but not in 2007, whereas the mineral oil applied at postpollination treatments reduced corn earworm damage in both years. The mineral oil also reduced the number of sap beetle adults, whereas the neem oil applied at postpollination attracted the most sap beetle adults in 2007. Among the six edible oil treatments, the corn and sesame oils applied at postpollination reduced corn earworm damage only in 2007. The application of the peanut oil at postpollination attracted more sap beetle adults in 2006, and more sap beetle larvae in 2007. Olive and neem oils significantly reduced husk coverage compared with the water control in both years. The mineral oil application consistently increased smut infection rate in both 2006 and 2007. Ramifications of using oil treatments in ear pest management also are discussed.

P USE EFFICIENCY BY CORN (Zea mays L. IN ULTISOL DUE TO APPLICATION OF COAL FLY ASH-CHICKEN MANURE MIXTURE

Directory of Open Access Journals (Sweden)

Agus Hermawan

2014-06-01

Full Text Available Low P availability is the main constraint for crops on acidic soil such as an Ultisols due to high soil P sorption. The objective of current research was to determine the effect of coal fly ash-chicken manure mixture application on P use efficiency by corn (Zea mays L. in Ultisols. The research were arranged according to Factorial Completely Randomized Design with three replicates. The treatments tested were the rates of FA-CM mixture (w/w of 1:1 that consisted of 0, 15, 30, 45 and 60 tons ha-1, and P fertilizer rates that consisted of 0, 0.5, 1.0, 1.5 and 2.0 times of P requirement to achieve of 0.2 μg P mL-1 in soil solution (equivalence to 0, 87, 174, 261 and 348 kg P2O5 ha-1. Results of current research showed that P use efficiency by corn on Ultisols had been increased through the addition of FA-CM in combination with P fertilization at the rate of 87 kg P2O5 ha-1. The optimum rate of FA-CM in combination with P fertilizer at the rate of 87 kg P2O5 ha-1 is 28.60 tons ha-1, with P uptake efficiency of 42.41 % and agronomic P efficiency of 82.53 mg shoot dry weight/mg P from fertilizer.

Caractérisation de neuf échantillons de farine de maïs Zea mays (L ...

African Journals Online (AJOL)

SARAH

31 juil. 2017 ... Adjamé, Aspergillus niger est respectivement présent à 41, 45 et 33 ... Objective : The aim of this work is to characterize the fungal flora of nine samples of maize flour [Zea ..... and mycotoxins production in Nigerian corn and.

Field screening of experimental corn hybrids and inbred lines for multiple ear-feeding insect resistance.

Science.gov (United States)

Ni, Xinzhi; Xu, Wenwei; Krakowsky, Matthew D; Buntin, G David; Brown, Steve L; Lee, R Dewey; Coy, Anton E

2007-10-01

Identifying and using native insect resistance genes is the core of integrated pest management. In this study, 10 experimental corn, Zea mays L., hybrids and 10 inbred lines were screened for resistance to major ear-feeding insects in the southeastern Coastal Plain region of the United States during 2004 and 2005. Ear-feeding insect damage was assessed at harvest by visual damage rating for the corn earworm, Helicoverpa zea (Boddie), and by the percentage of kernels damaged by the maize weevil, Sitophilus zeamais Motschulsky, and stink bugs [combination of Euschistus servus (Say) and southern green stink bug, Nezara viridula (L.)]. Among the eight inbred lines and two control populations examined, C3S1B73-5b was resistant to corn earworm, maize weevil, and stink bugs. In contrast, C3S1B73-4 was resistant to corn earworm and stink bugs, but not to maize weevil. In a similar manner, the corn hybrid S1W*CML343 was resistant to all three ear-feeding insects, whereas hybrid C3S1B73-3*Tx205 was resistant to corn earworm and maize weevil in both growing seasons, but susceptible to stink bugs in 2005. The silk-feeding bioassay showed that corn earworm developed better on corn silk than did fall armyworm. Among all phenotypic traits examined (i.e., corn ear size, husk extension, and husk tightness), only corn ear size was negatively correlated to corn earworm damage in the inbred lines examined, whereas only husk extension (i.e., coverage) was negatively correlated to both corn earworm and maize weevil damage on the experimental hybrids examined. Such information could be used to establish a baseline for developing agronomically elite corn germplasm that confers multiple ear-feeding insect resistance.

Corn Cultivation to Reduce the Mycotoxin Contamination

Directory of Open Access Journals (Sweden)

Yangseon Kim

2017-09-01

Full Text Available The effects of insecticide and fungicide treatment were investigated to reduce mycotoxin contamination of corn (Zea mays L. seeds. Deoxynivalenol and zearalenone contents were reduced in the treated seeds, but aflatoxin, ochratoxin A, fumonisin, and T-2 toxin were not effective by chemical treatments. The chemical treatment did not affect the growth of saprophyte, but inhibited the pathogenic fungi such as Fusarium verticillioides, F. graminearum and F. equiseti. Myotoxin contents at different harvesting time were compared. As the harvest time was delayed, both levels of deoxynivalenol and zearalenone and frequency of Fusarium spp. increased. However, the major nutrient contents of corn seeds were not affected by harvesting period. These results show that chemical treatments are necessary to reduce the fungal contamination of corn and harvest without delay is important as well.

Aerial spray deposition on corn silks applied at high and low spray rates

Science.gov (United States)

Corn earworm is a major pest of sweet corn, especially when grown organically. Aerial application of insecticides is important for both conventionally- and organically-grown sweet corn production as sweet corn is frequently irrigated to assure return on investment given the high production costs. ...

Sustainability of corn stover harvest strategies in Pennsylvania

Science.gov (United States)

Paul R. Adler; Benjamin M. Rau; Gregory W. Roth

2015-01-01

Pennsylvania farmers have a long history of harvesting corn (Zea mays L.) stover after grain harvest for animal bedding and feed or as a component of mushroom compost, or as silage for dairy cattle feed. With the shallow soils and rolling topography, soil erosion and carbon losses have been minimized through extensive use of cover crops, no-till, and...

A new artificial diet for western corn rootworm larvae is compatible with and detects resistance to all current Bt toxins

Science.gov (United States)

Insect resistance to transgenic crops expressing one or more genes from Bacillus thuringiensis Berliner (Bt) is a growing concern for farmers, regulatory agencies, the seed industry, and researchers alike. Western corn rootworm (Diabrotica virgifera virgifera LeConte) is a pest of corn (Zea mays L.)...

Kernel compositions of glyphosate-tolerant and corn rootworm-protected MON 88017 sweet corn and insect-protected MON 89034 sweet corn are equivalent to that of conventional sweet corn (Zea mays).

Science.gov (United States)

Curran, Kassie L; Festa, Adam R; Goddard, Scott D; Harrigan, George G; Taylor, Mary L

2015-03-25

Monsanto Co. has developed two sweet corn hybrids, MON 88017 and MON 89034, that contain biotechnology-derived (biotech) traits designed to enhance sustainability and improve agronomic practices. MON 88017 confers benefits of glyphosate tolerance and protection against corn rootworm. MON 89034 provides protection against European corn borer and other lepidopteran insect pests. The purpose of this assessment was to compare the kernel compositions of MON 88017 and MON 89034 sweet corn with that of a conventional control that has a genetic background similar to the biotech sweet corn but does not express the biotechnology-derived traits. The sweet corn samples were grown at five replicated sites in the United States during the 2010 growing season and the conventional hybrid and 17 reference hybrids were grown concurrently to provide an estimate of natural variability for all assessed components. The compositional analysis included proximates, fibers, amino acids, sugars, vitamins, minerals, and selected metabolites. Results highlighted that MON 88017 and MON 89034 sweet corns were compositionally equivalent to the conventional control and that levels of the components essential to the desired properties of sweet corn, such as sugars and vitamins, were more affected by growing environment than the biotech traits. In summary, the benefits of biotech traits can be incorporated into sweet corn with no adverse effects on nutritional quality.

SILAGE QUALITY OF CORN AND SORGHUM ADDED WITH FORAGE PEANUTS

Directory of Open Access Journals (Sweden)

WALKÍRIA GUIMARÃES CARVALHO

2016-01-01

Full Text Available Corn and sorghum are standard silage crops because of their fermentative characteristics. While corn and sorghum silages have lower crude protein (CP contents than other crops, intercropping with legumes can increase CP content. Furthermore, one way to increase CP content is the addition of legumes to silage. Consequently, the research objective was to evaluate the fermentative and bromatological characteristics of corn (Zea mays and sorghum (Sorghum bicolor silages added with forage peanuts (Arachis pintoi. The experimental design was completely randomized with four replicates. The treatments consisted of corn silage, sorghum silage, forage peanut silage, corn silage with 30% forage peanut, and sorghum silage with 30% forage peanut. The results showed that the corn and sorghum added with peanut helped to improve the silage fermentative and bromatological characteristics, proving to be an efficient technique for silage quality. The forage peanut silage had lower fermentative characteristics than the corn and sorghum silages. However, the forage peanut silage had a greater CP content, which increased the protein contents of the corn and sorghum silages when intercropped with forage peanuts.

Energy issues affecting corn/soybean systems: Challenges for sustainable production

Science.gov (United States)

Quantifying energy issues associated with agricultural systems, even for a simple two-crop corn (Zea mays L.) and soybean (Glycine max [L.] Merr.) rotation, is not a simple task. It becomes even more complicated if the goal is to include all aspects of sustainability (i.e., economic, environmental, ...

Parasitoids attacking fall armyworm (Lepidoptera: Noctuidae) in sweet corn habitats

Science.gov (United States)

Fall armyworm larvae, Spodoptera frugiperda (J. E. Smith), were collected from sweet corn plants (Zea mays L.) in fields located in three south Florida counties. Fields were sampled from 2010 – 2015 during the fall and spring seasons. Larvae were brought back to the laboratory to complete developme...

Within-field Corn Nitrogen Response Related to Aerial Photograph Color

Science.gov (United States)

Precision agriculture management of nitrogen (N) using aerial imagery of corn [Zea mays L.] canopy color has been a proposed strategy to understand crop N health and base within-season N fertilizer application rates. The objective of this study was to evaluate at field scale the relationship between...

Improved Canopy Sensor-based Corn Nitrogen Recommendations Using Auxiliary Information

Science.gov (United States)

The nitrogen (N) supplying capacity of the soil available to support corn (Zea mays L.) production can be highly variable both among and within fields. Thus, the amount of N fertilizer applied should be site-specific and also climate-sensitive. In recent years, canopy reflectance sensing has been in...

Corn stover for advanced biofuels perspectives of a soil “Lorax”

Science.gov (United States)

Crop residues like corn (Zea Mays L) stover are potential feedstock for production of advanced biofuels (e.g., cellulosic ethanol). Utilization of residue like stover for biofuel feedstock may provide economic and greenhouse gas mitigation benefits; however, harvesting these materials must be done i...

Legumes and forage species sole or intercropped with corn in soybean-corn succession in midwestern Brazil

Directory of Open Access Journals (Sweden)

Gessí Ceccon

2013-02-01

Full Text Available The feasibility of no-tillage in the Cerrado (Savanna-like vegetation of Brazil depends on the production of sufficient above-ground crop residue, which can be increased by corn-forage intercropping. This study evaluated how above-ground crop residue production and yields of soybean and late-season corn in a soybean-corn rotation were influenced by the following crops in the year before soybean: corn (Zea mays L. intercropped with Brachiaria (Urochloa brizantha cv. Marandu, B. decumbens cv. Basilisk, B. ruziziensis, cv. comum., Panicummaximum cv. Tanzânia, sunn hemp (Crotalaria juncea L., pigeon pea [Cajanus cajan (L. Millsp]; sole corn, forage sorghum [Sorghum bicolor (L. Moench (cv. Santa Elisa], and ruzi grass. In March 2005, corn and forage species were planted in alternate rows spaced 0.90 m apart, and sole forage species were planted in rows spaced 0.45 m apart. In October 2005, the forages were killed with glyphosate and soybean was planted. After the soybean harvest in March 2006, sole late-season corn was planted in the entire experimental area. Corn grain and stover yields were unaffected by intercropping. Above-ground crop residue was greater when corn was intercropped with Tanzania grass (10.7 Mg ha-1, Marandu (10.1 Mg ha-1, and Ruzi Grass (9.8 Mg ha-1 than when corn was not intercropped (4.0 Mg ha-1. The intercropped treatments increased the percentage of soil surface covered with crop residue. Soybean and corn grain yields were higher after sole ruzi grass and intercropped ruzi grass than after other crops. The intercropping corn with Brachiaria spp. and corn with Panicum spp. increases above-ground crop residue production and maintains nutrients in the soil without reducing late-season corn yield and the viability of no-till in the midwestern region of Brazil.

The Effects of Source and Rate of Nitrogen Fertilizer and Irrigation on Nitrogen Uptake of Silage Corn and Residual Soil Nitrate

Directory of Open Access Journals (Sweden)

M. A. Khodshenas

2016-09-01

Full Text Available Introduction: Growing irrigation demand for corn production, along side with draws of ground water from stressed water sources, should be limited due to scarce resources and environmental protection aspects. Nitrogen fertilizer applied at rates higher than the optimum requirement for crop production may cause an increase in nitrate accumulation below the root zone and pose a risk of nitrate leaching. Improving nitrogen management for corn production has a close relation with soil water content. In this study, we investigated the effects of source and rate of nitrogen fertilizer and irrigation on silage corn production and nitrogen concentration, nitrogen uptake and residual soil nitrate in two depths. Materials and Methods: This experiment carried out as split spli- plot in a Randomized Complete Block design (RCBD with three replications, in Arak station (Agricultural research center of markazi province, 34.12 N, 49.7 E; 1715 m above mean sea level during three years. The soil on the site was classified as a Calcaric Regosols (loamy skeletal over fragmental, carbonatic, thermic, calcixerollic xerochrepts. Main plots were irrigation treatments based on 70, 100 and 130 mm cumulative evaporation from A class Pan. Sub plots were two kinds of nitrogen fertilizers (Urea and Ammonium nitrate and sub sub-plots were five levels of nitrogen rates (0, 100, 200, 300 and 400 kgN.ha-1. Nitrogen fertilizer rates were split into three applications: 1/3 was applied at planting, 1/3 at 7-9 leaf stage and 1/3 remainder was applied before tasseling as a banding method. Phosphorus was applied at a rate of 150 kg.ha-1in each season and potassium at a rate of 30kg.ha-1 (only in first growth season based on soil testing as triple super phosphate and potassium sulfate, respectively. The corn variety of single cross 704 was planted at 20 m2 plots. The plants were sampled at dough stage from the two rows and weighted in each plot. Plant samples were dried in a forced air

Organic Based Glutinous Corn (Zea maize Supplemented With Seaweeds Emulsion

Directory of Open Access Journals (Sweden)

Jayrome S. Butay

2017-11-01

Full Text Available The study was therefore design to generate scientific information that are vital for organic farming advocates as it uses natural organic farm inputs in the production of corn. It was conducted because of the insurmountable rising cost of inorganic fertilizers perspective the farmers have to look for alternative measures to sustain the profitability of their farming business by evaluating the efficacy of seaweeds emulsion (Carrageenan as nutrient supplement to organic fertilizer on glutinous corn production, a study was conducted at the Cagayan State University – Lal-lo, Cagayan from July 17 to September 25, 2016with the following treatments: T1- Control, T2 – 3 tons Organic Fertilizer, T3 - 1.5 liters Seaweeds Emulsion ha-1 , T4 - 3 liters Seaweeds Emulsion ha-1 , T5 - 4.5 liters Seaweeds Emulsion ha-1 and T6 - 6 liters Seaweeds Emulsion ha-1 arranged in Randomized Complete Block Design with three replications. The treatments have no significant effect on plant height. Application of seaweed emulsion affected the grain development as manifested by longer and heavier corn ear. Higher rates (3-6 li ha-1 proved to more efficient as indicated by the bigger ear, highest yield and ROI of 909.62 percent. The study revealed that 3 tons Organic Fertilizer with liters of seaweed emulsion improved glutinous corn production. Further study is recommended to validate the result and come up with a more reliable conclusion.

quixotic coupling between irrigation system and maize-cowpea

African Journals Online (AJOL)

ACSS

number row-1 and maize grain yield, respectively. The ridge ... Key Words: Furrow irrigation, water use efficiency, Zea mays. RÉSUMÉ ... important in arid and semi-arid regions, with ... as maize) canopy is not able to intercept all the solar radiation during the growth period. ... Intercropping maize and legumes considerably ...

Nonomuraea zeae sp. nov., isolated from the rhizosphere of corn (Zea mays L.).

Science.gov (United States)

Shen, Yue; Jia, Feiyu; Liu, Chongxi; Li, Jiansong; Guo, Siyu; Zhou, Shuyu; Wang, Xiangjing; Xiang, Wensheng

2016-06-01

A novel actinobacterium, designated strain NEAU-ND5T, was isolated from the rhizosphere of corn (Zea mays L.) collected in Heilongjiang Province, north-east China, and characterized using a polyphasic approach. 16S rRNA gene sequence analysis showed that strain NEAU-ND5T was a member of the genus Nonomuraea, with highest sequence similarities to Nonomuraea jabiensis A4036T (98.29 %), Nonomuraea rosea GW12687T (98.25 %), Nonomuraea candida HMC10T (98.22 %), Nonomuraea rhizophila YIM 67092T (98.04 %) and Nonomuraea kuesteri NRRL B-24325T (98.04 %). Similarities to other type strains of the genus Nonomuraea were lower than 98 %. Morphological and chemotaxonomic properties of strain NEAU-ND5T were also consistent with the description of the genus Nonomuraea. The cell wall contained meso-diaminopimelic acid and the whole-cell sugars were glucose, ribose and madurose. The phospholipid profile consisted of diphosphatidylglycerol, phosphatidylmonomethylethanolamine, phosphatidylethanolamine, hydroxy-phosphatidylmonomethylethanolamine, hydroxy-phosphatidylethanolamine, phosphatidylinositol and phosphatidylinositol mannoside. The major menaquinones were MK-9(H4), MK-9(H2) and MK-9(H0). The predominant cellular fatty acids were iso-C16:0 and 10-methyl C17:0. A combination of DNA-DNA hybridization results and some phenotypic characteristics demonstrated that strain NEAU-ND5T was clearly distinguished from its closely related Nonomuraea species. Consequently, it is concluded that strain NEAU-ND5T represents a novel species of the genus Nonomuraea, for which the name Nonomuraea zeae sp. nov. is proposed. The type strain is NEAU-ND5T (=CGMCC 4.7280T=DSM 100528T).

Tillage and Water Deficit Stress Effects on Corn (Zea mays, L.) Root Distribution

Science.gov (United States)

One goal of soil management is to provide optimum conditions for root growth. Corn root distributions were measured in 2004 from a crop rotation – tillage experiment that was started in 2000. Corn was grown either following corn or following sunflower with either no till or deep chisel tillage. Wate...

Dielectric properties of Zea mays kernels - studies for microwave power processing applications

Energy Technology Data Exchange (ETDEWEB)

Surducan, Emanoil; Neamtu, Camelia; Surducan, Vasile, E-mail: emanoil.surducan@itim-cj.r [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)

2009-08-01

Microwaves absorption in biological samples can be predicted by their specific dielectrical properties. In this paper, the dielectric properties ({epsilon}' and {epsilon}'') of corn (Zea mays) kernels in the 500 MHz - 20 GHz frequencies range are presented. A short analysis of the microwaves absorption process is also presented, in correlation with the specific thermal properties of the samples, measured by simultaneous TGA-DSC method.

Efecto vasodilatador mediado por óxido nítrico del extracto hidroalcohólico de Zea mays L. (maíz morado en anillos aórticos de rata Vasodilator effect mediated by nitric oxide of the Zea mays L (andean purple corn hydroalcoholic extract in aortic rings of rat

Directory of Open Access Journals (Sweden)

Oscar Moreno-Loaiza

2010-12-01

Full Text Available Objetivo. Evaluar la respuesta vasodilatadora e inhibidora de la vasoconstricción del extracto hidroalcohólico de Zea mays L. (maíz morado y determinar si esta respuesta es mediada por óxido nítrico (NO. Materiales y métodos. Se obtuvo un extracto de las corontas de maíz morado maceradas durante ocho días en etanol al 70%, y posterior concentración del producto. Se trabajó con anillos aórticos de rata en cámara de órganos aislados, bañada con solución Krebs-Hensleit (K-H y se registró la actividad vasomotora con un transductor de tensión isométrica. Se produjo una contracción basal con KCl 120 mM sobre la cual determinó el efecto vasodilatador de tres dosis del extracto: 0,1; 0,5 y 1,0 mg/mL. Se utilizó L-NG-Nitroarginina metil ester (L-NAME para comprobar que la vasodilatación depende de la óxido nítrico sinteasa (NOs. Luego se comparó la inhibición de la contracción vascular tras la incubación durante 30 minutos, con extracto de maíz morado y captopril 10-5 M. Resultados. Se observó una reducción de la contracción máxima (100% a 85,25 ± 2,60%, 77,76 ± 3,23% y 73,3 ± 4,87%, para las dosis de 0,1; 0,5 y 1,0 mg/mL, respectivamente. La vasodilatación fue inhibida por la incubación previa con L-NAME. El extracto de maíz morado no inhibió la contracción vascular, a diferencia del captopril (reducción a 75,27 ± 8,61%. Conclusión. El extracto hidroalcohólico de Zea mays L produce vasodilatación dependiente de la síntesis de NO.Objective: To evaluate the vasodilator response of the hydroalcoholic extract of Zea mays L. (Andean purple corn and to determine if this response is mediated by nitric oxide (NO. Material and methods: We obtained an extract by maceration for eight days of Andean purple corn cobs in 70% ethanol and subsequent concentration of the product. Thoracic aortic rings were evaluated in an isolated organ chamber, bathed with Krebs-Hensleit solution (KH, and vasomotor activity was recorded

Micromonospora zeae sp. nov., a novel endophytic actinomycete isolated from corn root (Zea mays L.).

Science.gov (United States)

Shen, Yue; Zhang, Yuejing; Liu, Chongxi; Wang, Xiangjing; Zhao, Junwei; Jia, Feiyu; Yang, Lingyu; Yang, Deguang; Xiang, Wensheng

2014-11-01

A novel actinomycete, designated strain NEAU-gq9(T), was isolated from corn root (Zea mays L.) and characterized using a polyphasic approach. The organism was found to have morphological and chemotaxonomic characteristics typical of the genus Micromonospora. On the basis of 16S rRNA gene sequence similarity studies, strain NEAU-gq9(T) was most closely related to Micromonospora zamorensis CR38(T) (99.3%), Micromonospora jinlongensis NEAU-GRX11(T) (99.2%), Micromonospora saelicesensis Lupac 09(T) (99.2%), Micromonospora chokoriensis 2-19(6)(T) (98.9%), Micromonospora coxensis 2-30-b(28)(T) (98.6%) and Micromonospora lupini Lupac 14N(T) (98.5%). Phylogenetic analysis based on the 16S rRNA gene and gyrB gene demonstrated that strain NEAU-gq9(T) is a member of the genus Micromonospora and supported the closest phylogenetic relationship to M. zamorensis CR38(T), M. jinlongensis NEAU-GRX11(T), M. saelicesensis Lupac 09(T), M. chokoriensis 2-19(6)(T) and M. lupini Lupac 14N(T). A combination of DNA-DNA hybridization, morphological and physiological characteristics indicated that the novel strain could be readily distinguished from the closest phylogenetic relatives. Therefore, it is proposed that strain NEAU-gq9(T) represents a novel species of the genus Micromonospora, for which the name Micromonospora zeae sp. nov. is proposed. The type strain is NEAU-gq9(T) (=CGMCC 4.7092(T)=DSM 45882(T)).

Uptake, translocation and physiological effects of magnetic iron oxide (γ-Fe2O3) nanoparticles in corn (Zea mays L.).

Science.gov (United States)

Li, Junli; Hu, Jing; Ma, Chuanxin; Wang, Yunqiang; Wu, Chan; Huang, Jin; Xing, Baoshan

2016-09-01

Iron oxide nanoparticles (γ-Fe2O3 NPs) have emerged as an innovative and promising method of iron application in agricultural systems. However, the possible toxicity of γ-Fe2O3 NPs and its uptake and translocation require further study prior to large-scale field application. In this study, we investigated uptake and distribution of γ-Fe2O3 NPs in corn (Zea mays L.) and its impacts on seed germination, antioxidant enzyme activity, malondialdehyde (MDA) content, and chlorophyll content were determined. 20 mg/L of γ-Fe2O3 NPs significantly promoted root elongation by 11.5%, and increased germination index and vigor index by 27.2% and 39.6%, respectively. However, 50 and 100 mg/L γ-Fe2O3 NPs remarkably decreased root length by 13.5% and 12.5%, respectively. Additionally, evidence for γ-Fe2O3 NPs induced oxidative stress was exclusively found in the root. Exposures of different concentrations of NPs induced notably high levels of MDA in corn roots, and the MDA levels of corn roots treated by γ-Fe2O3 NPs (20-100 mg/L) were 5-7-fold higher than that observed in the control plants. Meanwhile, the chlorophyll contents were decreased by 11.6%, 39.9% and 19.6%, respectively, upon NPs treatment relative to the control group. Images from fluorescence and transmission electron microscopy (TEM) indicated that γ-Fe2O3 NPs could enter plant roots and migrate apoplastically from the epidermis to the endodermis and accumulate the vacuole. Furthermore, we found that NPs mostly existed around the epidermis of root and no translocation of NPs from roots to shoots was observed. Our results will be highly meaningful on understanding the fate and physiological effects of γ-Fe2O3 NPs in plants. Copyright © 2016 Elsevier Ltd. All rights reserved.

TOXICITY OF METHYL-TERT BYTYL ETHER (MTBE) TO PLANTS (AVENA SATIVA, ZEA MAYS, TRITICUM AESTIVUM, AND LACTUCA SATIVA)

Science.gov (United States)

Effects of Methyl tert-butyl ether (MTBE) on the germination of seeds and growth of the plant were studied in some laboratory experiments. Test plants were wild oat (Avena sative), sweet corn (Zea mays), wheat (Triticum aestivum), and lettuce (Lactuca sativa). Seed germination,...

Increasing Maize Tolerance to Drought and Flood with Seed Coating Treatments

OpenAIRE

Bennett, Jacob E; Sanghi, Achint; Kingsly Ambrose, R. P.

2016-01-01

The lack of irrigation in regions prone to drought, and flooding due to high rainfall or lack of drainage affects seed viability and the subsequent germination and crop establishment. Seed treatment in the form of coatings shows promise as an effective method to preserve the viability of corn (Zea mays) seeds in drought and flood conditions. Chemical formulations may help improve the seed corn vigor under these stressed conditions. This study examined the efficacy of β-aminobutyric acid [BABA...

Effects of residues from municipal solid waste landfill on corn yield and heavy metal content

International Nuclear Information System (INIS)

Prabpai, S.; Charerntanyarak, L.; Siri, B.; Moore, M.R.; Noller, Barry N.

2009-01-01

The effects of residues from municipal solid waste landfill, Khon Kaen Municipality, Thailand, on corn (Zea mays L.) yield and heavy metal content were studied. Field experiments with randomized complete block design with five treatments (0, 20, 40, 60 and 80% v/v of residues and soil) and four replications were carried out. Corn yield and heavy metal contents in corn grain were analyzed. Corn yield increased by 50, 72, 85 and 71% at 20, 40, 60 and 80% treatments as compared to the control, respectively. All heavy metals content, except cadmium, nickel and zinc, in corn grain were not significantly different from the control. Arsenic, cadmium and zinc in corn grain were strongly positively correlated with concentrations in soil. The heavy metal content in corn grain was within regulated limits for human consumption.

Evapotranspiration of a corn crop (Zea mays, L.)

International Nuclear Information System (INIS)

Calcache, M.; Engel, G.

1984-01-01

The real and potential evapotranspiration of corn crop is calculated in a field experiment. The potential evapotranspiration (PET) is estimated using the Penman Method with a Type 'A' evaporation tank. The real evapotranspiration (RET) is measured using the Mass Balance Method based on periodic calculations of the volumetric moisture of the soil using a neutron probe and the matrix potential using tensiometers. (M.A.C.) [pt

Is Corn Stover Harvest Predictable Using Farm Operation, Technology, and Management Variables?

Science.gov (United States)

Crop residue management, provision of animal feed or bedding, and increased income potential are some reasons for harvesting corn (Zea mays L.) stover. Reasons for not doing so are that crop residue is essential for restoring soil organic matter, protecting against wind and water erosion, and cyclin...

Analysis of Traits Related to Weed Competitiveness in Sweet Corn (Zea mays L.

Directory of Open Access Journals (Sweden)

Natalia de Leon

2012-03-01

Full Text Available Weed management in sweet corn can be costly; genetic improvements in sweet corn competitiveness may reduce this expense. Competitive ability can exist as weed suppressive ability (WSA, or crop tolerance (CT. Previous studies in corn have found year of hybrid release, maturity, plant height, leaf angle and leafiness may affect WSA, while hybrid era, maturity, and plant height may affect CT. However, many of these studies were limited to very few genotypes. The objective of this study was to assess the effects of phenomorphological traits on sweet corn competitiveness and the inheritance of these traits. An incomplete half-diallel from seven historic sweet corn inbred lines of varying morphologies was evaluated in a split-block randomized complete block design in three environments. Forage sorghum was interplanted in half of the blocks to act as a model weed. Significant differences among hybrids were generally found for both phenomorphological traits and traits measuring WSA and CT, such as sorghum biomass and yield stability, respectively. Crop plant height was most predictive of WSA and CT. In this set of genotypes, competitive ability may be passed with reasonable fidelity from parent to offspring, suggesting that sweet corn could be bred for competitive ability.

Restriction fragment length polymorphism markers associated with silk maysin, antibiosis to corn earworm (Lepidoptera: Noctuidae) larvae, in a dent and sweet corn cross.

Science.gov (United States)

Guo, B Z; Zhang, Z J; Li, R G; Widstrom, N W; Snook, M E; Lynch, R E; Plaisted, D

2001-04-01

Maysin, a C-glycosylflavone in maize silk, has insecticidal activity against corn earworm, Helicoverpa zea (Boddie), larvae. Sweet corn, Zea mays L., is a vulnerable crop to ear-feeding insects and requires pesticide protection from ear damage. This study was conducted to identify maize chromosome regions associated with silk maysin concentration and eventually to transfer and develop high silk maysin sweet corn lines with marker-assisted selection (MAS). Using an F2 population derived from SC102 (high maysin dent corn) and B31857 (low maysin sh2 sweet corn), we detected two major quantitative trait loci (QTL). It was estimated that 25.6% of the silk maysin variance was associated with segregation in the genomic region of npi286 (flanking to p1) on chromosome 1S. We also demonstrated that a1 on chromosome 3L had major contribution to silk maysin (accounted for 15.7% of the variance). Locus a1 has a recessive gene action for high maysin with the presence of functional p1 allele. Markers umc66a (near c2) and umc105a on chromosome 9S also were detected in this analysis with minor contribution. A multiple-locus model, which included npi286, a1, csu3 (Bin 1.05), umc245 (Bin 7.05), agrr21 (Bin 8.09), umc105a, and the epistatic interactions npi286 x a1, a1 x agrr21, csu3 x umc245, and umc105a x umc245, accounted for 76.3% of the total silk maysin variance. Tester crosses showed that at the a1 locus, SC102 has functional A1 alleles and B31857 has homozygous recessive a1 alleles. Individuals of (SC102 x B31857) x B31857 were examined with MAS and plants with p1 allele from SC102 and homozygous a1 alleles from B31857 had consistent high silk maysin. Marker-assisted selection seems to be a suitable method to transfer silk maysin to sweet corn lines to reduce pesticide application.

[Yeast irrigation enhances the nutritional content in hydroponic green maize fodder].

Science.gov (United States)

Bedolla-Torres, Martha H; Palacios Espinosa, Alejandro; Palacios, Oskar A; Choix, Francisco J; Ascencio Valle, Felipe de Jesús; López Aguilar, David R; Espinoza Villavicencio, José Luis; de Luna de la Peña, Rafael; Guillen Trujillo, Ariel; Avila Serrano, Narciso Y; Ortega Pérez, Ricardo

2015-01-01

The objective of this study was to evaluate the effect of irrigation with yeasts (Debaryomyces hansenii var. Fabry, Yarowia lipolytica YIBCS002, Yarowia lipolytica var. BCS and Candida pseudointermedia) on the final nutritional content of hydroponic green maize fodder (Zea Zea mays L.), applied at different fodder growth stages (1. seed-seedling stage, 2. seedling-plant 20cm, 3. during all the culture). Irrespective of the fodder growth stages at which they were applied, all yeasts tested enhanced the content of raw protein, lipids, ash, moisture and energy. The percentage of electrolytes (Na, K, Cl, sulphates, Ca and Mg) showed different responses depending on the kind of yeast applied; D. hansenii exhibited the highest increment in all electrolytes, except for phosphorous. We conclude that the addition of yeasts belonging to the genera Debaryomyces, Candida and Yarowia to the irrigation solution of hydroponic systems enhances the nutrient content of green fodder. This kind of irrigation can be applied to generate high commercial value cultures in limited spaces. Copyright © 2014 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

Integrating Water Supply Constraints into Irrigated Agricultural Simulations of California

Science.gov (United States)

Winter, Jonathan M.; Young, Charles A.; Mehta, Vishal K.; Ruane, Alex C.; Azarderakhsh, Marzieh; Davitt, Aaron; McDonald, Kyle; Haden, Van R.; Rosenzweig, Cynthia E.

2017-01-01

Simulations of irrigated croplands generally lack key interactions between water demand from plants and water supply from irrigation systems. We coupled the Water Evaluation and Planning system (WEAP) and Decision Support System for Agrotechnology Transfer (DSSAT) to link regional water supplies and management with field-level water demand and crop growth. WEAP-DSSAT was deployed and evaluated over Yolo County in California for corn, rice, and wheat. WEAP-DSSAT is able to reproduce the results of DSSAT under well-watered conditions and reasonably simulate observed mean yields, but has difficulty capturing yield interannual variability. Constraining irrigation supply to surface water alone reduces yields for all three crops during the 1987-1992 drought. Corn yields are reduced proportionally with water allocation, rice yield reductions are more binary based on sufficient water for flooding, and wheat yields are least sensitive to irrigation constraints as winter wheat is grown during the wet season.

Apex simulation: environmental benefits of agroforestry and grass buffers for corn-soybean watersheds

Science.gov (United States)

The Agricultural Policy Environmental Extender (APEX) model is used to simulate the effects of vegetative filter strips on runoff and pollutant loadings from agricultural watersheds. A long-term paired watershed study under corn (Zea mays L-soybean [Glycine max (L.) Merr.] rotation with agroforestr...

Relationships between soil-based management zones and canopy sensing for corn nitrogen management

Science.gov (United States)

Integrating soil-based management zones (MZ) with crop-based active canopy sensors to direct spatially variable nitrogen (N) applications has been proposed for improving N fertilizer management of corn (Zea mays L.). Analyses are needed to evaluate relationships between canopy sensing and soil-based...

Artificial intelligence analysis of hyperspectral remote sensing data for management of water, weed, and nitrogen stresses in corn fields

Science.gov (United States)

Waheed, Tahir

This study investigated the possibility of using ground-based remotely sensed hyperspectral observations with a special emphasis on detection of water, weed and nitrogen stresses contributing towards in-season decision support for precision crop management (PCM). A three factor split-split-plot experiment, with four randomized blocks as replicates, was established during the growing seasons of 2003 and 2004. Corn (Zea mays L.) hybrid DKC42-22 was grown because this hybrid is a good performer on light soils in Quebec. There were twelve 12 x 12m plots in a block (one replication per treatment per block) and the total number of plots was 48. Water stress was the main factor in the experiment. A drip irrigation system was laid out and each block was split into irrigated and non-irrigated halves. The second main factor of the experiment was weeds with two levels i.e. full weed control and no weed control. Weed treatments were assigned randomly by further splitting the irrigated and non-irrigated sub-blocks into two halves. Each of the weed treatments was furthermore split into three equal sub-sub-plots for nitrogen treatments (third factor of the experiment). Nitrogen was applied at three levels i.e. 50, 150 and 250 kg N ha-1 (Quebec norm is between 120-160 kg N ha-1). The hyperspectral data were recorded (spectral resolution = 1 nm) mid-day (between 1000 and 1400 hours) with a FieldSpec FR spectroradiometer over a spectral range of 400-2500 run at three growth stages namely: early growth, tasseling and full maturity, in each of the growing season. There are two major original contributions in this thesis: First is the development of a hyperspectral data analysis procedure for separating visible (400-700 nm), near-infrared (700-1300 nm) and mid-infrared (1300-2500 nm) regions of the spectrum for use in discriminant analysis procedure. In addition, of all the spectral band-widths analyzed, seven waveband-aggregates were identified using STEPDISC procedure, which were the

Effect of hydrolysis enzymatic process of corn using protease crude (Rhizopus oligosporus-C1) to produce corn hydrolisate rich folic acid

Science.gov (United States)

Maryati, Yati; Susilowati, Agustine; Melanie, Hakiki; Lotulung, Puspa D.

2017-11-01

Corn hydrolyzate (Zea mays L) as a functional food fortificant derived from natural folic acid has been evaluated through a hydrolysis process using protease enzyme Rhizopus oligosporus strain C1. Enzymatic hydrolysis was carried out on two types of corn; yellow and white pearl variety corn, at concentration of protease enzyme (rough) 0.025; 0.125; and 0.225% (v/w of soluble nixtamal corn protein) with a hydrolysis time of 24 h at 30 °C, and pH 5.0. The results showed that the concentration of protease enzymes can increase the folic acid to the optimum condition, from the beginning to the end of the process time. Folic acid optimization of hydrolysis results in each corn was at the concentration of protease enzyme 0.225% (v/w of soluble nixtamal corn protein) in white corn and yellow corn at 24 hours hydrolysis, with folic acid composition, 283.56 µg/mL and 412.52 µg/mL, 1.07 and 1.04 mg/mL of soluble proteins, proteolytic activity 2.09 and 2.06 U/mL, total solids of 21.74 and 17.85%, total sugars of 0.56 and 2.22 mg/mL, and reducing sugar 91.72 and 48.47 mg/mL. In this condition, the increase of optimum folic acid for white corn was 33.57% and for yellow corn was 71.60% after hydrolysis.

Corn nitrogen management influences nitrous oxide emissions in drained and undrained soils

Science.gov (United States)

Tile-drainage and nitrogen (N) fertilization are important for corn (Zea mays L.) production. To date, no studies have evaluated nitrous oxide (N2O) emissions of single vs. split-N fertilizer application under different soil drainage conditions. The objective of this study was to quantify season-lon...

VIGOR DE SEMENTES DE MILHO (Zea mays L. AVALIADO PELA PRECOCIDADE DE EMISSÃO DA RAIZ PRIMÁRIA EVALUATION OF CORN (Zea mays L. SEED VIGOR THROUGH THE PRECOCITY OF PRIMARY ROOT EMISSION

Directory of Open Access Journals (Sweden)

Francisco Ferraz de Toledo

1999-01-01

Full Text Available Foi desenvolvido trabalho baseado na determinação da precocidade da emissão da raiz primária de sementes de milho, em dez lotes de um mesmo cultivar. Este processo constou da distribuição de 200 sementes de cada lote sobre folhas de papel umedecido e, também, rolos de papel, que permaneceram em germinador a 25 °C; de 12 em 12 horas, aquelas que apresentaram emissão da raiz primária foram removidas, contadas e anotadas. Para estabelecer comparação entre os métodos e os lotes, paralelamente, as sementes eram avaliadas através da determinação do grau de umidade, dos testes de germinação e de vigor (primeira contagem, teste de frio com solo e emergência de plântulas em campo. Concluiu-se que há possibilidade de se utilizar o teste de emissão da raiz primária, em rolos de papel, para a avaliação do vigor de sementes de milho.The objectives of this study were to evaluate the variability of the emission of seed radicle of corn (Zea mays L. and to establish indexes of primary root emission to test the vigor of commercial seed lots. Samples of corn seeds not treated with fungicides, were taken from ten lots of the same cultivar. Two hundred seeds from each lot were distributed on wetted paper towels and also within paper rolles at 25 °C. Each 12 hours, seeds with primary root emission were counted and removed. Indexes of primary root emission were calculated and compared to conventional laboratory tests (first count; accelerated aging; cold test and field emergence. It was concluded that the primary root emission test, in rolled paper towels can be of great value for evaluating the vigor of corn seeds.

Efficacy of pyramided Bt proteins Cry1F, Cry1A.105, and cry2Ab2 expressed in Smartstax corn hybrids against lepidopteran insect pests in the northern United States.

NARCIS (Netherlands)

Rule, D.M.; Nolting, S.P.; Prasfika, P.L.; Storer, N.P.; Hopkins, B.W.; Scherder, E.J.A.; Siebert, M.W.; Hendrix, W.H.

2014-01-01

Commercial field corn (Zea mays L.) hybrids transformed to express some or all of the lepidopteran insect-resistant traits present in SmartStax corn hybrids were evaluated for insecticidal efficacy against a wide range of lepidopteran corn pests common to the northern United States, during 2008 to

Conservação pós-colheita de espigas de milho verde minimamente processado sob diferentes temperaturas Post-harvest conservation of fresh-cut corn on the cob (Zea maiz L. under different temperatures

Directory of Open Access Journals (Sweden)

Alexandra Mara Goulart Nunes Mamede

2009-02-01

Full Text Available Objetivou-se, neste trabalho, avaliar o efeito de três temperaturas (5ºC, 8ºC e 11ºC, na qualidade de híbridos de milho verde (Zea maiz L. com endosperma normal, minimamente processado, durante oito dias de armazenamento, com avaliações a cada dois dias. Foram utilizadas espigas de dois híbridos, sendo um comercial da Sementes Agroceres (Ag 1051 e outro do programa de melhoramento da Embrapa Milho e Sorgo (Embrapa HT1. A temperatura de 5ºC foi a que melhor preservou a qualidade das espigas dos híbridos de milho verde estudados, por proporcionar perda de massa reduzida e manutenção dos teores de sólidos solúveis, frutose e glicose. O híbrido Ag 1051 apresentou menor perda de massa, maiores valores de umidade e maior teor de frutose. O Embrapa HT1 apresentou maiores valores iniciais e finais para os teores de sólidos solúveis e maior valor para a coloração b*. O valor L*, que indica quãoclaro e escuro é produto, também diminuiu ao longo do armazenamento, indicando escurecimento das espigas ao longo do armazenamento.This work had the aim of evaluating the effect of three temperatures (5ºC, 8ºC and 11ºC on the quality of fresh-cut corn on the cob (Zea maiz L. with normal endosperm, for 8 days, with analyses taken every two days. Corn on the cob of two hybrids was used, a commercial common type from Sementes Agroceres (Ag 1051 and the other from the breeding program Embrapa Milho e Sorgo (Embrapa HT1. The temperature of 5ºC was more efficient to preserve the quality of normal corn by promoting reduced mass loss and higher contents of soluble solids, fructose and glucose. The hybrid Ag 1051 presented lower mass loss, higher contents of moisture and higher content of fructose. The hybrid Embrapa HT1 presented higher initial and final values for soluble solids and higher b* value. The L* value also decreased along storage, indicating browning of the corns along the storage.

Composition of forage and grain from second-generation insect-protected corn MON 89034 is equivalent to that of conventional corn (Zea mays L.).

Science.gov (United States)

Drury, Suzanne M; Reynolds, Tracey L; Ridley, William P; Bogdanova, Natalia; Riordan, Susan; Nemeth, Margaret A; Sorbet, Roy; Trujillo, William A; Breeze, Matthew L

2008-06-25

Insect-protected corn hybrids containing Cry insecticidal proteins derived from Bacillus thuringiensis have protection from target pests and provide effective management of insect resistance. MON 89034 hybrids have been developed that produce both the Cry1A.105 and Cry2Ab2 proteins, which provide two independent modes of insecticidal action against the European corn borer ( Ostrinia nubilalis ) and other lepidopteran insect pests of corn. The composition of MON 89034 corn was compared to conventional corn by measuring proximates, fiber, and minerals in forage and by measuring proximates, fiber, amino acids, fatty acids, vitamins, minerals, antinutrients, and secondary metabolites in grain collected from 10 replicated field sites across the United States and Argentina during the 2004-2005 growing seasons. Analyses established that the forage and grain from MON 89034 are compositionally comparable to the control corn hybrid and conventional corn reference hybrids. These findings support the conclusion that MON 89034 is compositionally equivalent to conventional corn hybrids.

Overview of a public-industry partnership for enhancing corn nitrogen research and datasets

Science.gov (United States)

Due to economic and environmental consequences of nitrogen (N) lost from fertilizer applications in corn (Zea mays L.), considerable public and industry attention has been devoted to development of N decision tools. Now a wide variety of tools are available to farmers for managing N inputs. However,...

Is a Nitrogen-rich Reference Needed for Canopy Sensor-based Corn Nitrogen Applications?

Science.gov (United States)

The nitrogen (N) supplying capacity of the soil available to support corn (Zea mays L.) production can be highly variable both among and within fields. In recent years, canopy reflectance sensing has been investigated for in-season assessment of crop N health and fertilization. Typically, the proced...

Bayesian Belief Networks Approach for Modeling Irrigation Behavior

Science.gov (United States)

Andriyas, S.; McKee, M.

2012-12-01

Canal operators need information to manage water deliveries to irrigators. Short-term irrigation demand forecasts can potentially valuable information for a canal operator who must manage an on-demand system. Such forecasts could be generated by using information about the decision-making processes of irrigators. Bayesian models of irrigation behavior can provide insight into the likely criteria which farmers use to make irrigation decisions. This paper develops a Bayesian belief network (BBN) to learn irrigation decision-making behavior of farmers and utilizes the resulting model to make forecasts of future irrigation decisions based on factor interaction and posterior probabilities. Models for studying irrigation behavior have been rarely explored in the past. The model discussed here was built from a combination of data about biotic, climatic, and edaphic conditions under which observed irrigation decisions were made. The paper includes a case study using data collected from the Canal B region of the Sevier River, near Delta, Utah. Alfalfa, barley and corn are the main crops of the location. The model has been tested with a portion of the data to affirm the model predictive capabilities. Irrigation rules were deduced in the process of learning and verified in the testing phase. It was found that most of the farmers used consistent rules throughout all years and across different types of crops. Soil moisture stress, which indicates the level of water available to the plant in the soil profile, was found to be one of the most significant likely driving forces for irrigation. Irrigations appeared to be triggered by a farmer's perception of soil stress, or by a perception of combined factors such as information about a neighbor irrigating or an apparent preference to irrigate on a weekend. Soil stress resulted in irrigation probabilities of 94.4% for alfalfa. With additional factors like weekend and irrigating when a neighbor irrigates, alfalfa irrigation

Evaluation of the soil health nutrient tool for corn nitrogen recommendations across the Midwest

Science.gov (United States)

Use and development of soil biological tests for estimating soil N availability and subsequently corn (Zea mays L.) fertilizer N recommendations is garnering considerable interest. The objective of this research was to evaluate relationships between the Soil Health Nutrient Tool (SHNT), also known a...

Prohexadione-calcium rate and timing effects on alfalfa interseeded into silage corn

Science.gov (United States)

Prohexadione-Ca (PHD) can enhance establishment of alfalfa (Medicago sativa, L.) interseeded into silage corn (Zea mays, L.), but optimal application rates and timing for this growth regulator are unknown. Two experiments examined how single or split applications of 0.25 to 1.0 kg a.i. ha-1 of PHD o...

Visual soil structure effects of tillage and corn stover harvest in Iowa, U.S.A.

Science.gov (United States)

Excessive harvest of corn (Zea mays L.) stover for ethanol production has raised concerns regarding negative consequences on soil structure and physical quality. Visual soil structure assessment methods have the potential to help address these concerns through simple, straightforward on-farm evaluat...

Uptake, distribution, and velocity of organically complexed plutonium in corn (Zea mays).

Science.gov (United States)

Thompson, Shannon W; Molz, Fred J; Fjeld, Robert A; Kaplan, Daniel I

2012-10-01

Lysimeter experiments and associated simulations suggested that Pu moved into and through plants that invaded field lysimeters during an 11-year study at the Savannah River Site. However, probable plant uptake and transport mechanisms were not well defined, so more detailed study is needed. Therefore, experiments were performed to examine movement, distribution, and velocity of soluble, complexed Pu in corn. Corn was grown and exposed to Pu using a "long root" system in which the primary root extended through a soil pot and into a hydroponic container. To maintain solubility, Pu was complexed with the bacterial siderophore DFOB (Desferrioxamine B) or the chelating agent DTPA (diethylenetriaminepentaacetic acid). Corn plants were exposed to nutrient solutions containing Pu for periods of 10 min to 10 d. Analysis of root and shoot tissues permitted concentration measurement and calculation of uptake velocity and Pu retardation in corn. Results showed that depending on exposure time, 98.3-95.9% of Pu entering the plant was retained in the roots external to the xylem, and that 1.7-4.1% of Pu entered the shoots (shoot fraction increased with exposure time). Corn Pu uptake was 2-4 times greater as Pu(DFOB) than as Pu(2)(DTPA)(3). Pu(DFOB) solution entered the root xylem and moved 1.74 m h(-1) or greater upward, which is more than a million times faster than Pu(III/IV) downward movement through soil during the lysimeter study. The Pu(DFOB) xylem retardation factor was estimated to be 3.7-11, allowing for rapid upward Pu transport and potential environmental release. Copyright © 2012 Elsevier Ltd. All rights reserved.

Maize silk antibiotic polyphenol compounds and molecular genetic improvement of resistance to corn earworm (Helicoverpa zea Boddie) in sh2 sweet corn

OpenAIRE

Baozhu Guo; Ana Butrón; Brian T. Scully

2010-01-01

The flavor of sh2 super-sweet corn is preferred by consumers. Unfortunately, sh2 sweet corn has little genetic variation for insect resistance. In this paper we review the functions of two loci, p1 and a1. The P1 allele has a major role in sh2 sweet corn resistance to corn earworm, an allele that was lost in historical selection because of its pleiotropic effect on undesirable cob color and silk browning. The P1 allele has significant effects on biosyntheses of silk antibiotic compounds, mays...

Effect of Winter Cover Crops on Soil Nitrogen Availability, Corn Yield, and Nitrate Leaching

OpenAIRE

Kuo, S.; Huang, B.; Bembenek, R.

2001-01-01

Biculture of nonlegumes and legumes could serve as cover crops for increasing main crop yield, while reducing NO3 leaching. This study, conducted from 1994 to 1999, determined the effect of monocultured cereal rye (Secale cereale L.), annual ryegrass (Lolium multiflorum), and hairy vetch (Vicia villosa), and bicultured rye/vetch and ryegrass/vetch on N availability in soil, corn (Zea mays L.) yield, and NO3-N leaching in a silt loam soil. The field had been in corn and cover crop rotation sin...

INOCULATION OF DIAZOTROPHIC BACTERIA AND NITROGEN FERTILIZATION IN TOPDRESSING IN IRRIGATED CORN

Directory of Open Access Journals (Sweden)

VANESSA ZIRONDI LONGHINI

2016-01-01

Full Text Available Corn is a nitrogen-intensive crop, and the use of management practices such as inoculation of the seed with diazotrophic bacteria, which can maximize crop productivity and reduce the need of nitrogen fertilizers, may result in lower production costs. The present study aimed to evaluate the effect of inoculation of corn seed with Azospirillum brasilense and controlled addition of nitrogen to topdressing on the nutrition, production components, and productivity of crop grain. The experimental design was a randomized block design, with four replications in a 2 × 5 factorial scheme. The treatments consisted of inoculation or not of corn seed with A. brasilense (at 100 mL per 25 kg of seed and five nitrogen (N levels in topdressing (0, 30, 60, 90, and 120 kg N ha-1 from urea [45% N] were applied when the corn was in the phenological growth stage V6. Foliar macronutrients, foliar chlorophyll index (FCI, production components, and yield of corn grain were valuated. Inoculation of corn seeds with A. brasilense increased plant height and grain yield. Fertilization in topdressing, with N levels up to 120 kg ha-1, linearly increased the foliar nutrients and productivity of corn cultivated in the spring/summer in the low-altitude Cerrado region of Brazil.

The Effect of Rain-Fed and Supplementary Irrigation on the Yield ...

African Journals Online (AJOL)

The effect of rain-fed with rain-fed supplementary irrigation on yield and yield components of Maize (Zea mays L.) was carried out at Mekelle University main campus under Tigray region in Ethiopia. The experiment was laid out in a Randomized Complete Block Design (RCBD), and investigated in the early cropping season ...

[Effects of simulated acid rain on seed germination and seedling growth of different type corn Zea mays].

Science.gov (United States)

Zhang, Hai-Yan

2013-06-01

Taking normal corn, waxy corn, pop corn, and sweet corn as test materials, this paper studied their seed germination and seedling growth under effects of simulated acid rain (pH 6.0, 5.0, 4.0, 3.0, 2.0, and 1.0). Simulated acid rain at pH 2.0-5.0 had no significant effects on the seed germination and seedling growth, but at pH 1.0, the germination rate of normal corn, waxy corn, pop corn, and sweet corn was 91.3%, 68.7%, 27.5%, and 11.7%, respectively. As compared with those at pH 6.0 (CK), the germination rate, germination index, vigor index, germination velocity, shoot height, root length, shoot and root dry mass, and the transformation rate of stored substances at pH 1.0 had significant decrease, and the average germination time extended apparently. At pH 1.0, the effects of acid rain were greater at seedling growth stage than at germination stage, and greater on underground part than on aboveground part. Due to the differences in gene type, normal corn and waxy corn had the strongest capability against acid rain, followed by pop corn, and sweet corn. It was suggested that corn could be categorized as an acid rain-tolerant crop, the injury threshold value of acid rain was likely between pH 1.0 and pH 2.0, and normal corn and waxy corn would be prioritized for planting in acid rain-stricken area.

Biology and natural enemies of Peregrinus maidis (Ashmead in corn (Zea mays L., in systems of polycrops

Directory of Open Access Journals (Sweden)

Marcos Tulio García González

2015-02-01

Full Text Available This research was done in Fomento municipality, Sancti Spíritus, in Cuba, from 2011 through 2013 in two ecosystems and in two sowing times (rainy and dry seasons. The objectives were to describe the life cycle of Peregrinus maidis (Ashmead and the damage caused to corn (Zea mays L., to identify the main pest bio-regulators naturally occurring in two agro-ecosystems, and to determine the predator-prey relationship. The experiment was arranged in a randomized block design. The data were collected through observation at weekly intervals. In order to estimate the number of pest insects and bio-regulators occurring on the plants, 25 plants per parcel were selected for a total of 100 plants per treatment (maize/squash, maize/beans, maize/ Sesame, maize/sunflower, and maize monoculture. Once the research was accomplished, it was concluded that P maidis had been present since the first week, and reached its population peak in week six. The lower indexes of affectation occurred in the pre-mountain agro-ecosystems, and with more frequency in the maize/sesame and maize/squash polyculture, which depended on the time of the year and the season. Fifteen species of P. maidis control insects of were identified, and Scymnus sp was found in all treatments. The life cycle of P maidis averaged 5.4 days more in the dry season than in rain season. The predator-prey relationship showed relatively superior indexes in the polyculture systems than in monocrops systems.

Larval Helicoverpa zea Transcriptional, Growth and Behavioral Responses to Nicotine and Nicotiana tabacum

Directory of Open Access Journals (Sweden)

Linus Gog

2014-09-01

Full Text Available The polyphagous feeding habits of the corn earworm, Helicoverpa zea (Boddie, underscore its status as a major agricultural pest with a wide geographic distribution and host plant repertoire. To study the transcriptomic response to toxins in diet, we conducted a microarray analysis of H. zea caterpillars feeding on artificial diet, diet laced with nicotine and Nicotiana tabacum (L. plants. We supplemented our analysis with growth and aversion bioassays. The transcriptome reflects an abundant expression of proteases, chitin, cytochrome P450 and immune-related genes, many of which are shared between the two experimental treatments. However, the tobacco treatment tended to elicit stronger transcriptional responses than nicotine-laced diet. The salivary factor glucose oxidase, known to suppress nicotine induction in the plant, was upregulated by H. zea in response to tobacco but not to nicotine-laced diet. Reduced caterpillar growth rates accompanied the broad regulation of genes associated with growth, such as juvenile hormone epoxide hydrolase. The differential expression of chemosensory proteins, such as odorant binding-protein-2 precursor, as well as the neurotransmitter nicotinic-acetylcholine-receptor subunit 9, highlights candidate genes regulating aversive behavior towards nicotine. We suggest that an observed coincidental rise in cannibalistic behavior and regulation of proteases and protease inhibitors in H. zea larvae signify a compensatory response to induced plant defenses.

DEVELOPMENT OF ACID-SOIL TOLERANT CORN (Zea mays L. WITH HIGH-QUALITY PROTEIN

Directory of Open Access Journals (Sweden)

E.S. Halimi

2011-06-01

Full Text Available Corn is an important food crop in Indonesia. Plant expansion has been hampered by soil-acidity problem and the protein content of many corn varieties was low. This research initiates development of soil-acid-tolerant corn with high-quality-protein content. Research was done on 12 factorial treatments and 3 replications as blocks in RCBD. The first factor was corn populations: Toray-1(G1, Toray-2(G2, GS-5(G3 and GS-10(G4. The second factor was fertilizations: P1(69 kg N+36 kg P2O5+15 kg K2O per ha; P2(115 kg N+54 kg P2O5+30 kg K2O per ha; and P3(161 kg N+72 kg P2O5+45 kg K2O per ha. The observed variables consisted of several agronomic traits, including the protein content. Results indicated that the corn populations, in general, showed good agronomic traits. The differences were mostly between populations, not between fertilizations, and no interaction was observed. The yield potential ranged from 4.25 to 6.47 ton dry seeds per ha. The protein content of seed resulted from cross ranged from 9.84% to 11.30%, as compared to the parents of 9.11% and 12.62%. This research concludes that genetic factors play an important role as confirmed by heritability estimate (h2=0.75.

An Active Sensor Algorithm for Corn Nitrogen Recommendations Based on a Chlorophyll Meter Algorithm

Science.gov (United States)

In previous work we found active canopy sensor reflectance assessments of corn (Zea mays L.) N status acquired at two growth stages (V11 and V15) have the greatest potential for directing in-season N applications, but emphasized an algorithm was needed to translate sensor readings into appropriate N...

Evaluation of the Haney Soil Health Nutrient Tool for corn nitrogen recommendations across eight Midwest states

Science.gov (United States)

Use and development of soil biological tests for estimating soil N availability and subsequently corn (Zea mays L.) fertilizer N recommendations is garnering considerable interest. The objective of this research was to evaluate relationships between the Soil Health Nutrient Tool (SHNT), also known a...

Monitoring Agricultural Drought Using Geographic Information Systems and Remote Sensing on the Primary Corn and Soybean Belt in the United States

Science.gov (United States)

Al-Shomrany, Adel

The study aims to evaluate various remote sensing drought indices to assess those most fitting for monitoring agricultural drought. The objectives are (1) to assess and study the impact of drought effect on (corn and soybean) crop production by crop mapping information and GIS technology; (2) to use Geographical Weighted Regression (GWR) as a technical approach to evaluate the spatial relationships between precipitation vs. irrigated and non-irrigated corn and soybean yield, using a Nebraska county-level case study; (3) to assess agricultural drought indices derived from remote sensing (NDVI, NMDI, NDWI, and NDII6); (4) to develop an optimal approach for agricultural drought detection based on remote sensing measurements to determine the relationship between US county-level yields versus relatively common variables collected. Extreme drought creates low corn and soybean production where irrigation systems are not implemented. This results in a lack of moisture in soil leading to dry land and stale crop yields. When precipitation and moisture is found across all states, corn and soybean production flourishes. For Kansas, Nebraska, and South Dakota, irrigation management methods assist in strong crop yields throughout SPI monthly averages. The data gathered on irrigation consisted of using drought indices gathered by the national agricultural statistics service website. For the SPI levels ranging between one-month and nine-months, Kansas and Nebraska performed the best out of all 12-states contained in the Midwestern primary Corn and Soybean Belt. The reasoning behind Kansas and Nebraska's results was due to a more efficient and sustainable irrigation system, where upon South Dakota lacked. South Dakota was leveled by strong correlations throughout all SPI periods for corn only. Kansas showed its strongest correlations for the two-month and three-month averages, for both corn and soybean. Precipitation regression with irrigated and non-irrigated maize (corn) and

Exploring of Agro Waste (Pineapple Leaf, Corn Stalk, and Napier Grass) by Chemical Composition and Morphological Study

OpenAIRE

Angzzas Sari Mohd Kassim; Halizah Awang; Ashuvila Mohd Aripin

2013-01-01

Malaysia is a country that is a rich source of agricultural waste material. Three different crops were studied here, including pineapple (Ananas comosus) leaf, corn (Zea mays) stalk, and Napier grass (Pennisetum purpureum). These crops are characterized as agricultural waste materials in Malaysia and have a high potential to be used as alternative fibers for the paper making industry. The objective of this work was to analyze the chemical composition of pineapple leaf, corn stalk, and Napier ...

Field performance of maize (Zea mays L. cultivars under drought stress

Directory of Open Access Journals (Sweden)

Kazem GHASSEMI-GOLEZANI

2018-04-01

Full Text Available This research was carried out in 2014 at the Research Farm of the University of Tabriz, Iran. The experiment was arranged as split plot on the basis of randomized complete block with three replicates to assess the effects of four irrigation intervals (irrigations after 60, 80, 100 and 120 mm evaporation on physiological and agronomical traits of three cultivars of maize (Zea mays L.; ‘SC704’, ‘NS640’, ‘DC303’: late, mid and early maturing, respectively. Irrigation intervals and maize cultivars were assigned to the main and sub-plots, respectively. Leaf temperature of all maize cultivars significantly increased, but chlorophyll content index, maximum efficiency of photosystem II, number of grains per plant, 1000 grain mass, plant biomass, grain yield and harvest index significantly decreased with increasing irrigation intervals. Late maturing cultivar (‘SC704’ was superior in all studied traits, followed by mid (‘NS640’ and early (‘DC303’ maturing cultivars. It was concluded that water limitation can potentially reduce performance of maize cultivars in the field, but the extent of this reduction depends on genotype and severity of stress.

Transgenic Bt Corn, Soil Insecticide, and Insecticidal Seed Treatment Effects on Corn Rootworm (Coleoptera: Chrysomelidae) Beetle Emergence, Larval Feeding Injury, and Corn Yield in North Dakota.

Science.gov (United States)

Calles-Torrez, Veronica; Knodel, Janet J; Boetel, Mark A; Doetkott, Curt D; Podliska, Kellie K; Ransom, Joel K; Beauzay, Patrick; French, B Wade; Fuller, Billy W

2018-02-09

Northern, Diabrotica barberi Smith & Lawrence (Coleoptera: Chrysomelidae), and western, Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae), corn rootworms are economic pests of corn, Zea mays L. in North America. We measured the impacts of corn hybrids incorporated with Cry3Bb1, Cry34/35Ab1, and pyramided (Cry3Bb1 + Cry34/35Ab1) Bacillus thuringiensis Berliner (Bt) proteins, tefluthrin soil insecticide, and clothianidin insecticidal seed treatment on beetle emergence, larval feeding injury, and corn yield at five locations from 2013 to 2015 in eastern North Dakota. In most cases, emergence was significantly lower in Bt-protected corn than in non-Bt corn hybrids. Exceptions included Wyndmere, ND (2013), where D. barberi emergence from Cry34/35Ab1 plots was not different from that in the non-Bt hybrid, and Arthur, ND (2013), where D. v. virgifera emergence from Cry3Bb1 plots did not differ from that in the non-Bt hybrid. Bt hybrids generally produced increased grain yield compared with non-Bt corn where rootworm densities were high, and larval root-feeding injury was consistently lower in Bt-protected plots than in non-Bt corn. The lowest overall feeding injury and emergence levels occurred in plots planted with the Cry3Bb1 + Cry34/35Ab1 hybrid. Time to 50% cumulative emergence of both species was 5-7 d later in Bt-protected than in non-Bt hybrids. Tefluthrin and clothianidin were mostly inconsequential in relation to beetle emergence and larval root injury. Our findings could suggest that some North Dakota populations could be in early stages of increased tolerance to some Bt toxins; however, Bt corn hybrids currently provide effective protection against rootworm injury in eastern North Dakota. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

A public-industry partnership for enhancing corn nitrogen research and datasets: project description, methodology, and outcomes

Science.gov (United States)

Due to economic and environmental consequences of nitrogen (N) lost from fertilizer applications in corn (Zea mays L.), considerable public and industry attention has been devoted to development of N decision tools. Now a wide variety of tools are available to farmers for managing N inputs. However,...

Modeling irrigation behavior in groundwater systems

Science.gov (United States)

Foster, Timothy; Brozović, Nicholas; Butler, Adrian P.

2014-08-01

Integrated hydro-economic models have been widely applied to water management problems in regions of intensive groundwater-fed irrigation. However, policy interpretations may be limited as most existing models do not explicitly consider two important aspects of observed irrigation decision making, namely the limits on instantaneous irrigation rates imposed by well yield and the intraseasonal structure of irrigation planning. We develop a new modeling approach for determining irrigation demand that is based on observed farmer behavior and captures the impacts on production and water use of both well yield and climate. Through a case study of irrigated corn production in the Texas High Plains region of the United States we predict optimal irrigation strategies under variable levels of groundwater supply, and assess the limits of existing models for predicting land and groundwater use decisions by farmers. Our results show that irrigation behavior exhibits complex nonlinear responses to changes in groundwater availability. Declining well yields induce large reductions in the optimal size of irrigated area and irrigation use as constraints on instantaneous application rates limit the ability to maintain sufficient soil moisture to avoid negative impacts on crop yield. We demonstrate that this important behavioral response to limited groundwater availability is not captured by existing modeling approaches, which therefore may be unreliable predictors of irrigation demand, agricultural profitability, and resilience to climate change and aquifer depletion.

Hubungan antara Zea mays L., Ostrinia furnacalis (Lep.:Pyralidae dan Beauveria bassiana Vuill.

Directory of Open Access Journals (Sweden)

Itji Diana Daud

2017-02-01

Full Text Available Connection between Zea mays L., Ostrinia furnacalis (Lep.:Pyralidae and  Beauveria bassiana Vuill. The entomopatogen fungus, Beauveria bassiana (Balsamo, is obtained in the tissue of corn plant through submersion of seed in cinidia 1010/ml. Tissue observation showed that hifa B. bassiana appears when the plant attain the age of three weeks and when it reaches six weeks B bassiana appears in all sample plants. Hifa obtained in parenchyma tissue passively without causing illness the mother plant. The appearance of B. bassiana is remained until the 12th weeks of plant. Bio test of plan which contain the endofit of B. bassiana showed the percentage of tested insect mortality is 64%. The observation showed that the corn plant can still produce the toxin of beauverisin.

Will algorithms modified with soil and weather information improve in-field reflectance-sensing corn nitrogen applications?

Science.gov (United States)

Nitrogen (N) needs to support corn (Zea mays L.) production can be highly variable within fields. Canopy reflectance sensing for assessing crop N health has been implemented on many farmers’ fields to side-dress or top-dress variable-rate N application, but at times farmers report the performance of...

Bioaccessibility and antioxidant activity of free phenolic compounds and oligosaccharides from corn (Zea mays L.) and common bean (Phaseolus vulgaris L.) chips during in vitro gastrointestinal digestion and simulated colonic fermentation.

Science.gov (United States)

Luzardo-Ocampo, I; Campos-Vega, R; Gaytán-Martínez, M; Preciado-Ortiz, R; Mendoza, S; Loarca-Piña, G

2017-10-01

Corn (Zea mays L.) and common beans (Phaseolus vulgaris L.) are alternative suitable ingredients for snacks, because of their content of bioactive compounds such as phenolic compounds (PC) and oligosaccharides (OS). However, there is no information about the transformation of these compounds associated with food matrix during gastrointestinal digestion. Therefore, the objective of this work was to simulate the whole digestion process (mouth to colon) to estimate bioaccessibility and small intestine permeability of free PC and OS, and the antioxidant capacity of free PC. Digested nixtamalized corn-cooked common bean chips exhibited significant different quantities of free PC and OS, and higher antioxidant activity compared to methanolic extract. The free PC showed high values of apparent permeability coefficients (0.023-0.729×10 -3 ), related with their absorption in the small intestine. Both free PC and OS were retained in the non-digestible fraction of chips (10.24-64.4%) and were able to reach the colon. Our results suggest the digestion potential to increase chip bioactive compounds and antioxidant activity. Additional studies are required to evaluate their in vivo effects. Copyright © 2017. Published by Elsevier Ltd.

Effect of Nitrogen Fertilizer on Weeds Growth and Emergence and Yield and Yield Components of Corn (Zea mays L.

Directory of Open Access Journals (Sweden)

M. Gholamshahi

2017-01-01

components of corn and weeds growth and emergence, a field study was conducted in research Station of Natural Resources Research Centre, Kerman province. Materials and Methods: This experiment was conducted using a randomized complete block design with three replications. The treatments consisted of different levels of nitrogen in four levels (0, 80, 160, 240 kg ha-1 urea fertilizer (46%. In addition, for assessment the effect of experimental treatments, each plot separated into two parts (complete control and non-control of weeds. Preparing the field was done with autumn plowing and spring disc. Corn seeds (single cross 704 were planted on rows in the spring with hand and with the density of 71000 plants per hectare with row spacing of 70 cm and 20cm. Irrigation was performed on average every7 days. Weeds in the control treatment were weeding by hand twice during the growing season. Results and Discussion: The results showed that nitrogen application in combination with weeds control increased yield and yield components of corn and the other growth traits, significantly. The maximum corn yield observed 12/8 kg under high nitrogen treatment (240 kg ha-1 with 88/82% increase compare with non-fertilizer treatment. Moreover, increase in nitrogen imposed a significant positive affect on height, yield and yield components including (Length and ear diameter and ear dry matter, the number of grains in row and the number of rows in ear, hundred grain weight. Nitrogen is one of the factors affecting the development of leaf area per plant and therefore, the development of the corn canopy. It seems that the increase of nitrogen during the tassel stage and seed formation which are the most sensitive stages to nitrogen absorption and photosynthesis, increased the length of ear. In addition, results of the experiment indicated that control of weeds had significant effect on different growth factors. Furthermore, the increase nitrogen rate caused to weeds emergence rate and dry weight

Mucuna pruriens and its effect on the productivity of sweet corn (Zea mays L.

Directory of Open Access Journals (Sweden)

Oscar Eduardo Sanclemente Reyes

2013-10-01

Full Text Available The nitrogen contribution to the soil Typic Haplustalfs through the species Mucuna pruriens as a green manure and cover crop, and its effects on sweet corn yield were evaluated. There was a max fixation in the soil of 201 kg ha-1 which contrasted with the control. The treatment using the green manure and compost 2.5 t ha-1 and chemical fertilizer 125 kg ha-1 obtained the highest yield of dry corn grain 7 t ha-1 which is con­sidered very high for this agro ecological zone. The use of compost and fertilizer synthesis as a cover had no significant effect on the corn yield, possibly due to its dynamic losses.

Effect of Filter Cake on Morphophysiological and Yield of Sweet Corn Under Late Season Drought Stress Condition

Directory of Open Access Journals (Sweden)

S. A. Siadat

2015-06-01

Full Text Available In order to investigate the effect of Filter Cake application on some morpho-physiological characteristics and yield of sweet corn (Zea mays var saccharata under different irrigation regimes, an experiment was conducted in Ramin Agriculture and Natural Resources University, Khuzestan, in 2012. The experiment was arranged in split-plot design in RCBD (Completely Randomized Block Design with three replications. Treatments were drought stress (irrigation after 25, 50 and 75% depletion of available water content in main plots and Filter Cake (0, 10, 20 and 30 tonha-1 arranged in sub-plots. Results showed that drought stress increased electrolyte leakage (EL and proline content (PC while height of plant, relative water content (RWC, chlorophyll stability index and ear and grain yield were decreased. The intensive drought stress had the greatest effect on EL and PC (54% increase, and decreased ear and grain yield by21 and 37% compared to control, respectively. Application of filter cake on non-stress condition increased height of plant and economic yield. But Filter Cake in intensive stress reduced RWC and yield and increased EL compared to control. Also, the application of 30 tonha-1 of Filter Cake in intensive stress condition decreased ear and grain yield by 14.5 and 10.7% respectively. Thus, positive effect of Filter Cake application was clear on non-stress condition, but on drought stress condition it decreased the economic yield.

ASSESSING INTRA- AND INTER-FIELD VARIABILITY OF CORN NITROGEN FERTILIZER NEED USING GROUND-BASED REFLECTANCE SENSORS

Science.gov (United States)

Since soil types within and between corn (Zea mays L.) fields can be highly variable, the amount of nitrogen (N) provided by those different soil types to support production can also be highly variable. Ideally, the amount of N fertilizer added during a given growing season should be both climate-se...

Precision overhead irrigation is suitable for several Central Valley crops

Directory of Open Access Journals (Sweden)

Jeffrey P. Mitchell

2016-04-01

Full Text Available Overhead systems are the dominant irrigation technology in many parts of the world, but they are not widely used in California even though they have higher water application efficiency than furrow irrigation systems and lower labor requirements than drip systems. With water and labor perennial concerns in California, the suitability of overhead systems merits consideration. From 2008 through 2013, in studies near Five Points, California, we evaluated overhead irrigation for wheat, corn, cotton, tomato, onion and broccoli as an alternative to furrow and drip irrigation. With the exception of tomato, equal or increased yields were achieved with overhead irrigation. Many variables are involved in the choice of an irrigation system, but our results suggest that, with more research to support best management practices, overhead irrigation may be useful to a wider set of California farmers than currently use it.

Effects of sowing date and plant density on morphological triats, yield and yield components of sweet corn (Zea mays L.

Directory of Open Access Journals (Sweden)

A. Rahmani

2016-04-01

Full Text Available In order to evaluate the effect of sowing date and plant density on the morphological triats, yield and yield components of sweet corn (Zea mays L. var SC. 403 an experiment was conducted at the Khorasan Razavi Agricultural Research and Natural Resources Center, Mashhad, Iran during 2008. This experiment was carried out as split plot based on RCBD with four replications. The sowing date (14th June, 3th July and 24th July and plant densities (66600, 83300 and 111000 plants.ha-1 were arranged in main and sub plots, respectively. The results showed significant differences between different sowing dates for plant height, ear height, and no. of leaves/plant, no. of leaves above ear, stem diameter, dehusked ear yield, can grains yield, no. of grain rows/ear, ear length, ear diameter, kernel depth, no. of ear.plant-1, 1000 kernel weight, ear harvest index and plant harvest index. The highest and the lowest can grains yield with 18.27 and 0.930 ton ha-1 was belonged to 14th June and 24th July sowing date, respectively. Although, delay in sowing date, led to decrease of growth period and also decrease of temperature can lead to improper transfer of photosynthetic materials and cause to grains yield decrease. The plant density had significant effects on husked ear yield, dehusked ear yield and forage yield. The highest can grains yield was harvested from the highest plant density (8.862 t.ha-1 and the lowest can grains yield derived from the lowest plant density (66600 plants.ha-1 with 7.692 t.ha-1. Finally, the interaction of sowing date and plant density was significant only for harvest index. Therefore, the sowing date 14th June and the highest plant density (111000 plants.ha-1, is recommended for summer sowing date of sweet corn in Mashhad with maximum and better can grains production.

Microwave heat treatment of dent corn (Zea mays var. indentata sturt ...

African Journals Online (AJOL)

2012-02-07

Feb 7, 2012 ... This study is on the determination of drying kinetics of corn and selecting proper model in ... energy and high thermal conductivity to the inner sides of ... The size of the oven is 300 x 460 x 280 mm and its rotating glass.

Využití kukuřice seté (Zea mays L.) pro energetické účely

OpenAIRE

RATAJ, David

2011-01-01

This bachelor thesis deals with the types of energy use of flint corn (Zea mays). It compares the suitability of hybrid maize lines. The thesis is to summarize and compare the literature data on other types of energy crops and compares them suitable for cultivation for energy recovery on the basis of some production capacity and energy parameters (dry matter yield, energy recovery, combustion heat and humidity).

Aldose Reductase Inhibitory Activity of Compounds from  Zea mays L.

Science.gov (United States)

Kim, Tae Hyeon; Kim, Jin Kyu; Kang, Young-Hee; Lee, Jae-Yong; Kang, Il Jun; Lim, Soon Sung

2013-01-01

Aldose reductase (AR) inhibitors have a considerable therapeutic potential against diabetes complications and do not increase the risk of hypoglycemia. Through bioassay-guided fractionation of an EtOH extract of the kernel from purple corn (Zea mays L.), 7 nonanthocyanin phenolic compounds (compound 1–7) and 5 anthocyanins (compound 8–12) were isolated. These compounds were investigated by rat lens aldose reductase (RLAR) inhibitory assays. Kinetic analyses of recombinant human aldose reductase (rhAR) were performed, and intracellular galactitol levels were measured. Hirsutrin, one of 12 isolated compounds, showed the most potent RLAR inhibitory activity (IC50, 4.78 μM). In the kinetic analyses using Lineweaver-Burk plots of 1/velocity and 1/substrate concentration, hirsutrin showed competitive inhibition against rhAR. Furthermore, hirsutrin inhibited galactitol formation in rat lens and erythrocytes sample incubated with a high concentration of galactose; this finding indicates that hirsutrin may effectively prevent osmotic stress in hyperglycemia. Therefore, hirsutrin derived from Zea mays L. may be a potential therapeutic agent against diabetes complications. PMID:23586057

Hormetic effect(s) of tetracyclines as environmental contaminant on Zea mays

International Nuclear Information System (INIS)

Migliore, Luciana; Godeas, Feliciana; De Filippis, Stefania Paola; Mantovi, Paolo; Barchi, Davide; Testa, Cecilia; Rubattu, Nicolino; Brambilla, Gianfranco

2010-01-01

Animal wastes from intensive pig farming as fertilizers may expose crops to antimicrobials. Zea mays cultivations were carried out on a virgin field, subjected to dressing with pig slurries contaminated at 15 mg L -1 of Oxy- and 5 mg L -1 of Chlor-tetracycline, and at 8 mg L -1 of Oxy and 3 mg L -1 of Chlor, respectively. Pot cultivation was performed outdoor (Oxy in the range 62.5-1000 ng g -1 dry soil) and plants harvested after 45 days. Tetracyclines analyses on soils and on field plants (roots, stalks, and leaves) did not determine the appreciable presence of tetracyclines. Residues were found in the 45-day pot corn only, in the range of 1-50 ng g -1 for Oxy in roots, accounting for a 5% carry-over rate, on average. Although no detectable residues in plants from on land cultivations, both experimental batches showed the same biphasic growth form corresponding to a dose/response hormetic curve. - Oxytetracycline in soils elicits a hormetic response in Zea mays plants.

Hormetic effect(s) of tetracyclines as environmental contaminant on Zea mays

Energy Technology Data Exchange (ETDEWEB)

Migliore, Luciana; Godeas, Feliciana [Dipartimento di Biologia, Universita Tor Vergata, Rome (Italy); De Filippis, Stefania Paola [Istituto Superiore di Sanita, Toxicological Chemistry Unit, Rome (Italy); Mantovi, Paolo [Centro Ricerche Produzioni Animali, Reggio Emilia (Italy); Barchi, Davide [Assessorato all' Agricoltura, Regione Emilia-Romagna, Bologna (Italy); Testa, Cecilia; Rubattu, Nicolino [Istituto Zooprofilattico Sperimentale della Sardegna, Sassari (Italy); Brambilla, Gianfranco [Istituto Superiore di Sanita, Toxicological Chemistry Unit, Rome (Italy)

2010-01-15

Animal wastes from intensive pig farming as fertilizers may expose crops to antimicrobials. Zea mays cultivations were carried out on a virgin field, subjected to dressing with pig slurries contaminated at 15 mg L{sup -1} of Oxy- and 5 mg L{sup -1} of Chlor-tetracycline, and at 8 mg L{sup -1} of Oxy and 3 mg L{sup -1} of Chlor, respectively. Pot cultivation was performed outdoor (Oxy in the range 62.5-1000 ng g{sup -1} dry soil) and plants harvested after 45 days. Tetracyclines analyses on soils and on field plants (roots, stalks, and leaves) did not determine the appreciable presence of tetracyclines. Residues were found in the 45-day pot corn only, in the range of 1-50 ng g{sup -1} for Oxy in roots, accounting for a 5% carry-over rate, on average. Although no detectable residues in plants from on land cultivations, both experimental batches showed the same biphasic growth form corresponding to a dose/response hormetic curve. - Oxytetracycline in soils elicits a hormetic response in Zea mays plants.

Genetic Markers for Western Corn Rootworm Resistance to Bt Toxin

OpenAIRE

Flagel, Lex E.; Swarup, Shilpa; Chen, Mao; Bauer, Christopher; Wanjugi, Humphrey; Carroll, Matthew; Hill, Patrick; Tuscan, Meghan; Bansal, Raman; Flannagan, Ronald; Clark, Thomas L.; Michel, Andrew P.; Head, Graham P.; Goldman, Barry S.

2015-01-01

Western corn rootworm (WCR) is a major maize (Zea mays L.) pest leading to annual economic losses of more than 1 billion dollars in the United States. Transgenic maize expressing insecticidal toxins derived from the bacterium Bacillus thuringiensis (Bt) are widely used for the management of WCR. However, cultivation of Bt-expressing maize places intense selection pressure on pest populations to evolve resistance. Instances of resistance to Bt toxins have been reported in WCR. Developing genet...

Do soil tests help forecast nitrogen response in first-year corn following alfalfa on fine-textured soils?

Science.gov (United States)

Improved methods of predicting grain yield response to fertilizer N for first-year corn (Zea mays L.) following alfalfa (Medicago sativa L.) on fine-textured soils are needed. Data from 21 site-years in the North Central Region were used to (i) determine how Illinois soil nitrogen test (ISNT) and pr...

Influence of Agricultural Management on Phytochemicals of Colored Corn Genotypes ( Zea mays L.). Part 2: Sowing Time.

Science.gov (United States)

Giordano, Debora; Beta, Trust; Gagliardi, Federica; Blandino, Massimo

2018-05-02

Among the agronomic practices carried out in corn cultivation, the early sowing time is increasingly used by farmers of temperate regions to improve yield and reduce mycotoxin contamination of corn grains. The present study determined the influence of sowing time on the phytochemical content of grains of 10 colored genotypes of corn. There was a significant improvement of both grain yield (+26%), thousand kernel weight (+3%), and test weight (+2%) in plots sown early. The early sowing also significantly influenced the chemical composition of corn grains, with an increase in the concentration of cell-wall-bound phenolic acids (+5%) and β-cryptoxanthin (+23%) and a decrease in the concentration of lutein (-18%) and total anthocyanins (-21%). Environmental conditions that occurred during grain development significantly influenced the phytochemical content of corn grain, and early spring sowing could impart advantages in terms of both productivity and content of some antioxidants of whole-meal corn flour.

Effect of Organic Amendments and Chemical Fertilization in Production of Corn (Zea Mays L.

Directory of Open Access Journals (Sweden)

Fabio Emilio Forero Ulloa

2014-11-01

Full Text Available Corn is grown in 135 countries, and because of its uses and nutritional benefits is the world's most important cereal. In Colombia it is grown in various agro-ecological conditions of production. The bagasse is an organic residue resulting from the grinding of sugar cane (Saccharum officinarum L., used for the production of jaggery (solid resulting of boiling and evaporation of the juice from sugar cane, which can be used as an amendment and is a soil conditioner, as a rich source of phosphorus, calcium and nitrogen. The aim of the research was to evaluate the effect of bagasse against the application of other organic sources and chemical fertilization in maize, variety ICA-V-305. For this, a completely random statistical design with four treatments and absolute control was established. Results were subjected to analysis of variance and Tukey comparison test. Applying Bagasse + Abimgra® produced the greatest number of ears of corn, while the use of only bagasse, presented the second best results in terms of number of grains / ear and weight of 100 grains of corn, therefore bagasse becomes , through time, an important option as organic amendment, which would favor the production of corn, and an option as organic fertilizer.

Effects of water stress on the photosynthetic assimilation and distribution of 14C-photosynthate in maize (Zea mays L.) and bean (Phaseolus vulgaris L.)

International Nuclear Information System (INIS)

Martinez y Huaman, C.A.; Cerri, C.C.

1984-01-01

The relationship between photosynthesis and distribution of 14 C-photosinthate as affected by water stress was evaluated. Corn (Zea mays L.) during the grain filling period and bean (Phaseolus vulgaris L.) during flowering, representing a C-4 and a C-3 photosynthetic type, respectively, were studied. (M.A.C.) [pt

Evaluation and Comparison of Environmental Indicators of Hybrid Corn (Zea mays L. Production by Three Different Harvesting Methods in Alborz Province using Life Cycle Assessment

Directory of Open Access Journals (Sweden)

Majid Khanali

2018-02-01

environmental indicators including eutrophication potential (EP, global warming potential (GWP, acidification potential (AP, ozone layer depletion (OD, abiotic depletion (AD, photochemical oxidation (PO, human toxicity (HT, terrestrial ecotoxicity (TE, marine aquatic ecotoxicity (MAE and fresh water aquatic ecotoxicity (FAE were investigated. LCA was conducted using Sima Pro software from cradle to grave, i.e., from the production of raw materials to the production of hybrid corn considering the both farming and processing stages. One ton of produced hybrid corn was chosen as the functional unit in this study. Results and Discussion Total energy input to produce hybrid corn harvested by hand, combine and picker husker methods were calculated as 118711, 111335 and 120403 MJ ha-1, respectively. Electricity and nitrate fertilizer were the most important energy inputs for their investigated harvesting methods. The results of life cycle assessment revealed that electricity and diesel fuel used for irrigation had the most environmental impact in production of hybrid corn in the farm, while the consumption of fungicides had the largest environmental impacts in the processing stage. On the other hand, in harvesting method by picker husker, environmental indicators such as GWP, EU, HT, AP, AD and PO were higher than other harvesting methods. The different harvesting methods had no significant effect on OD and TE. MAE and FAE were higher than those of other harvesting methods because of the high consumption of diesel fuel and electricity in hand harvesting method,. Combine harvesting method had less environmental damage than other methods. Conclusion The combine harvesting method was recognized as the best harvesting method from environmental viewpoint. Electricity and diesel fuel consumption for supplying irrigation alter had the most environmental burdens in the agricultural stage. The right application of inputs such as herbicides and chemical fertilizers, substitution of non

Effect of different phosphorus fertilizer rates on N-uptake, N-efficiency and zea maize yield in irrigated soils

International Nuclear Information System (INIS)

Khalifa, Kh.

1993-01-01

Effect of different rates of P fertilizer on N-uptake, N-efficiency and zea mays (C.V.Lg 11) were studied by use of 15 N technique. The main objectives of this study were to study effect of different level of P on N-utilization and determine the interaction between P and N on zea mays yield, and the efficiency of N-fertilizer during different stages of plant growth. The field experiment was conducted for two years 1985 and 1986. The treatments were 0, 80, 160 Kg N, as urea Co( 15 NH 2 ) 2 and 0, 40, 80, 160 Kg P 2 O 5 as triplsuperphophate. The experiment design was randomized block of four replicates for each treatment. Yield (grain and dry matter), utilization of urea, N-uptake, total N, N-yield, Ndff%, NDF% and A-values were determined. All results indicate that zea mays responds to the addition of nitrogen and the yield increases with the increase of added nitrogen. The highest yield was for N 2 (160 Kg) level during two seasons. Also zea mays responds clearly to phosphorus especially at stages 1 and 2, where dry matter yield increases with the increase of phosphorus rate. The highest yield was for P 3 (160 Kg) rate. While in grain stage the response was for rate P 1 (40 Kg) and P 2 (80 Kg) in comparison with control. However P 1 , rate was dominant over P 2 and P 3 . The effect of P 2 rate on grain yield was very little in comparison with P 1 , while P 3 decreases the grain yield during two seasons in comparison with control. There is an effect of N and P when added both or separately. There is also effect for interaction between them on the yield (grain and dry matter). Generally, from the previous data we can conclude that the rate 160 Kg N/ha and 40 Kg P 2 O 5 /ha were optimum rate for zea mays fertilization in Deir-Ezzor (Syria) and similar areas for grain yield. (author). 17 refs., 6 tabs

Evaluating of Physiological Indices of Weed Species at Different Density on Corn (Zea mays L. Growth

Directory of Open Access Journals (Sweden)

Gh Mahmodi

2014-07-01

Full Text Available Crop density is one of the usage tools in sustainable agriculture to carry out integrated weed management. Weed species response varied according to diversity and density of species in agricultural ecosystems. This study was conducted in research field of Ferdowsi University of Mashhad, Iran. Four levels of corn densities (5, 6, 7 and 9 plant m-2 and four levels of species diversity were used including complete control, broad leaved control (corn and narrow leaves, grass control (corn and broad leaves and without control (corn, broadleaves and grass weeds by weeding. All species sampling were done at five stages from 42 days after planting up to the end of growth period. Crop growth rate, total dry matter of weed (TDMw and total dry matter of corn (TDMc were measured. Results showed that TDMc was minimum at 9 and 5 plant m-2 in the early growth period, while it was highest at 9 plant m-2 by the end of the growth period. Also, TDMc increased with increasing density in the weed free control, but (TDMc decreased about 46% in compare with complete control. The same trends were observed for CGR. It was found that broad leaves weeds were more effective than narrow leaves (causing 60 and 34% lower CGR reduction, respectively on corn growth.

Uptake of Zn++ and aflatoxin from perlite and liquid culture by Zea mays seedlings

International Nuclear Information System (INIS)

Llewellyn, G.C.; Reynolds, J.D.; Hurst, L.; Vance, R.A.; Dashek, W.V.

1982-01-01

The present paper reports our attempts to determine whether in inclusion of 0.0014 mM Zn ++ within a hydroponic culture medium affects the ability of 12-day-old Zea mays, cv. 'SS-522' to take-up [ 3 H]-aflatoxin B 1 . Data from the corollary experiment., i.e., whether inclusion of aflatoxin affects the ability of Zea mays, cvs. 'Truckers White', 'X-Sweet' and 'Merit' to take-up 65 ZnCl 2 are presented also. This report is a preliminary to one regarding an in-progress analysis of whether pollutant levels of Zn ++ affect aflatoxin uptake and distribution. In the absence of irrigating seedlings, which were grown in Perlite containing 65 ZnCl 2 , with a solution containing mixed aflatoxins, the stem contained the greatest amount of label with root plus seed the next highest and the leaf the least for each of the cvs. In contrast, when the seedlings were irrigated with a solution containing mixed aflatoxins, the root plus seed contained either an amount nearly identical to (cv. 'Truckers White') or in excess of that within the stem (cvs. 'X-Sweet' and 'Merit'). Calculation of the percentages of aflatoxin-induced diminutions in leaf, stem and root label suggested that the aflatoxins interfered with the translocation of 65 ZnCl 2 from the root to the stem and leaf, at least for cvs 'X-Sweet' and 'Merit'. (orig./AJ)

Effect of nitrate addition on the efficient use of ammonium sulfate fertilizer on corn under saline conditions . II. field experiment

International Nuclear Information System (INIS)

Khalifa, Kh.; Zidan, A

2003-01-01

two field experiments during two consecutive seasons, were conducted on corn (Zea mays L. var. Ghota-82), grown on a saline soil under flood irrigation system at ACSAD research station located at the Euphrates valley, Deir-Ez-zor district, east of Syria. The objective was to study the effect of applying different ratios of mixed NO 3 -N and NH 4 -N fertilizers on the biomass yield of corn. Five rates of nitrogen (0, 50, 100, 150 and 200 kg N/ha) were applied either in a single or in combination of two forms of 15 N labelled nitrogen fertilizers ( 15 NH 4 ) 2 SO 4 and Ca( 15 NO 3 ) 2 . Total N, 15 N, nitrogen use efficiency (N recovery) and dry matter yield were the parameters investigated. The results showed that: (1) The high concentrations of NH 4 -N reduced dry matter yield; (2) NO 3 -N was more effective in increasing total N content of plant tissues than the same concentration of NH 4 -N; (3) Combination treatments always induced both higher yields and N content of plant tissues than single treatments of NH 4 -N; (4) NH 4 -N form increased the NO 3 -N uptake, and the NO 3 -N form had an effect on the absorption of NH 4 -N; (5) the recovery of NO 3 -N form was much higher than NH 4 -N form under saline soil conditions. (author)

Blended Refuge and Insect Resistance Management for Insecticidal Corn

Science.gov (United States)

Crespo, Andre L B; Pan, Zaiqi; Crain, Philip R; Thompson, Stephen D; Pilcher, Clinton D; Sethi, Amit

2018-01-01

Abstract In this review, we evaluate the intentional mixing or blending of insecticidal seed with refuge seed for managing resistance by insects to insecticidal corn (Zea mays). We first describe the pest biology and farming practices that will contribute to weighing trade-offs between using block refuges and blended refuges. Case studies are presented to demonstrate how the trade-offs will differ in different systems. We compare biological aspects of several abstract models to guide the reader through the history of modeling, which has played a key role in the promotion or denigration of blending in various scientific debates about insect resistance management for insecticidal crops. We conclude that the use of blended refuge should be considered on a case-by-case basis after evaluation of insect biology, environment, and farmer behavior. For Diabrotica virgifera virgifera, Ostrinia nubilalis, and Helicoverpa zea in the United States, blended refuge provides similar, if not longer, delays in the evolution of resistance compared to separate block refuges. PMID:29220481

Comparison of the forage and grain composition from insect-protected and glyphosate-tolerant MON 88017 corn to conventional corn (Zea mays L.).

Science.gov (United States)

McCann, Melinda C; Trujillo, William A; Riordan, Susan G; Sorbet, Roy; Bogdanova, Natalia N; Sidhu, Ravinder S

2007-05-16

The next generation of biotechnology-derived products with the combined benefit of herbicide tolerance and insect protection (MON 88017) was developed to withstand feeding damage caused by the coleopteran pest corn rootworm and over-the-top applications of glyphosate, the active ingredient in Roundup herbicides. As a part of a larger safety and characterization assessment, MON 88017 was grown under field conditions at geographically diverse locations within the United States and Argentina during the 2002 and 2003-2004 field seasons, respectively, along with a near-isogenic control and other conventional corn hybrids for compositional assessment. Field trials were conducted using a randomized complete block design with three replication blocks at each site. Corn forage samples were harvested at the late dough/early dent stage, ground, and analyzed for the concentration of proximate constituents, fibers, and minerals. Samples of mature grain were harvested, ground, and analyzed for the concentration of proximate constituents, fiber, minerals, amino acids, fatty acids, vitamins, antinutrients, and secondary metabolites. The results showed that the forage and grain from MON 88017 are compositionally equivalent to forage and grain from control and conventional corn hybrids.

Vertical Distribution of Structural Components in Corn Stover

Directory of Open Access Journals (Sweden)

Jane M. F. Johnson

2014-11-01

Full Text Available In the United States, corn (Zea mays L. stover has been targeted for second generation fuel production and other bio-products. Our objective was to characterize sugar and structural composition as a function of vertical distribution of corn stover (leaves and stalk that was sampled at physiological maturity and about three weeks later from multiple USA locations. A small subset of samples was assessed for thermochemical composition. Concentrations of lignin, glucan, and xylan were about 10% greater at grain harvest than at physiological maturity, but harvestable biomass was about 25% less due to stalk breakage. Gross heating density above the ear averaged 16.3 ± 0.40 MJ kg−1, but with an alkalinity measure of 0.83 g MJ−1, slagging is likely to occur during gasification. Assuming a stover harvest height of 10 cm, the estimated ethanol yield would be >2500 L ha−1, but it would be only 1000 L ha−1 if stover harvest was restricted to the material from above the primary ear. Vertical composition of corn stover is relatively uniform; thus, decision on cutting height may be driven by agronomic, economic and environmental considerations.

Vertical distribution of structural components in corn stover

Energy Technology Data Exchange (ETDEWEB)

Jane M. F. Johnson; Douglas L. Karlen; Garold L. Gresham; Keri B. Cantrell; David W. Archer; Brian J. Wienhold; Gary E. Varvel; David A. Laird; John Baker; Tyson E. Ochsner; Jeff M. Novak; Ardell D. Halvorson; Francisco Arriaga; David T. Lightle; Amber Hoover; Rachel Emerson; Nancy W. Barbour

2014-11-01

In the United States, corn (Zea mays L.) stover has been targeted for second generation fuel production and other bio-products. Our objective was to characterize sugar and structural composition as a function of vertical distribution of corn stover (leaves and stalk) that was sampled at physiological maturity and about three weeks later from multiple USA locations. A small subset of samples was assessed for thermochemical composition. Concentrations of lignin, glucan, and xylan were about 10% greater at grain harvest than at physiological maturity, but harvestable biomass was about 25% less due to stalk breakage. Gross heating density above the ear averaged 16.3 ± 0.40 MJ kg?¹, but with an alkalinity measure of 0.83 g MJ?¹, slagging is likely to occur during gasification. Assuming a stover harvest height of 10 cm, the estimated ethanol yield would be >2500 L ha?¹, but it would be only 1000 L ha?¹ if stover harvest was restricted to the material from above the primary ear. Vertical composition of corn stover is relatively uniform; thus, decision on cutting height may be driven by agronomic, economic and environmental considerations.

Effects of Vermi compost and Compost tea Application on the Growth criteria of Corn (Zea mays

Directory of Open Access Journals (Sweden)

R Afsharmanesh

2016-07-01

Full Text Available Introduction Maize (Zea mays is a cereal crop that is grown widely throughout the world in a range of agroecological environments. .Its value as a cost-effective ruminant feed is one of the main reasons that farmers grow it. However, lack of nutrients such as N and P, are the principal obstacles - to crop production under low input agricultural systems leading to dependency on chemical fertilizers. Long-term use of chemical fertilizers destroy soil physicochemical properties and it reduced permeability which restricts root growth, nutrient uptake and plant production. Therefore, the use of organic fertilizers can help to enrich the soil root zone As a result growth and yield will improve. Materials and Methods In order to study the effects of different levels of vermicompost and foliar application of tea compost on growth characteristics of the hybrid maize genotype 713, a greenhouse experiment was conducted as a factorial experiment in randomized complete block design with three replications at the Vali-e-Asr University of Rafsanjan, during 2013. Treatments were included vermicompost (0, 5%, 10%, 15%, 20%, 25% and 30% pot weight and tea composts (foliar application, non-foliar application. Measured traits were included root dry weight, root volume, leaf dry weight, stem dry weight, macro nutrient concentration (N and P and micro nutrient concentration (Zn, Mn, Fe and Cu. All the data were subjected to the statistical analysis (two-way ANOVA using SAS software (SAS 9.1.3. Differences between the treatments were performed by Duncan’s multiple range test (DMRT at 1% confidence interval. Results and Discussion Results indicated that leaf and stem dry weight affected by the application of vermicompost and tea compost. However, the interaction effects had no significant effects on the leaf and stem dry weight. Application of tea compost increased 20% and 50% leaf dry weight and stem dry weight of corn compared to non- foliar application

Evaluation of multi-species weed competition and weeds population dynamic in corn Zea mays L. field

Directory of Open Access Journals (Sweden)

S Mijani

2016-05-01

Full Text Available In order to examine the multi-species weed competition in corn field an experiment as an interval mapping was carried out at the Agricultural Research field of Ferdowsi University of Mashhad during growing season 2009-2010. At 3-4 leafy stages of corn, 20 non-destructive quadrates determine and the density of weeds was counted separately. At the same time, 20 destructive quadrates determine and in addition of counting number of plants, leaf area index and dry weight of each species were recorded separately. By using data from previous section, hyperbolic functions were fitted. In these functions number of species serve as the independent variable, weight or leaf area was considered as the dependent variable. With the help of these functions and leaf dry weight of each species was determined for non-destructive quadrates at this stage. Relative leaf area at early season as independent variables and natural logarithm of individual plant weight at later season as dependent variable in a multiple linear regression was fitted to obtain the interspecies competition coefficients. Based on ln of weight of single plant equation the weed interference effects on the corn yield can be divided into two groups: inhibition (negative sign and stimulation (positive sign. Among all weeds, night shade (Solanum nigrum L., redroot pigweed (Amaranthus retroflexus L. and lambsquarter (Chenopodium album L. had positive effects on corn yield, respectively. In fact, these weeds had competition and negative impacts on other weeds and reduced their competition power with corn and caused facilitation role on corn yield. At the end of growing season of corn, population of lambsquarter and Common purslane (Portulaca oleracea L. decreased while population of barnyard grass(Echinochloa crus-galli L., redroot pigweed and night shade increased.

RAPD and Internal Transcribed Spacer Sequence Analyses Reveal Zea nicaraguensis as a Section Luxuriantes Species Close to Zea luxurians

Science.gov (United States)

Wang, Pei; Lu, Yanli; Zheng, Mingmin; Rong, Tingzhao; Tang, Qilin

2011-01-01

Genetic relationship of a newly discovered teosinte from Nicaragua, Zea nicaraguensis with waterlogging tolerance, was determined based on randomly amplified polymorphic DNA (RAPD) markers and the internal transcribed spacer (ITS) sequences of nuclear ribosomal DNA using 14 accessions from Zea species. RAPD analysis showed that a total of 5,303 fragments were produced by 136 random decamer primers, of which 84.86% bands were polymorphic. RAPD-based UPGMA analysis demonstrated that the genus Zea can be divided into section Luxuriantes including Zea diploperennis, Zea luxurians, Zea perennis and Zea nicaraguensis, and section Zea including Zea mays ssp. mexicana, Zea mays ssp. parviglumis, Zea mays ssp. huehuetenangensis and Zea mays ssp. mays. ITS sequence analysis showed the lengths of the entire ITS region of the 14 taxa in Zea varied from 597 to 605 bp. The average GC content was 67.8%. In addition to the insertion/deletions, 78 variable sites were recorded in the total ITS region with 47 in ITS1, 5 in 5.8S, and 26 in ITS2. Sequences of these taxa were analyzed with neighbor-joining (NJ) and maximum parsimony (MP) methods to construct the phylogenetic trees, selecting Tripsacum dactyloides L. as the outgroup. The phylogenetic relationships of Zea species inferred from the ITS sequences are highly concordant with the RAPD evidence that resolved two major subgenus clades. Both RAPD and ITS sequence analyses indicate that Zea nicaraguensis is more closely related to Zea luxurians than the other teosintes and cultivated maize, which should be regarded as a section Luxuriantes species. PMID:21525982

Impact of glyphosate resistant corn, glyphosate applications, and tillage on soil nutrient ratios, exoenzyme activities, and nutrient acquisition ratios

Science.gov (United States)

We report results of the last two years of a 7-year (2008-2014) field experiment designed to test the null hypothesis that applications of glyphosate on glyphosate resistant corn (Zea mays L.) as a routine weed control practice under both conventional and reduced tillage practices would have no effe...

Purple corn-associated rhizobacteria with potential for plant growth promotion.

Science.gov (United States)

Castellano-Hinojosa, A; Pérez-Tapia, V; Bedmar, E J; Santillana, N

2018-05-01

Purple corn (Zea mays var. purple amylaceum) is a native variety of the Peruvian Andes, cultivated at 3000 m since the pre-Inca times without N fertilization. We aimed to isolate and identify native plant growth-promoting rhizobacteria (PGPR) for future microbial-based inoculants. Eighteen strains were isolated from the rhizosphere of purple corn plants grown without N fertilization in Ayacucho (Peru). The 16S rRNA gene clustered the 18 strains into nine groups that contained species of Bacillus, Stenotrophomonas, Achromobacter, Paenibacillus, Pseudomonas and Lysinibacillus. A representative strain from each group was selected and assayed for N 2 fixation, phosphate solubilization, indole acetic and siderophore production, 1-aminocyclopropane-1-carboxylic acid deaminase activity and biocontrol abilities. Inoculation of purple corn plants with single and combined strains selected after a principal component analysis caused significant increases in root and shoot dry weight, total C and N contents of the plants. PGPRs can support growth and crop production of purple corn in the Peruvian Andes and constitute the base for microbial-based inoculants. This study enlarges our knowledge on plant-microbial interactions in high altitude mountains and provides new applications for PGPR inoculation in purple amylaceum corn, which is part of the staple diet for the native Quechua communities. © 2018 The Society for Applied Microbiology.

Quantitative analysis of allantoin in Iranian corn silk

Directory of Open Access Journals (Sweden)

E. Khanpour*

2017-11-01

Full Text Available Background and objectives: Zea mays is cultivated in different parts of Iran and corn silk is used in traditional medicine. Allantoin is one of the major compounds in corn silk. The purpose of this research was the quantitatve analysis of allantoin in corn silks belonging to several regions of Iran. Methods: The samples of corn silk were prepared from three provinces of Iran (Kermanshah, Fars and Razavi Khorasan. The dried plant materials were infused in boiling distilled water with a temperature of 90-95 °C on magnetic stirrer for 30 min. The levels of allantoin in aqueous extracts were determined by HPLC. Quantification was achieved using an C18 column (250×4.6 mm, 5 µm under isocratic conditions and phosphate buffer solution (pH 3.0 as the mobile phase at a flow rate of 0.5 mL/min. Column effluent was monitored at 210 nm. The calibration curve of allantoin standard was plotted with concentrations from 6.25 to 100 µg/mL. Results: The calibration curve of standard was linear over the concentration range used (R2=0.9999. The results showed that the amount of allantoin in samples was between 205 and 374 mg/100g of dry plant material. The corn silk samples of Razavi Khorasan and Fars provinces showed the lowest and highest amount of allantoin, respectively. Conclusion: The levels of allantoin obtained in this study were higher than the values reported in other studies; therefore, the researchers of this project are investigating the wound healing effect of corn silk.

On-plant movement and feeding of western bean cutworm (Lepidoptera: Noctuidae) early instars on corn.

Science.gov (United States)

Paula-Moraes, S V; Hunt, T E; Wright, R J; Hein, G L; Blankenship, E E

2012-12-01

Western bean cutworm, Striacosta albicosta (Smith), has undergone a recent eastward expansion from the western U.S. Corn Belt to Pennsylvania and parts of Canada. Little is known about its ecology and behavior, particularly during the early instars, on corn (Zea mays L.). There is a narrow treatment window for larvae, and early detection of the pest in the field is essential. An understanding of western bean cutworm larval feeding and early-instar dispersal is essential to understand larval survival and establishment in corn. Studies were conducted in 2009 through 2011 in Nebraska to determine the feeding and dispersal of early-instar western bean cutworm on corn. The treatment design was a factorial with three corn stages (pretassel, tassel, and posttassel) and five corn plant zones (tassel, above ear, primary ear, secondary ear, and below ear) in a randomized complete block design. The effects of different corn tissues on larval survival and development were investigated in laboratory studies in a randomized complete block design during 2009 and 2011. Treatments were different corn tissues (leaf alone, leaf with developing tassel, pollen, pollen plus silk, and silk alone). Results demonstrated that neonate larvae move to the upper part of the plant, independent of corn stage. Larval growth was optimal when fed on tassel tissue. Overall results indicated a selective benefit for movement of the early instar to upper part of the plant.

Crop and Soil Responses to Using Corn Stover as a Bioenergy Feedstock: Observations from the Northern US Corn Belt

Directory of Open Access Journals (Sweden)

Jane M. F. Johnson

2013-02-01

Full Text Available Corn (Zea mays L. stover is a potential bioenergy feedstock, but little is known about the impacts of reducing stover return on yield and soil quality in the Northern US Corn Belt. Our study objectives were to measure the impact of three stover return rates (Full (~7.8 Mg ha−1 yr−1, Moderate (~3.8 Mg ha−1 yr−1 or Low (~1.5 Mg ha yr−1 Return on corn and soybean (Glycine max. L [Merr.] yields and on soil dynamic properties on a chisel-tilled (Chisel field, and well- (NT1995 or newly- (NT2005 established no-till managed fields. Stover return rate did not affect corn and soybean yields except under NT1995 where Low Return (2.88 Mg ha−1 reduced yields compared with Full and Moderate Return (3.13 Mg ha−1. In NT1995 at 0–5 cm depth, particulate organic matter in Full Return and Moderate Return (14.3 g kg−1 exceeded Low Return (11.3 g kg−1. In NT2005, acid phosphatase activity was reduced about 20% in Low Return compared to Full Return. Also the Low Return had an increase in erodible-sized dry aggregates at the soil surface compared to Full Return. Three or fewer cycles of stover treatments revealed little evidence for short-term impacts on crop yield, but detected subtle soil changes that indicate repeated harvests may have negative consequences if stover removed.

Optimasi Konsentrasi Ekstrak Alang-Alang (Imperata cylindrica L. untuk Memacu Pertumbuhan dan Produksi Jagung Manis (Zea mays Saccharata Sturt

Directory of Open Access Journals (Sweden)

Mayta Novaliza Isda

2016-03-01

Full Text Available Sweet corn (Zea mays saccharata Struts a type of corn of high economic value, not only used for consumption also used to make syrup. Imperata is one of the weeds that interfere with crop cultivation, but efforts continue to be made use of weeds as an addition to soil organic matter. The study was conducted to determine the concentration of the extract Imperata (Imperata cylindrica L. appropriate in the sweet corn growth and determine the concentration of extract proper Imperata in the growth and production. The research method is a Completely Randomized Design (CRD with 9 treatments and 3 replicates. The results showed that treatment of Imperata extracts with varying concentrations significantly influenced the growth of plant height and leaf number. But not significantly to the growth of the leaf length, leaf width, stem diameter, number of rows per cob, number of seeds per row and plant dry weight. At a concentration of 200 g / 250 ml was able to reduce the vegetative and generative growth of sweet corn.

Sweet corn (Zea mays L.: Fresh ear yield in dependance of genotype and the environment

Directory of Open Access Journals (Sweden)

Srdić Jelena

2016-01-01

Full Text Available Sweet corn is used as food in the milky stage of endosperm, when its kernel is tender, succulent and sweet. It is consumed in form of fresh ears, or it is industrially processed. Breeding of sweet corn has several equally important aims that are directed by the market demands and different modes of consumption. The ear yield, in sweet corn is the most important but not the only main goal of breeding. In the two year study (2013, 2014 we observed the effect of the genotype, year and their interactions on the yields of 8 sweet corn hybrids. Two of the hybrids were commercial and six were experimental hybrids. The field experiment was arranged according to the RCBD with four replications. Hybrids were harvested 23 days after pollination, i.e. silking. Average yield in 2013 was significantly higher (12.19 t ha-1 than in 2014 (11.49 t ha- 1. In 2013 it ranged from 10.21 t ha-1 for the experimental hybrid ZP 489/1su, up to 13.52 t ha-1 for the commercial hybrid ZP 355su. In 2014 the lowest yielding hybrid was ZP 485/1su (10.14 t ha-1 while the highest yielding was ZP 486/1su (13.41 t ha-1. On average those two were also the highest (13.19 t ha-1 and the lowest yielding (10.66 t ha-1 hybrids. Statistical analysis showed that the effect of genotype and the year, as well as their interactions had significant impact on the yield performances of sweet corn hybrids.

Water Table Management Reduces Tile Nitrate Loss in Continuous Corn and in a Soybean-Corn Rotation

Directory of Open Access Journals (Sweden)

Craig F. Drury

2001-01-01

Full Text Available Water table management systems can be designed to alleviate soil water excesses and deficits, as well as reduce nitrate leaching losses in tile discharge. With this in mind, a standard tile drainage (DR system was compared over 8 years (1991 to 1999 to a controlled tile drainage/subirrigation (CDS system on a low-slope (0.05 to 0.1% Brookston clay loam soil (Typic Argiaquoll in southwestern Ontario, Canada. In the CDS system, tile discharge was controlled to prevent excessive drainage, and water was pumped back up the tile lines (subirrigation to replenish the crop root zone during water deficit periods. In the first phase of the study (1991 to 1994, continuous corn (Zea mays, L. was grown with annual nitrogen (N fertilizer inputs as per local soil test recommendations. In the second phase (1995 to 1999, a soybean (Glycine max L., Merr.-corn rotation was used with N fertilizer added only during the two corn years. In Phase 1 when continuous corn was grown, CDS reduced total tile discharge by 26% and total nitrate loss in tile discharge by 55%, compared to DR. In addition, the 4-year flow weighted mean (FWM nitrate concentration in tile discharge exceeded the Canadian drinking water guideline (10 mg N l–1 under DR (11.4 mg N l–1, but not under CDS (7.0 mg N l–1. In Phase 2 during the soybean-corn rotation, CDS reduced total tile discharge by 38% and total nitrate loss in tile discharge by 66%, relative to DR. The 4-year FWM nitrate concentration during Phase 2 in tile discharge was below the drinking water guideline for both DR (7.3 mg N l–1 and CDS (4.0 mg N l–1. During both phases of the experiment, the CDS treatment caused only minor increases in nitrate loss in surface runoff relative to DR. Hence CDS decreased FWM nitrate concentrations, total drainage water loss, and total nitrate loss in tile discharge relative to DR. In addition, soybean-corn rotation reduced FWM nitrate concentrations and total nitrate loss in tile discharge

Intraguild competition and enhanced survival of western bean cutworm (Lepidoptera: Noctuidae) on transgenic Cry1Ab (MON810) Bacillus thuringiensis corn.

Science.gov (United States)

Dorhout, David L; Rice, Marlin E

2010-02-01

The effect of genetically modified corn (event MON810, YieldGard Corn Borer) expressing the Bacillus thuringiensis sp. kurstaki (Berliner) (Bt) endotoxin, Cry1Ab, on the survival of western bean cutworm, Striacosta albicosta (Smith), larvae was examined during intraguild competition studies with either European corn borer, Ostrinia nubilalis (Hübner), or corn earworm, Helicoverpa zea (Boddie), larvae. Competition scenarios were constructed by using either a laboratory or field competition arena containing one of five different diets and one of 13 different larval size-by-species scenarios. The survival of western bean cutworms competing with corn earworms in the laboratory arenas on either a meridic diet or isoline corn silk diet was significantly lower (P corn earworm on a Cry1Ab-MON810 corn silk diet was significant higher (P corn borers generally did not alter the outcomes observed in the western bean cutworm and corn earworm only two-way competitions. These data suggest that Cry1Ab-MON810 corn may confer a competitive advantage to western bean cutworm larvae during intraguild competition, particularly from corn earworms, and that western bean cutworms become equal competitors only when they are of equal or larger size and the diet is Cry1Ab-MON810 corn.

Potential of Microbispora sp. V2 as biocontrol agent against Sclerotium rolfsii, the causative agent of southern blight of Zea mays L (Baby corn)--in vitro studies.

Science.gov (United States)

Patil, N N; Waghmode, M S; Gaikwad, P S; Gajbhiye, M H; Gunjal, A B; Nawani, N N; Kapadnis, B P

2014-11-01

The study was undertaken with the aim of exploring novel and beneficial agro activities of rare actinomycetes like Microbispora sp. V2. The antagonistic activity of Microbispora sp. V2 was evaluated as a biocontrol agents against Sclerotium rolfsii, a soil-borne fungal plant pathogen. The methodology performed for evaluation of biocontrol agent was in vitro evaluation assay which comprised of three tests viz., cellophane overlay technique, seed germination test and Thiram (fungicide) tolerance of Microbispora sp. V2. The isolate was found to inhibit the fungal pathogen Sclerotium rolfsii to 91.43% in cellophane assay. In seed germination assay, Microbispora sp. V2 treated seeds resulted in 25.75% increased germination efficiency, as compared to seeds infected by Sclerotium rolfsii. The isolate Microbispora sp. V2 could tolerate 1000 microg mL(-1) of Thiram (fungicide). The in vitro assay studies proved that Microbispora sp. V2 can be used as antifungal antagonist and thus posses' great potential as biocontrol agent against southern blight caused by Sclerotium rolfsii in Zea mays L (Baby corn) which causes large economical losses.

Corn silk aqueous extracts and intraocular pressure of systemic and non-systemic hypertensive subjects.

Science.gov (United States)

George, Gladys O; Idu, Faustina K

2015-03-01

Hypotensive properties have been attributed to the stigma/style of Zea mays L (corn silk). Although the effect of corn silk extract on blood pressure has been documented in animal studies, we are not aware of any study on its effect on human blood pressure and intraocular pressure. A randomised study was carried out on the effect of water only, masked doses of corn silk aqueous extract (60, 130, 192.5 and 260 mg/kg body weight) on intraocular pressure and blood pressure of 20 systemic and 20 non-systemic hypertensive subjects. Intraocular pressure and blood pressure were measured at baseline and every hour for eight hours after administering water or a masked dose of corn silk aqueous extract. Each dose was administered at two-week intervals to each subject in the two study groups. The results showed that the last three doses of corn silk aqueous extract gave a statistically significant reduction (p Corn silk aqueous extract has a lowering effect on intraocular pressure in systemic and non-systemic hypertensive subjects. This may have resulted from the fall in blood pressure that is due to potassium-induced natriuresis and diuresis caused by the high potassium content in the high doses of the corn silk extract. © 2015 The Authors. Clinical and Experimental Optometry © 2015 Optometry Australia.

A Review of Growth Stage Deficit Irrigation Effecting Sticky Maize Production

Directory of Open Access Journals (Sweden)

Ha Bui Manh

2017-06-01

Full Text Available The shortage of water resources influences the future sustainability of sticky Maize (Zea mays L. production. Deficit irrigation (DI - a water management strategy - has gained much attention from scientists because of enhanced water use efficiency (WUE. Nonetheless, in reality, when applying this technique, its impact on yield and economic returns should be considered. Through an analytical literature review, this study examined the effect of growth stage DI on Maize production factors, i.e. yield, WUE, and economic returns. The results revealed that Maize’s WUE could be improved with the lowest reduction in yield as water stress was imposed during the vegetative or maturation growth stages. Therefore, the profitable returns could be reached even if the yield was reduced; however, the economic return was sensitive to commodity prices. The present review addressed that the Maize flexible capacities under growth stage water stress presented an opportunity for the optimization of irrigated water and profit preservation by accurately judging the managing time of irrigation implementation.

Infection of corn ears by Fusarium spp. induces the emission of volatile sesquiterpenes.

Science.gov (United States)

Becker, Eva-Maria; Herrfurth, Cornelia; Irmisch, Sandra; Köllner, Tobias G; Feussner, Ivo; Karlovsky, Petr; Splivallo, Richard

2014-06-04

Infection of corn (Zea mays L.) ears with fungal pathogens of the Fusarium genus might result in yield losses and in the accumulation of mycotoxins. The aim of this study was to investigate whether volatile profiles could be used to identify Fusarium-infected corn ears. The volatiles released by corn ears infected by Fusarium graminearum, Fusarium verticillioides, and Fusarium subglutinans were studied. Volatile emission was recorded at 24 days postinoculation (dpi) and in a time series (from 4 to 24 dpi). Twenty-two volatiles were differentially emitted from Fusarium-infected versus healthy corn ears. These included C6-C8 compounds and sesquiterpenoids. All volatiles indicative of Fusarium infection were detectable as early as 4-8 dpi and continued to be produced to the final sampling time (early milk maturity stage). The induced emission of β-macrocarpene and β-bisabolene correlated with an increased transcript accumulation of corn terpene synthase 6/11 (tps6/11). Additionally, the modification of volatile profiles after Fusarium infection was accompanied by the induction of plant defense compounds such as zealexins and oxylipins. Together, these results reveal a broad metabolic response of the plant to pathogen attack. Volatile biomarkers of Fusarium infection are promising indicators for the early detection of fungal infection before disease symptoms become visible.

Ecophysiological Evaluation of Three Maize (Zea mays L. Cultivars under Irrigation Regimes and Use of Super Absorbent

Directory of Open Access Journals (Sweden)

Allahyar Hassanzadeh

2016-03-01

Full Text Available To evaluate the effects of using super absorbent and irrigation regimes on seed yield and yield components of maize cultivars a split plot experiment based on randomized complete block design with three replications was performed at the Research Field of Malekan Islamic Azad University. Main factor consisted of three irrigation regimes (irrigation after 70, 110 and 150 mm evaporation from pan and subfactor of two levels of super absorbent applications (application and without application and three maize cultivars (704, Iranian maxima and overseas maxima. Based on the results obtained it was revealed that highest seed yield (985 g/m2 belonged to the plants irrigated after 70 mm evaporation from the pan without using super absorbent. Irrigation after evaporation of 150 mm from the pan decreased both seed numbers per plant and 100 seed weight, and seed yield loss amounted to be 46.1% as compared with irrigation after 70 mm evaporation from the pan. Without using super absorbent and irrigation after 150 mm evaporation from the pan decreased seed number per ear by 38.8% and 100 seed weight by 13.8%. However, application of super absorbent and irrigation of plants after 150 mm evaporation from the pan increased by grain yield 38% as compared with out using super absorbent. There were not significant difference between cultivars for seed yield and yield components. It could be concluded that application of super absorbent under water shortage conditions may reduce crop yield losses.

Desempenho produtivo de juvenis de tambaqui (Colossoma macropomum Cuvier, 1818 alimentados com rações contendo farinha de crueira de mandioca (Manihot esculenta, Crantz em substituição ao milho (Zea mays Performance of juvenile tambaqui (Colossoma macropomum Cuvier, 1818 fed diets containing crueira manioc flour (Manihot esculenta, Crantz in replacement of corn (Zea mays

Directory of Open Access Journals (Sweden)

Geraldo Pereira Pereira Junior

2013-06-01

Full Text Available O objetivo deste estudo foi avaliar o desempenho produtivo de juvenis de tambaqui (Colossoma macropomum, alimentados com níveis crescentes de farinha de crueira de mandioca, Manihot esculenta (0%, 20%, 40%, 60%, 80%, 100%, como substituto do milho (Zea mays. Os peixes (peso médio inicial de 6,6 ± 0,1 g foram distribuídos aleatoriamente em 24 grupos (20 peixes/grupo e alimentados com as dietas experimentais em quatro repetições para avaliação da performance de crescimento, eficiência alimentar, composição corporal e os custos de produção. As performances de crescimento não foram afetados pelos tratamentos. O teor de lipídio no músculo foi diferentemente significativo em peixes alimentados com 40% e 100% em relação aos outros tratamentos. O custo de produção de milho diminuiu linearmente com a substituição. O valor da dieta diminuiu de R $ 1,43 kg-1 a R $ 1,21 kg-1 e o peixe de R $ 1,54 kg-1 a R $ 1,30 peixe kg-1. Concluiu-se que o milho pode ser totalmente substituído por farinha de crueira de mandioca na dieta de juvenil de tambaqui, sem prejudicar o seu desempenho.The main objective of this study was to evaluate the productive performance of young tambaqui (Colossoma macropum, fed with increasing levels of cassava flour, Manihot esculenta (0%, 20%, 40%, 60%, 80%, 100%, as corn (Zea mays replacement. Fish (initial body weight 6.6 ± 0.1 g were randomly distributed in 24 groups (20 fish/group with four replications. They were fed with the experimental diets for evaluation of growth performances, feed utilization, body composition and production costs. Growth performances were not affected by the dietary treatments. Lipid content in muscle were significant different in fish fed 40% and 100% substitution when compared to the other treatments. The production cost decreased linearly with corn substitution. Diet decreased from R$ 1.43 kg-1 to R$ 1.21 kg-1 and fish production cost from R$ 1.54 kg-1 to R$ 1.30 kg-1 fish. It was

Field evidence for the exposure of ground beetles to Cry1Ab from transgenic corn.

Science.gov (United States)

Zwahlen, Claudia; Andow, David A

2005-01-01

Non-target organisms associated with the soil might be adversely affected by exposure to the CrylAb protein from Bacillus thuringiensis (Bt) in transgenic corn (Zea mays L.). To check for such exposure, we used ELISA to test for Cry1Ab in ground beetles collected live from fields with Bt corn residues and Bt corn (Bt/Bt), Bt corn residues and non-Bt crops (Bt/non-Bt), or non-Bt corn residues and non-Bt crops (non-Bt/non-Bt). In fields with Bt corn residues (Bt/Bt and Bt/non-Bt), Cry1Ab was present in all seven species of ground beetles examined (Agonum placidum, Bembidion rupicola, Clivina impressefrons, Cyclotrachelus iowensis, Harpalus pensylvanicus, Poecilus chalcites, and Poecilus lucublandus). For the two most abundant species, P. chalcites and P. lucublandus, the proportion of beetles with Cry1Ab was significantly higher in Bt/Bt fields (0.50-1.0) and Bt/non-Bt fields (0.41-0.50) than in non-Bt/non-Bt fields (0.0). This is the first field evidence that some ground beetle species are exposed to Cry1Ab. The implications of exposure on the performance of these non-target organisms are unclear.

Organics and mineral fertilizers and biological control on the incidence of stalk rot and corn yield

Directory of Open Access Journals (Sweden)

Elena Blume

2014-06-01

Full Text Available The expansion of area under maize (Zea mays L. and the use of no tillage have favored the incidence of stalk rot on this crop. The study aimed to evaluate the organic fertilizers and the treatment of corn seeds with Trichoderma spp. on the production of dry matter (DM of shoot, incidence of stalk rot and corn yield. The experiment consisted in a factorial with split-plot in strips, on the randomized block design with four replicates, and the fertilization treatments (pig slurry; swine deep bedding; cattle slurry; mineral fertilizer; control treatment were applied to the plots and the seeds treatment (with and without Trichoderma spp. in the subplots. At the flowering stage, three corn plants per subplot were collected for the assessment of DM production. At physiological maturity stage, the incidence of stalk rot was assessed, and the ears of corn harvested for productivity assessment. The organic and mineral fertilizers increased the production of DM and productivity of corn. Trichoderma spp. increased the production of DM of corn, but had no reflection on productivity. The incidence of stalk rot in corn was higher in treatments with organic and mineral fertilization. Organic fertilizers increase dry matter production of shoot and corn yield, and Trichoderma spp. provides an increase in dry matter production of shoot.

Prediction of County-Level Corn Yields Using an Energy-Crop Growth Index.

Science.gov (United States)

Andresen, Jeffrey A.; Dale, Robert F.; Fletcher, Jerald J.; Preckel, Paul V.

1989-01-01

Weather conditions significantly affect corn yields. while weather remains as the major uncontrolled variable in crop production, an understanding of the influence of weather on yields can aid in early and accurate assessment of the impact of weather and climate on crop yields and allow for timely agricultural extension advisories to help reduce farm management costs and improve marketing, decisions. Based on data for four representative countries in Indiana from 1960 to 1984 (excluding 1970 because of the disastrous southern corn leaf blight), a model was developed to estimate corn (Zea mays L.) yields as a function of several composite soil-crop-weather variables and a technology-trend marker, applied nitrogen fertilizer (N). The model was tested by predicting corn yields for 15 other counties. A daily energy-crop growth (ECG) variable in which different weights were used for the three crop-weather variables which make up the daily ECG-solar radiation intercepted by the canopy, a temperature function, and the ratio of actual to potential evapotranspiration-performed better than when the ECG components were weighted equally. The summation of the weighted daily ECG over a relatively short period (36 days spanning silk) was found to provide the best index for predicting county average corn yield. Numerical estimation results indicate that the ratio of actual to potential evapotranspiration (ET/PET) is much more important than the other two ECG factors in estimating county average corn yield in Indiana.

Genetic Variation and Phenotypic Response of 15 Sweet Corn (Zea mays L. Hybrids to Population Density

Directory of Open Access Journals (Sweden)

William F. Tracy

2013-06-01

Full Text Available Planting sweet corn at higher densities may increase the canopy cover, reducing light transmission to the understory and suppressing weed growth. High planting densities can also negatively impact the crop, however, by decreasing ear size and overall yield. The objective of this study was to determine the potential for increased density tolerance of 15 sweet corn hybrids by estimating the general combining ability (GCA and specific combining ability (SCA for traits of interest. In 2010 and 2011, a half-diallel of six historic sweet corn inbreds was evaluated in a split-block randomized complete block design in four Wisconsin environments, with four replicates in each environment. Hybrids were planted at a low density of 29,936 plants ha−1, a medium density of 63,615 plants ha−1, and a high density of 97,293 plants ha−1. Significant differences between hybrids were found for phenomorphological traits and ear characteristics. Inbreds C68, C40 and Ia5125 produced the progeny most tolerant of the highest population density. Among these genotypes, tolerance to high density is a heritable trait, indicating the feasibility of breeding sweet corn for density tolerance and potential weed competitiveness.

Utilization of Organic Fertilizer on Sweet Corn (Zea mays saccharata Sturt Crop at Shallow Swamp Land

Directory of Open Access Journals (Sweden)

Midranisiah

2017-01-01

Full Text Available Shallow lowland swamp area has significant potential for cultivation of sweet corn crop. This lowland swamp has rich natural resources such as organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC that are not maximally utilized yet by farmers. These organic fertilizers can be utilized to increase the growth and production of sweet corn crop. The research objective was to determine organic fertilizer types that capable to increase the growth and production of sweet corn crop at shallow lowland swamp area. This research had been conducted from January to April 2015 in Pulau Semambu Village, North Indralaya Subdistrict, Ogan Ilir District, South Sumatra Province. The design used in this research was non-factorial Randomized Block Design (RBD with four treatments of organic fertilizer types with six replications for each treatment. The treatments were consisted of organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC. The results showed that treatment of organic fertilizers from chicken dunk could increase the growth and production of sweet corn at shallow lowland swamp area with yield level of 4.37 kg.plot −1.

Soil water capture trends over 50 years of single-cross maize (Zea mays L.) breeding in the US corn-belt.

Science.gov (United States)

Reyes, Andres; Messina, Carlos D; Hammer, Graeme L; Liu, Lu; van Oosterom, Erik; Lafitte, Renee; Cooper, Mark

2015-12-01

Breeders have successfully improved maize (Zea mays L.) grain yield for the conditions of the US corn-belt over the past 80 years, with the past 50 years utilizing single-cross hybrids. Long-term improvement for grain yield under water-limited conditions has also been reported. Grain yield under water-limited conditions depends on water use, water use efficiency, and harvest index. It has been hypothesized that long-term genetic gain for yield could be due, in part, to increased water capture from the soil. This hypothesis was tested using a set of elite single-cross hybrids that were released by DuPont Pioneer between 1963 and 2009. Eighteen hybrids were grown in the field during 2010 and 2011 growing seasons at Woodland, CA, USA. Crops grew predominantly on stored soil water and drought stress increased as the season progressed. Soil water content was measured to 300cm depth throughout the growing season. Significant water extraction occurred to a depth of 240-300cm and seasonal water use was calculated from the change in soil water over this rooting zone. Grain yield increased significantly with year of commercialization, but no such trend was observed for total water extraction. Therefore, the measured genetic gain for yield for the period represented by this set of hybrids must be related to either increased efficiency of water use or increased carbon partitioning to the grain, rather than increased soil water uptake. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Uptake of Zn/sup + +/ and aflatoxin from perlite and liquid culture by Zea mays seedlings

Energy Technology Data Exchange (ETDEWEB)

Llewellyn, G C; Reynolds, J D; Hurst, L [Virginia Commonwealth Univ., Richmond (USA). Dept. of Biology; Vance, R A; Dashek, W V [West Virginia Univ., Morgantown (USA). Dept. of Biology

1982-01-01

The present paper reports our attempts to determine whether in inclusion of 0.0014 mM Zn/sup + +/ within a hydroponic culture medium affects the ability of 12-day-old Zea mays, cv. 'SS-522' to take-up (/sup 3/H)-aflatoxin B/sub 1/. Data from the corollary experiment., i.e., whether inclusion of aflatoxin affects the ability of Zea mays, cvs. 'Truckers White', 'X-Sweet' and 'Merit' to take-up /sup 65/ZnCl/sub 2/ are presented also. This report is a preliminary to one regarding an in-progress analysis of whether pollutant levels of Zn/sup + +/ affect aflatoxin uptake and distribution. In the absence of irrigating seedlings, which were grown in Perlite containing /sup 65/ZnCl/sub 2/, with a solution containing mixed aflatoxins, the stem contained the greatest amount of label with root plus seed the next highest and the leaf the least for each of the cvs. In contrast, when the seedlings were irrigated with a solution containing mixed aflatoxins, the root plus seed contained either an amount nearly identical to (cv. 'Truckers White') or in excess of that within the stem (cvs. 'X-Sweet' and 'Merit'). Calculation of the percentages of aflatoxin-induced diminutions in leaf, stem and root label suggested that the aflatoxins interfered with the translocation of /sup 65/ZnCl/sub 2/ from the root to the stem and leaf, at least for cvs 'X-Sweet' and 'Merit'.

Rapid changes in protein phosphorylation associated with gravity perception in corn roots

International Nuclear Information System (INIS)

McFadden, J.J.; Poovaiah, B.W.

1987-01-01

A previous paper from this laboratory showed calcium- and calmodulin-dependent in vivo protein phosphorylation in corn root tips. The authors show that rapid changes in calcium-dependent protein phosphorylation are involved in light-dependent graviperception in corn root tips. Corn seedlings (Zea mays L, cv Merit) were grown in the dark for 3 d, then apical root segments were harvested in dim green light to measure in vivo protein phosphorylation. Segments were incubated with 0.5 mCi 32 P for 1 h, then immediately frozen in liquid N 2 or first treated with either 7 min light, or 7 min light plus 1 mM EGTA and 10 μM A23187. Labeled proteins were separated by 2D gel electrophoresis and detected by autoradiography. Light caused rapid and specific promotion of phosphorylation of 5 polypeptides. The increases in protein phosphorylation were reversed by treating with EGTA and A23187. The authors postulate that these changes in protein phosphorylation are an essential part of the light-dependent gravity response in Merit roots

Utilization of artificial recharged effluent for irrigation: pollutants' removal and risk assessment

Directory of Open Access Journals (Sweden)

Liangliang Wei

2017-03-01

Full Text Available The reclaimed water from soil aquifer treatment (SAT column was reused for irrigation as the source water, pollutants' removal and health risk assessment was analyzed via the comparison with secondary and tertiary effluents. The effect of the SAT pre-treatment on the qualities and growth of different crops (Lachca sativa – lettuce, Brasica rapa var chinensis – pak choi, Cucumis sativus – cucumber, Brassica oleracea – cabbage, and Zea mays – maize were evaluated. Experimental results demonstrated that the tertiary and SAT treatments had no significant effect on the crop qualities, and could efficiently decrease the accumulation of heavy metals (especially for SAT pre-treatment. Moreover, the carcinogenic risk of the chemical carcinogens for the 1.5 m SAT effluent irrigation declined roughly an order of magnitude as compared with the secondary effluent, and three to four orders of magnitude decreasing of the virus risk. These findings are significant for the safe and cheap reuse of secondary effluent for irrigation purposes.

Optical Reflectance and Fluorescence for Detecting Nitrogen Needs in Zea mays L.

Science.gov (United States)

McMurtrey, J. E.; Middleton, E. M.; Corp. L. A.; Campbell, P. K. Entcheva; Butcher, L. M.; Daughtry, C. S. T.

2003-01-01

Nitrogen (N) status in field grown corn (Zea mays L.) was assessed using spectral techniques. Passive reflectance remote sensing and, both passive and active fluorescence sensing methods were investigated. Reflectance and fluorescence methods are reported to detect changes in the primary plant pigments (chlorophylls a and b; carotenoids) in higher plant species. As a general rule, foliar chlorophyll a (Chl a) and chlorophyll b (Chl b) usually exist in approx.3:l ratio. In plants under stress, Chl b content is affected before Chl a reductions occur. For reflectance, a version of the chlorophyll absorption in reflectance index (CARI) method was tested with narrow bands from the Airborne Imaging Spectroradiometer for Applications (ASIA). CARI minimizes the effects of soil background on the signal from green canopies. A modified CARI (MCARI) was used to track total Chl a levels in the red dip of the spectrum from the corn canopy. A second MCARI was used to track the auxiliary plant pigments (Chl b and the carotenoids) in the yellow/orange/red edge part of the reflectance spectrum. The difference between these two MCARI indices detected variations in N levels across the field plot canopies using ASIA data. At the leaf level, ratios of fluorescence emissions in the blue, green, red and far-red wavelengths sensed responses that were associated with the plant pigments, and were indicative of energy transfer in the photosynthetic process. N stressed corn stands could be distinguish from those with optimally applied N with fluorescence emission spectra obtained from individual corn leaves. Both reflectance and fluorescence methods are sensitive in detecting corn N needs and may be especially powerful in monitoring crop conditions if both types of information can be combined.

Water erosion and soil water infiltration in different stages of corn development and tillage systems

OpenAIRE

Daniel F. de Carvalho; Eliete N. Eduardo; Wilk S. de Almeida; Lucas A. F. Santos; Teodorico Alves Sobrinho

2015-01-01

ABSTRACTThis study evaluated soil and water losses, soil water infiltration and infiltration rate models in soil tillage systems and corn (Zea mays, L.) development stages under simulated rainfall. The treatments were: cultivation along contour lines, cultivation down the slope and exposed soil. Soil losses and infiltration in each treatment were quantified for rains applied using a portable simulator, at 0, 30, 60 and 75 days after planting. Infiltration rates were estimated using the models...

Odorous volatile organic compounds, Escherichia coli, and nutrient concentrations when kiln-dried pine chips and corn stover bedding are used in beef bedded manure packs

Science.gov (United States)

Pine (Pinus spp.) bedding has been shown to lower the concentration of odorous volatile organic compounds (VOCs) and pathogenic bacteria compared with corn (Zea mays L.) stover bedding, but availability and cost limit the use of pine bedding in cattle confinement facilities. The objectives of this s...

The effect of nitrogen rate on transgenic corn Cry3Bb1 protein expression.

Science.gov (United States)

Marquardt, Paul T; Krupke, Christian H; Camberato, James J; Johnson, William G

2014-05-01

Combining herbicide-resistant and Bacillus thuringiensis (Bt) traits in corn (Zea mays L.) hybrids may affect insect resistance management owing to volunteer corn. Some Bt toxins may be expressed at lower levels by nitrogen-deficient corn roots. Corn plants with sublethal levels of Bt expression could accelerate the evolution of Bt resistance in target insects. The present objective was to quantify the concentration of Bt (Cry3Bb1) in corn root tissue with varying tissue nitrogen concentrations. Expression of Cry3Bb1 toxin in root tissue was highly variable, but there were no differences in the overall concentration of Cry3Bb1 expressed between roots taken from Cry3Bb1-positive volunteer and hybrid corn plants. The nitrogen rate did affect Cry3Bb1 expression in the greenhouse, less nitrogen resulted in decreased Cry3Bb1 expression, yet this result was not documented in the field. A positive linear relationship of plant nitrogen status on Cry3Bb1 toxin expression was documented. Also, high variability in Cry3Bb1 expression is potentially problematic from an insect resistance management perspective. This variability could create a mosaic of toxin doses in the field, which does not fit into the high-dose refuge strategy and could alter predictions about the speed of evolution of resistance to Cry3Bb1 in western corn rootworm Diabrotica virgifera virgifera LeConte. © 2013 Society of Chemical Industry.

Assessment of plant biomass and nitrogen nutrition with plant height in early-to mid-season corn.

Science.gov (United States)

Yin, Xinhua; Hayes, Robert M; McClure, M Angela; Savoy, Hubert J

2012-10-01

The physiological basis for using non-destructive high-resolution measurements of plant height through plant height sensing to guide variable-rate nitrogen (N) applications on corn (Zea mays L.) during early (six-leaf growth stage, V6) to mid (V12) season is largely unknown. This study was conducted to assess the relationships of plant biomass and leaf N with plant height in early- to mid-season corn under six different N rate treatments. Corn plant biomass was significantly and positively related to plant height under an exponential model when both were measured at V6. This relationship explained 62-78% of the variations in corn biomass production. Leaf N concentration was, in general, significantly and positively related to plant height when both were measured at V6, V8, V10 and V12. This relationship became stronger as the growing season progressed from V6 to V12. The relationship of leaf N with plant height in early- to mid-season corn was affected by initial soil N fertility and abnormal weather conditions. The relationship of leaf N concentration with plant height may provide a physiological basis for using plant height sensing to guide variable-rate N applications on corn. Copyright © 2012 Society of Chemical Industry.

Biomass in monospecific and mixed stands of eucalyptus and black wattle and corn in an agroforestry system

Directory of Open Access Journals (Sweden)

Márcio Viera

2011-06-01

Full Text Available This study aimed at quantifying the production and distribution of aboveground biomass from the plants in monospecific and mixed stands of eucalyptus (hybrid E. urophylla x E. grandis and black wattle (Acacia mearnsii and, of corn (Zea mays in agrosilvicultural systems. The biomass evaluation (leaf, branch, bark and wood from the forest species at 6 and 18 months of age were performed at the treatments: 100E (100% of eucalyptus + corn; - 100A (100% of black wattle + corn; - 50E:50A (50% of eucalyptus + 50% of black wattle + corn. The corn biomass evaluation (stem, leaves, straw, cob and grains was performed at treatments 100E; 100A; 50E:50A; 75E:25A (75% of eucalyptus + 25% of black wattle + corn; and - 25E:75A (25% of eucalyptus + 75% of black wattle + corn. The biomass production from eucalyptus and from the black wattle, in both monospecific and mixed planting, did not differ in any of the assessed ages but, when evaluated by plants compartments, it was verified an interspecific competitive interaction from the eucalyptus on the black wattle, reducing the formation of crown biomass. The total production of corn biomass in agrosilvicutural systems with eucalyptus and with black wattle in monospecific or mixed plantings did not differ in the studied treatments.

Planting pattern and weed control method influence on yield production of corn (Zea mays L.)

Science.gov (United States)

Purba, E.; Nasution, D. P.

2018-02-01

Field experiment was carried out to evaluate the influence of planting patterns and weed control methods on the growth and yield of corn. The effect of the planting pattern and weed control method was studied in a split plot design. The main plots were that of planting pattern single row (25cm x 60cm), double row (25cm x 25cm x 60cm) and triangle row ( 25cm x 25cm x 25cm). Subplot was that of weed control method consisted five methods namely weed free throughout the growing season, hand weeding, sprayed with glyphosate, sprayed with paraquat, and no weeding.. Result showed that both planting pattern and weed control method did not affect the growth of corn. However, planting pattern and weed control method significantly affected yield production. Yield resulted from double row and triangle planting pattern was 14% and 41% higher, consecutively, than that of single row pattern. The triangle planting pattern combined with any weed control method produced the highest yield production of corn.

Recent changes in county-level corn yield variability in the United States from observations and crop models

Energy Technology Data Exchange (ETDEWEB)

Leng, Guoyong

2017-12-01

The United States is responsible for 35% and 60% of global corn supply and exports. Enhanced supply stability through a reduction in the year-to-year variability of US corn yield would greatly benefit global food security. Important in this regard is to understand how corn yield variability has evolved geographically in the history and how it relates to climatic and non-climatic factors. Results showed that year-to-year variation of US corn yield has decreased significantly during 1980-2010, mainly in Midwest Corn Belt, Nebraska and western arid regions. Despite the country-scale decreasing variability, corn yield variability exhibited an increasing trend in South Dakota, Texas and Southeast growing regions, indicating the importance of considering spatial scales in estimating yield variability. The observed pattern is partly reproduced by process-based crop models, simulating larger areas experiencing increasing variability and underestimating the magnitude of decreasing variability. And 3 out of 11 models even produced a differing sign of change from observations. Hence, statistical model which produces closer agreement with observations is used to explore the contribution of climatic and non-climatic factors to the changes in yield variability. It is found that climate variability dominate the change trends of corn yield variability in the Midwest Corn Belt, while the ability of climate variability in controlling yield variability is low in southeastern and western arid regions. Irrigation has largely reduced the corn yield variability in regions (e.g. Nebraska) where separate estimates of irrigated and rain-fed corn yield exist, demonstrating the importance of non-climatic factors in governing the changes in corn yield variability. The results highlight the distinct spatial patterns of corn yield variability change as well as its influencing factors at the county scale. I also caution the use of process-based crop models, which have substantially underestimated

RELATIONSHIP BETWEEN EUROPEAN CORN BORER FEEDING ACTIVITY AND NITROGEN LEAF CONTENT UNDER DIFFERENT AGRICULTURAL PRACTICES

Directory of Open Access Journals (Sweden)

Ankica Sarajlić

2015-06-01

Full Text Available One of the most destructive maize pest in Croatia is European corn borer (Ostrinia nubilalis Hübner (ECB. The aim of this study was to determine the influence of irrigation, nitrogen fertilization, different maize genotypes and nitrogen leaf content on ECB feeding activity. The experiment was set up in Osijek, Croatia under field conditions during 2012-2013 vegetation season. Experiment treatments were as follows: three irrigation levels (A1 - control, A2 from 60% to 80% field water capacity - FWC and A3 from 80% to100% FWC, three nitrogen fertilizer levels (B1 - 0, B2 - 100 and B3 - 200 kg N/ha and four different genotypes (C1 - OSSK 596; C2 - OSSK 617; C3 - OSSK 602 and C4 - OSSK 552. Ear weight, number of larvae in stem and shank, tunnel length and nitrogen leaf content were evaluated. Genotype C1 was the most susceptible for following the tested variables of ECB feeding: tunnel length (TL, larvae in stalk (LS and total number of larvae (TNL at P<0.05 probability level. By raising the level of irrigation, European corn borer feeding activity was reduced while by raising the level of nitrogen fertilization feeding activity was increased. These results suggest that good production practices can significantly affect the susceptibility of maize to European corn borer.

Evaluation of Spring Sweet Corn (Zea mays var saccharata Production in Different Planting Date under Plastic Cover in Gachsaran Province

Directory of Open Access Journals (Sweden)

H. Naraki,

2012-08-01

Full Text Available In order to evaluate the performance of spring sweet corn (Zea mays var saccharata at different planting dates under plastic cover, a split plot experiment based on RCBD with three replications was conducted in Gachsaran, in southwest of Iran, during 2009-2010 growing season. Four sweet corn hybrids (Merit, Challenger, Chase and Basin were used as main factor and five sowing date (15th and 25th Jan, 4th, 14th and 24th Feb as sub factor. The results showed that hybrid effect was significant on the days to tassel and ear emergence, days to harvest, ear harvest index, ear length, number of row per each ear, wet biological yield and 1000 grains weight, at 1%, and ear wet yield and grain yield harvest index at 5% probability levels. Also the effect of sowing date was significant on the days to tassel and ear emergence, days to harvest, ear wet yield, ear harvest index, ear diameter, ear length, biological yield, and 1000 grains weight at the 1% probability level. 'Basin' and 'Chase' hybrids were determined to have highest and lowest ear wet yield (17.09 and 15.13 t.ha-1 respectively. The highest and the lowest wet ear yield (16.81 and 15.06 t.ha-1 belonged to 15th Jan. and 24th Feb. respectively. 'Basin' hybrid and 'Challenger' with 8.39 and 7.59 t.ha-1 grain yield were found to be highest and lowest yields. The highest and the lowest grain yield (8.41 t.ha-1 7.45 t.ha-1 were recorded for 15th Jan. and 24th Feb. respectively.' Merit' and 'Chase' hybrids were determined to have longest and shortest days to ear harvest (94.3 and 86.2 days. Longest and shortest days to ear harvest (101.5 and 82 days were recorded in 4th Jan. and 24th Feb. Sowing date and hybrids interaction effects showed that the longest and shortest days to ear harvest (104.7 and 78.3 days were calculated in 4th Jan. of Merit and in 24th Feb. for Chase. Based on these results, it can be concluded that 'Basin' hybrid Feb. 24 is the most suitable cultivar to be produced in Gachsaran.

Production, carbon and nitrogen in stover fractions of corn (Zea mays L.) in response to cultivar development

Science.gov (United States)

The contribution of genetic selection of corn to quantity and quality of stover is still poor-known. The aim of the study was to evaluate production, C and N in fractions of corn stover in response to the cultivar development. Two field experiments were conducted in the city of Rolândia (Paraná - Br...

Corn-Soybean Rotation Systems in the Mississippi Delta: Implications on Mycotoxin Contamination and Soil Populations of Aspergillus flavus

Directory of Open Access Journals (Sweden)

Hamed K. Abbas

2012-01-01

Full Text Available The effect of corn-soybean rotation on mycotoxin contamination in corn (Zea mays L. and soybean (Glycine max L. Merrill. grains has not been fully evaluated. Therefore, this research investigated the effect of corn-soybean rotation on aflatoxin and fumonisin contamination in respective grains. The results showed that aflatoxin levels in soybean averaged 2.3, <0.5, 0.6, and 6.8 ng/g in 2005, 2006, 2007, and 2008, while corn aflatoxin levels were 16.7, 37.1, 2.4, and 54.8 ng/g, respectively. Aspergillus flavus colonization was significantly greater (P≤0.05 in corn (log 1.9, 2.9, and 4.0 cfu/g compared to soybean (<1.3, 2.6, and 2.7 cfu/g in 2005, 2007, and 2008, respectively. Aflatoxigenic A. flavus isolates were more frequent in corn than in soybean in all four years. Higher fumonisin levels were found in corn (0.2 to 3.6 μg/g than in soybean (<0.2 μg/g. Rotating soybean with corn reduces the potential for aflatoxin contamination in corn by reducing A. flavus propagules in soil and grain and reducing aflatoxigenic A. flavus colonization. These results demonstrated that soybean grain is less susceptible to aflatoxin contamination compared to corn due to a lower level of colonization by A. flavus with a greater occurrence of non-aflatoxigenic isolates.

Carbon dynamics in corn-soybean sequences as estimated from natural carbon-13 abundance

International Nuclear Information System (INIS)

Huggins, D.R.; Clapp, C.E.; Allmaras, R.R.; Lamb, J.A.; Layese, M.F.

1998-01-01

Carbon flow in terrestrial ecosystems regulates partitioning between soil organic C (SOC) and atmospheric CO2. Our objectives were to assess SOC dynamics using natural 13C abundance in corn (Zea mays L., a C4 species)-soybean [Glycine max (L.) Merr., a C3 species] sequences. Fifteen treatments of continuous corn, continuous soybean, various sequences of corn and soybean, and fallow were initiated in 1981 at Lamberton, MN, on a Webster clay loam (fine-loamy, mixed, mesic Typic Haplaquoll). In 1991, soil and aboveground shoot samples from all treatments were analyzed for total organic C and delta 13C. Carbon inputs, delta 13C, and SOC were integrated into a two-pool model to evaluate C dynamics of corn and soybean. Total SOC was similar across all treatments after 10 yr; however, differences in soil delta 13C occurred between continuous corn (delta 13C = -17.2 per thous and) and continuous soybean (delta 13C = -18.2 per thousand). Modeled C dynamics showed SOC decay rates of 0.011 yr-1 for C4-derived C and 0.007 yr-1 for C3-derived C, and humification rates of 0.16 yr-1 for corn and 0.11 yr-1 for soybean. Decay and humification rates were slightly lower than those found in other Corn Belt studies. Levels of SOC were predicted to decline an additional 7 to 18% with current C inputs from either corn or soybean, respectively. Annual C additions required for SOC maintenance averaged 5.6 Mg C ha-1, 1.4 to 2.1 times greater than previously reported estimates. Controlled variation in natural 13C abundance in corn-soybean rotations during a 10-yr period adequately traced C dynamics

Chemical constituents and free radical scavenging activity of corn pollen collected from Apis mellifera hives compared to floral corn pollen at Nan, Thailand

Directory of Open Access Journals (Sweden)

Chantarudee Atip

2012-04-01

Full Text Available Abstract Background Bee pollen is composed of floral pollen mixed with nectar and bee secretion that is collected by foraging honey (Apis sp. and stingless bees. It is rich in nutrients, such as sugars, proteins, lipids, vitamins and flavonoids, and has been ascribed antiproliferative, anti-allergenic, anti-angiogenic and free radical scavenging activities. This research aimed at a preliminary investigation of the chemical constituents and free radical scavenging activity in A. mellifera bee pollen. Methods Bee pollen was directly collected from A. mellifera colonies in Nan province, Thailand, in June, 2010, whilst floral corn (Zea mays L. pollen was collected from the nearby corn fields. The pollen was then sequentially extracted with methanol, dichloromethane (DCM and hexane, and each crude extract was tested for free radical scavenging activity using the DPPH assay, evaluating the percentage scavenging activity and the effective concentration at 50% (EC50. The most active crude fraction from the bee pollen was then further enriched for bioactive components by silica gel 60 quick and adsorption or Sephadex LH-20 size exclusion chromatography. The purity of all fractions in each step was observed by thin layer chromatography and the bioactivity assessed by the DPPH assay. The chemical structures of the most active fractions were analyzed by nuclear magnetic resonance. Results The crude DCM extract of both the bee corn pollen and floral corn pollen provided the highest active free radical scavenging activity of the three solvent extracts, but it was significantly (over 28-fold higher in the bee corn pollen (EC50 = 7.42 ± 0.12 μg/ml, than the floral corn pollen (EC50 = 212 ± 13.6% μg/ml. After fractionation to homogeneity, the phenolic hydroquinone and the flavone 7-O-R-apigenin were found as the minor and major bioactive compounds, respectively. Bee corn pollen contained a reasonably diverse array of nutritional components, including

Production Systems and Potential Development of Corn in West Pasaman Districts

Directory of Open Access Journals (Sweden)

Yulmar Jastra

2015-09-01

Full Text Available Maize (Zea mays L. is the second national food crop after rice and its role is increasing in line increase of population, livestock operations, and development of raw material corn processing industry. This research is a descriptive qualitative and quantitative as well as done in stages, namely: pre -study in order neighbor information gathering and general condition of farmers in the districts of West Pasaman, intensive desk study on the extent of data and the development of hybrid corn and all information obtained from pre -study activities; observation, field survey. This study aims to: identify systems of maize production in West Pasaman, identify potential areas of development and analysis of maize farming, Prepare Corn Development Action Programme in West Pasaman. Age maize farmers in West Pasaman between 40-60 years old, with old school for 9 years and the number of family members of farmers 5. The highest maize production in West Pasaman district occurred in 2009 amounted to 364 287 tonnes with 44 793 ha of harvested area and productivity of 6.99 tonnes/ha, in 2010, a decline in production to 220 761 tonnes with a productivity of 6.3 tons /ha due to a decline in harvested area into 33 757 ha. And in 2011 the production of corn production back to normal by 286 078 tons / year with 44 360 ha of harvested area and productivity of 6.50 tonnes/ha. Potential land that can be used to achieve the 142 850 ha of maize farming dominated peat and mineral soil of each area of 7,550 ha and 16,550 ha. Of corn farming can provide a gain of Rp 8,860,000,-/ha . When the period of 4 months of the corn crop corn farmer income per month is Rp 2.215.000,-

Radio-induced inherited sterility in Heliothis zea (Boddie)

International Nuclear Information System (INIS)

Carpenter, J.E.

1985-01-01

Heliothis zea (Boddie) (Lepidoptera: Noctuidae) males and females were irradiated with substerilizing doses of radiation. These moths were inbred and outcrossed and observed for their ability to reproduce. The inherited deleterious effects resulting from the irradiated P 1 males were recorded for several generations. Larvae from both irradiated (10 krad) and normal parents were compared for their ability to survive under field conditions on whole-stage sweet corn and these results were compared with those from a laboratory study using meridic diet. Irradiated males and females and F 1 males from an irradiated (10 krad) male x normal female cross were released in the field and in field cages and observed for their ability to search/attract and secure a mate. Females that had mated with normal and irradiated (10 krad) males were studied to determine the effect of different mating histories on the subsequent mating propensity of the females. A 10-krad dose of radiation induced deleterious effects which were inherited through the F 2 generation. These radiation-induced deleterious effects were similar to those reported in other species of Lepidoptera. The relationship between the survival of normal larvae and larvae from irradiated parents was similar under laboratory and field rearing conditions. Females mated to normal males and males irradiated with 10 krad had the same mating propensity and experienced the same intermating interval. These effects of substerilizing doses of radiation and inherited sterility on the reproductive ability and behavior of H. zea suggest that a great potential exists for population suppression

Growth, 14C-sucrose uptake, and metabolites of starch synthesis in apical and basal kernels of corn (Zea mays L.)

International Nuclear Information System (INIS)

Greenberg, J.M.

1985-01-01

Developing field-grown kernels of corn (Zea mays L. cv. Cornell 175) from the base and apex of the ear were sampled from seven to 70 days after pollination (DAP) an compared with respect to dry weight, ability to take up 14 C-sucrose from solution in vitro, and content of sucrose, glucose, starch, glucose-1-P (G1P), glucose-6-P (G6P), fructose-6-P (F6P), ADP-glucose (ADPG), and UDP-glucose (UDPG). ADPG and UDPG were analyzed by HPLC. All other metabolites were analyzed enzymatically. Simultaneous hand-pollination of all ovaries in an ear did not reduce the difference between apical and basal kernels in dry weight, indicating that the latter fertilization of apical kernels was not responsible for their lesser mature dry weight. Detached kernels took up 14 C-sucrose (0.3-400 mM) and glucose (5-100 mM) at rates linearly proportional to the sugar concentration. Glucose, fructose, and sorbitol did not inhibit uptake of 14 C-sucrose. Uptake was not stimulated by 5 mM CaCl 2 or the addition of buffers (pH 4.5-6.7) to the medium. Sulfhydryl reagents (PCMBS, NEM) and metabolic inhibitors (TNBS, DNP, NaF) did not reduce uptake. These observations suggest that sucrose is taken up by a non-saturable, non-energy-requiring mechanism. Sucrose uptake increased throughout development, especially at the stage when basal kernels began to accumulate more dry weight than apical kernels (10-20 DAP in freely pollinated ears; 25 DAP in synchronously pollinated ears). Hydrolysis of incorporated sucrose increased from 87% at 14 DAP to 99% by 57 DAP

Sublethal effects of Cry 1F Bt corn and clothianidin on black cutworm (Lepidoptera: Noctuidae) larval development.

Science.gov (United States)

Kullik, Sigrun A; Sears, Mark K; Schaafsma, Arthur W

2011-04-01

Black cutworm, Agrotis ipsilon (Hufnagel) (Lepidoptera: Noctuidae), is an occasional pest of maize (corn), Zea mays L., that may cause severe stand losses and injury to corn seedlings. The efficacy of the neonicotinoid seed treatment clothianidin at two commercially available rates and their interaction with a transgenic corn hybrid (Bt corn), trait expressing the Bacillus thuringiensis variety aizawai insecticidal toxin Cry 1Fa2, against black cutworm larvae was investigated. Clothianidin at a rate of 25 mg kernel(-1) on Bt corn increased larval mortality and reduced larval weight gains additively. In contrast, weights of larvae fed non-Bt corn seedlings treated with clothianidin at a rate of 25 mg kernel(-1) increased significantly, suggesting either compensatory overconsumption, hormesis, or hormoligosis. Both Bt corn alone and clothianidin at a rate of 125 mg kernel(-1) applied to non-Bt corn seedlings caused increased mortality and reduced larval weight gains. In two field trials, plots planted with Bt corn hybrids consistently had the highest plant populations and yields, regardless of whether they were treated with clothianidin at the lower commercial rate of 25 mg kernel(-1) The use of Bt corn alone or in combination with the low rate of clothianidin (25 mg kernel(-1)) seems suitable as a means of suppressing black cutworm in no-tillage cornfields, although rescue treatments may still be necessary under severe infestations. Clothianidin alone at the low rate of 25 mg kernel(-1) is not recommended for black cutworm control until further studies of its effects on larval physiology and field performance have been completed.

Corn yield for silage and grains in different integrated crop-livestock systems

Directory of Open Access Journals (Sweden)

Laíse da Silveira Pontes

Full Text Available Abstract In this study, the objective was to assess the influence of two doses of N (90 and 180 kg N ha-1, added to the winter pastures, two integrated crop-livestock systems (ICLS, with and without trees and five positions between the tree rows, on the corn (Zea mays L. quality and productivity, for silage and grain. Adopting the complete randomized block design, the treatments included three replicates. In 2006, following the 14 x 3 m spacing (currently with 158 trees ha-1 the trees were planted in 6 out of the 12 paddocks. While the corn was implemented during summer of 2013/2014, cattle grazing on the annual pasture was done during the prior winter, in both ICLS. Corn for silage was reaped at the R5 phenological stage, whereas for grains it was done at 176 days post seeding. For silage, the corn plants were grinded and then stocked in the experimental mini PVC silos. The silage varied slightly in quality along the positions between the tree rows. The differences observed between N levels in the dry matter, crude protein (CP and grain productivity are expressions of the residual effects of the winter fertilization. Silage quality was improved by the shade effect which minimized the acid detergent fiber and raised the CP, although it reduced the corn production for silage and grains by 52%. Some feasible techniques to reduce these losses are discussed.

Evaluating gridded crop model simulations of evapotranspiration and irrigation using survey and remotely sensed data

Science.gov (United States)

Lopez Bobeda, J. R.

2017-12-01

The increasing use of groundwater for irrigation of crops has exacerbated groundwater sustainability issues faced by water limited regions. Gridded, process-based crop models have the potential to help farmers and policymakers asses the effects water shortages on yield and devise new strategies for sustainable water use. Gridded crop models are typically calibrated and evaluated using county-level survey data of yield, planting dates, and maturity dates. However, little is known about the ability of these models to reproduce observed crop evapotranspiration and water use at regional scales. The aim of this work is to evaluate a gridded version of the Decision Support System for Agrotechnology Transfer (DSSAT) crop model over the continental United States. We evaluated crop seasonal evapotranspiration over 5 arc-minute grids, and irrigation water use at the county level. Evapotranspiration was assessed only for rainfed agriculture to test the model evapotranspiration equations separate from the irrigation algorithm. Model evapotranspiration was evaluated against the Atmospheric Land Exchange Inverse (ALEXI) modeling product. Using a combination of the USDA crop land data layer (CDL) and the USGS Moderate Resolution Imaging Spectroradiometer Irrigated Agriculture Dataset for the United States (MIrAD-US), we selected only grids with more than 60% of their area planted with the simulated crops (corn, cotton, and soybean), and less than 20% of their area irrigated. Irrigation water use was compared against the USGS county level irrigated agriculture water use survey data. Simulated gridded data were aggregated to county level using USDA CDL and USGS MIrAD-US. Only counties where 70% or more of the irrigated land was corn, cotton, or soybean were selected for the evaluation. Our results suggest that gridded crop models can reasonably reproduce crop evapotranspiration at the country scale (RRMSE = 10%).

Effect of plant density and mixing ratio on crop yield in sweet corn/mungbean intercropping.

Science.gov (United States)

Sarlak, S; Aghaalikhani, M; Zand, B

2008-09-01

In order to evaluate the ear and forage yield of sweet corn (Zea mays L. var. Saccarata) in pure stand and intercropped with mung bean (Vigna radiata L.), a field experiment was conducted at Varamin region on summer 2006. Experiment was carried out in a split plot design based on randomized complete blocks with 4 replications. Plant density with 3 levels [Low (D1), Mean (D2) and High (D3) respecting 6, 8 and 10 m(-2) for sweet corn, cultivar S.C.403 and 10, 20 and 30 m(-2) for mung bean cultivar, Partow] was arranged in main plots and 5 mixing ratios [(P1) = 0/100, (P2) = 25/75, (P3) = 50/50, (P4) = 75/25, (P5) = 100/0% for sweet corn/mung bean, respectively] were arranged in subplots. Quantitative attributes such as plant height, sucker numbers, LER, dry matter distribution in different plant organs were measured in sweet corn economical maturity. Furthermore the yield of cannable ear corn and yield components of sweet corn and mung bean were investigated. Results showed that plant density has not any significant effect on evaluated traits, while the effect of mixing ratio was significant (p ratio of 75/25 (sweet corn/mung bean) could be introduced as the superior mixing ratio; because of it's maximum rate of total sweet corn's biomass, forage yield, yield and yield components of ear corn in intercropping. Regarding to profitability indices of intercropping, the mixing ratio 75/25 (sweet corn/mung bean) in low density (D1P2) which showed the LER = 1.03 and 1.09 for total crop yield before ear harvesting and total forage yield after ear harvest respectively, was better than corn or mung bean monoculture.

Net ecosystem exchange of CO2 and H2O fluxes from irrigated grain sorghum and maize in the Texas High Plains

Science.gov (United States)

Net ecosystem exchange (NEE) of carbon dioxide (CO2) and water vapor (H2O) fluxes from irrigated grain sorghum (Sorghum bicolor L. Moench) and maize (Zea mays L.) fields in the Texas High Plains were quantified using the eddy covariance (EC) technique during 2014-2016 growing seasons and examined in...

Evaluation of the Increased Rates of Water Super Absorbent and Humic Acid Application under Deficit Irrigation Condition on Some Agroecological Characteristics of Zea Mays Using Response Surface Methodology

Directory of Open Access Journals (Sweden)

M Jahan

2017-03-01

. Despite of many researches on the effect of water super absorbent, humic acid and irrigation on different crops, information on simultaneous optimization of these factors for many crops is scarce, therefore, in this study optimum levels of water super absorbent, humic acid and irrigation in maize were determine. Materials and Methods In order to estimate the optimized application rates of water superabsorbent, humic acid and irrigation in cultivation of maize (Zea mays L., an experiment as Box-Behnken design using Response Surface Methodology, was conducted at Research Farm of Ferdowsi University of Mashhad, during 2013-14 growing season. The experimental treatments were designed considering of the high and the low levels of water superabsorbent (80 and 160 kg ha-1, humic acid (4 and 8 kg ha-1 and irrigation (200 and 400 m3 ha-1 in each irrigation using Minitab 17 statistical software, as the central point in every treatment replicated 3 times, so 15 treatment combinations were provided totally. Results and Discussion The results showed that linear effects of humic acid and irrigation and quadratic effects of superabsorbent and irrigation were significant on seed yield, as the highest grain yield obtained in treatments of 120 kg ha-1 super absorbent, 8 kg ha-1 humic acid and 300 m3 ha-1 irrigation. The middle level of humic acid (6 kg ha-1 led to the highest dry matter yield and increase of humic acid from 4 to 8 kg ha-1 improved grain protein by 7%. In economic scenario, using 126.06 kg ha-1 superabsorbent, 7.19 kg ha-1 humic acid and 347.47 m3 ha-1 irrigation, resulted in 26710 kg ha-1 grain yield. In eco-environmental scenario, using 123.63 kg ha-1 superabsorbent, 7.19 kg ha-1 humic acid and 323.23 m3 ha-1 irrigation, resulted in the highest grain yield (26309 kg ha-1 and the highest water use efficiency (5.23. It seems that application of 120 kg ha-1 water super absorbent increased grain yield by improving soil physical properties. Jahan et al., (2011 reported that

Variations in fuel characteristics of corn (Zea mays) stovers: General spatial patterns and relationships to soil properties

Energy Technology Data Exchange (ETDEWEB)

Xiong, Shaojun [Unit of Biomass Technology and Chemistry, Swedish University of Agricultural Sciences, SE-901 83 Umeaa (Sweden); College of Life Science, Beijing Normal University, Beijing (China); Zhang, Yufen [College of Life Science, Beijing Normal University, Beijing (China); Zhuo, Yue [Biomass Engineering Centre, China Agricultural University, Beijing (China); Lestander, Torbjoern; Geladi, Paul [Unit of Biomass Technology and Chemistry, Swedish University of Agricultural Sciences, SE-901 83 Umeaa (Sweden)

2010-06-15

The geographic variations in corn stover fuel and soil characteristics from 22 sites in the Kerchin region (43.8-45.0 N, 122.7-125.1 E), north-east China, were examined in both 2006 and 2007. The correlations between fuel characteristics and soil parameters were analysed using principal component analysis (PCA) and partial least squares regression (PLS). The main emphasis was on the feasibility of using corn stovers as feedstock in direct combustion for heat and power generation. The examined corn stovers from Kerchin generally have similar characteristics to energy grasses grown in Europe and may be used as biofuels. However, large variations, up to several orders of magnitude, in the fuel characteristics existed among the samples. With PCA, the studied soils showed a clear distinction between soluble and less soluble elements, with a trend for higher insoluble element (such as Si) concentrations in south-western soils and a higher pH in the more northern soils. The component for fuel characteristics showed a distinct trend with latitude that can be explained by the above-mentioned soil component pattern. PLS regression models suggested some important relationships that may be used to predict corn stover fuel characteristics using soil and environment properties; for example, latitude, soil pH and Si are the most important predictors for Ca content in corn stovers, but not for K that is best predicted by soil K. Although limited by numbers of samples and sites, this study indicated that this approach can be used to predict biofuel quality. (author)

Degradation of some representative polycyclic aromatic hydrocarbons by the water-soluble protein extracts from Zea mays L. cv PR32-B10.

Science.gov (United States)

Barone, Roberto; de Biasi, Margherita-Gabriella; Piccialli, Vincenzo; de Napoli, Lorenzo; Oliviero, Giorgia; Borbone, Nicola; Piccialli, Gennaro

2016-10-01

The ability of the water-soluble protein extracts from Zea mais L. cv. PR32-B10 to degrade some representative polycyclic aromatic hydrocarbons (PAHs), has been evaluated. Surface sterilized seeds of corn (Zea mais L. Pioneer cv. PR32-B10) were hydroponically cultivated in a growth chamber under no-stressful conditions. The water-soluble protein extracts isolated from maize tissues showed peroxidase, polyphenol oxidase and catalase activities. Incubation of the extracts with naphthalene, fluorene, phenanthrene and pyrene, led to formation of oxidized and/or degradation products. GC-MS and TLC monitoring of the processes showed that naphthalene, phenanthrene, fluorene and pyrene underwent 100%, 78%, 92% and 65% oxidative degradation, respectively, after 120 min. The chemical structure of the degradation products were determined by (1)H NMR and ESI-MS spectrometry. Copyright © 2016 Elsevier Ltd. All rights reserved.

NUTRIENTS POOL IN CONSORTIA OF Eucalyptus urograndis, Acacia mearnsii AND Zea mays

Directory of Open Access Journals (Sweden)

Márcio Viera

2013-08-01

Full Text Available http://dx.doi.org/10.5902/1980509810543This study aimed to determine the nutrient pool in monospecific and mixed stands of Eucalyptus urograndis and Acacia mearnsii in a consortium with Zea mays.The amount determination of nutrients of forest species was carried out in the treatments: 100E (100% of eucalyptus; 100A (100% of black wattle and 50E:50A (50% of eucalyptus + 50% of black-wattle. On the other hand, for corn, it was carried out in all treatments (100E; 100A, 50E:50A; 75E:25A – 75% of eucalyptus + 25% black-wattle and 25E:75A – 25% of eucalyptus + 75% of black wattle. The delimitation adopted was the one of a randomized block with three replications. The magnitude of the nutrient pool in the agrossilvicultural systems biomass was: N> K > Ca > Mg > P > S, for macronutrients, and Mn > Fe > Zn > B > Cu, for micronutrients. Due to the great export of nutrients through the corn harvest, residues should be kept and it is necessary to make a nutritional reposition, mainly with P, N, K, S and Zn in the following crops, because of the higher amount that are exported with the extraction of the corn tang, which reaches 75.3; 60.6; 59.9; 55.8 e 53.8%, respectively, in relation to the total stocked in the biomass.

Baby corn, green corn, and dry corn yield of corn cultivars

OpenAIRE

Castro,Renato S; Silva,Paulo Sérgio L; Cardoso,Milton J

2013-01-01

In corn, when the first female inflorescence is removed, the plant often produces new female inflorescences. This allows the first ear to be harvested as baby corn (BC) and the second as green corn (GC) or dry corn (DC), that is, mature corn. The flexibility provided by a variety of harvested products allows the grower to compete with better conditions in the markets. We evaluated BC, GC, and DC yields in corn cultivars AG 1051, AG 2060, and BRS 2020, after the first ear was harvested as BC. ...

Electrical conductivity testing of corn seeds as influenced by temperature and period of storage

OpenAIRE

Fessel,Simone Aparecida; Vieira,Roberval Daiton; Cruz,Mara Cristina Pessoa da; Paula,Rinaldo Cesar de; Panobianco,Maristela

2006-01-01

The objective of this work was to evaluate the effects of temperature (10, 20, 30, 20/10 and 30/10ºC) and period of storage on electrical conductivity (EC) in four seed lots of corn (Zea mays L.), as well as the mineral composition of the soaking solution. EC test determines indirectly the integrity of seed membrane systems, and is used for the assessment of seed vigor, because this test detects the seed deterioration process since its early phase. The research comprised determinations o...

Mercury in some chemical fertilizers and the effect of calcium superphosphate on mercury uptake by corn seedlings (Zea mays L.).

Science.gov (United States)

Zhao, Xiulan; Wang, Dingyong

2010-01-01

Mercury (Hg) contents in ten chemical fertilizers were determined, and the effect of calcium superphosphate (CSP) on the uptake and translocation of Hg in corn seedlings was investigated by pot experiments. CSP was applied at the levels of 0, 66.7, and 133.4 mg P2O5/kg to Hg-treated (2 mg/kg) and untreated soils. CSP had the highest Hg content (5.1 mg/kg), followed by the NPK compound fertilizer 15-5-5 (15% N, 5% P2O5, 5% K2O) (1.2 mg/kg), then by nitrogen fertilizers (except for ammonia sulfate) and potassium fertilizers. Application of CSP did not obviously influence the biomass of corn roots, but it significantly increased the biomass of corn shoots in Hg-treated soil. Application of CSP at the levels of 66.7 and 133.4 mg P2O5/kg did not obviously influence the uptake of Hg by corn seedlings on soils without Hg treatment, but it decreased the Hg uptake of corn seedlings significantly on Hg-treated soils. The transfer coefficient of Hg in corn seedlings improved slightly on soils without Hg treatment, but decreased slightly on Hg-treated soils with the application of CSP. These results implied that CSP could ameliorate Hg toxicity to corn seedlings by inhibiting the uptake and the translocation of Hg in plants on Hg-polluted soils.

Pengaruh Jenis Dan Waktu Pemberian Bokashi Terhadap Pertumbuhan Dan Hasil Tanaman Jagung Manis (Zea Mays L. Saccharata Sturt) Varietas Super Sweet

OpenAIRE

Setiani, Wike

2014-01-01

Effect of Type and Bokashi Application Time on the Growth and Yield of Sweet Corn (Zea mays L. saccharata Sturt), Super Sweet variety. Objectives of the research were to know the effect of Bokashi types and application time as well as their interactions on the growth and yield of sweet maize. The research lasted for about four months, started from February 2013 to May 2013, carried out in Dempar Village, Nyuatan Sub-District of West Kutai District, East Kalimantan Province. The research em...

Callose deposition during gravitropism of Zea mays and Pisum sativum and its inhibition by 2-deoxy-D-glucose

Science.gov (United States)

Jaffe, M. J.; Leopold, A. C.

1984-01-01

In etiolated corn (Zea mays L.) and etiolated pea (Pisum sativum L.) seedlings, a gravitropic stimulation induces the deposition of callose. In the corn coleoptiles this occurs within 5 min of gravity stimulation, and prior to the beginning of curvature. Both gravitropic curvature and callose deposition reach their maxima by 12 h. Within the first 2 h more callose is deposited on the upper (concave) side, but after 2-3 h, this deposition pattern is reversed. An inhibitor of protein glycosylation, 2-deoxy-D-glucose (DDG), inhibits callose production and considerably retards gravitropic bending in both species of plants. Mannose can relieve the inhibition of gravitropic bending by DDG. The pea mutant "Ageotropum", which does not respond to gravity when etiolated, also fails to produce callose in response to a gravitic stimulus. These correlations indicate that callose deposition may be a biochemical component of gravitropism in plant shoots.

Nitrogen source effects on soil nitrous oxide emissions from strip-till corn.

Science.gov (United States)

Halvorson, Ardell D; Del Grosso, Stephen J; Jantalia, Claudia Pozzi

2011-01-01

Nitrogen (N) application to crops generally results in increased nitrous oxide (NO) emissions. Commercially available, enhanced-efficiency N fertilizers were evaluated for their potential to reduce NO emissions from a clay loam soil compared with conventionally used granular urea and urea-ammonium nitrate (UAN) fertilizers in an irrigated strip-till (ST) corn ( L.) production system. Enhanced-efficiency N fertilizers evaluated were a controlled-release, polymer-coated urea (ESN), stabilized urea, and UAN products containing nitrification and urease inhibitors (SuperU and UAN+AgrotainPlus), and UAN containing a slow-release N source (Nfusion). Each N source was surface-band applied (202 kg N ha) at corn emergence and watered into the soil the next day. A subsurface-band ESN treatment was included. Nitrous oxide fluxes were measured during two growing seasons using static, vented chambers and a gas chromatograph analyzer. All N sources had significantly lower growing season NO emissions than granular urea, with UAN+AgrotainPlus and UAN+Nfusion having lower emissions than UAN. Similar trends were observed when expressing NO emissions on a grain yield and N uptake basis. Loss of NO-N per kilogram of N applied was <0.8% for all N sources. Corn grain yields were not different among N sources but greater than treatments with no N applied. Selection of N fertilizer source can be a mitigation practice for reducing NO emissions in strip-till, irrigated corn in semiarid areas. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Wastewater from monosodium glutamate industry as a low cost fertilizer source for corn (Zea mays L.)

International Nuclear Information System (INIS)

Singh, Satnam; Rekha, P.D.; Arun, A.B.; Huang, Y.-M.; Shen, F.-T.; Young, Chiu-Chung

2011-01-01

Nitrogen rich wastewater from monosodium glutamate industry (MSG) and paper-mill wastewater were used in this study as low cost fertilizers for growing corn, a common fuel crop. Detailed characterization of the wastewaters and toxicity testes were conducted to assure the safety of these wastewaters. In a greenhouse pot experiment, effects of these wastewaters on corn growth and biomass yield along with the soil properties were evaluated. MSG-wastewater was applied at three rates i.e., zero, 5 m 3 ha -1 and 7.5 m 3 ha -1 and paper-mill wastewater was applied at and zero, 3.5 m 3 ha -1 and 5 m 3 ha -1 in a complete randomized blocks design experiment. Significant increase in the corn biomass yield was observed in all the wastewater treatments compared to the Control. Both these wastewaters did not show any adverse effects on plant. N-use efficiency from the MSG-wastewater was comparable to urea-N application. This study emphasizes on sustainable practices for energy crop production by utilizing wastewaters as fertilizer sources. Hence, we report for the first time that the MSG-wastewater can be used for growing corn as a low cost green practice without adverse affects on the soil properties. -- Highlights: → MSG-wastewater acidity neutralization with highly alkaline paper-mill effluent is sustainable practice. → Growing fuel crops using wastewaters comprises multiple benefits on plant, soil, and environment. → Organic rich wastewaters improve SOC. → Co-application of MSG and paper-mill wastewaters stimulates humification.

Climatic warming and potential demands for irrigation water in southwest Ontario

International Nuclear Information System (INIS)

Brklacich, M.

1990-01-01

The potential impacts of global warming on demand for irrigation water in southwestern Ontario are discussed. The climatic change scenarios considered derive from the Goddard Institute for Space Studies (GISS) general circulation model, which suggests that the frost-free season in southwestern Ontario will be extended from the current 166 days to 223 days under a doubling of atmospheric carbon dioxide. The 1.76 million ha of agricultural land in southwestern Ontario was disaggregated into 365 unique land units, reflecting regional variability in soil quality, topography and climate. Analyses were conducted for individual crops on each of the land units, and results were aggregated to a regional level. Overall, a longer, warmer but relatively drier crop growing season could be expected in southwestern Ontario under this scenario. Climatic change impacts will vary from crop to crop, and will have a greater impact on corn yield than soybeans or wheat. Yield improvements stemming from irrigation should be greater with corn than with the other two crops. 16 refs., 1 tab

Conservation and diversity of seed associated endophytes in Zea across boundaries of evolution, ethnography and ecology.

Science.gov (United States)

Johnston-Monje, David; Raizada, Manish N

2011-01-01

Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte) to modern maize (corn) and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP) of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed isolate

Conservation and Diversity of Seed Associated Endophytes in Zea across Boundaries of Evolution, Ethnography and Ecology

Science.gov (United States)

Johnston-Monje, David; Raizada, Manish N.

2011-01-01

Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte) to modern maize (corn) and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP) of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed isolate

Conservation and diversity of seed associated endophytes in Zea across boundaries of evolution, ethnography and ecology.

Directory of Open Access Journals (Sweden)

David Johnston-Monje

Full Text Available Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte to modern maize (corn and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed

Economic evaluation of a crop rotation portfolio for irrigated farms in central Chile

Directory of Open Access Journals (Sweden)

Jorge González U

2013-09-01

Full Text Available The sustainable use of productive resources by agricultural producers in the central valley of Chile should be compatible with economic results so that producers can select an appropriate rotation or succession of annual crops and pasture. The objective of this work was to evaluate the economic behavior of four food crop and supplementary forage rotations using indicators of profitability and profit variability. Productive data were used from a long-term experiment (16 yr in the central valley of Chile under conditions of irrigation. With productive data and information on historic input/output prices, the real net margin per rotation (RNMR and its coefficient of variation (CV were determined. The results indicated that the highest economic benefits and greatest economic stability were obtained with rotations that only included crops, namely sugar beet (Beta vulgaris L. subsp. vulgaris-wheat (Triticum aestivum L.-bean (Phaseolus vulgaris L.-barley (Hordeum vulgare L. (CR2 and corn (Zea mays L.-wheat-bean-barley (CR4. These rotations included crops with low CV of the net margin, such as wheat, barley and beans, with values between 0.31 and 0.34. The rotations with crops and pasture, sugar beet-wheat-red clover (Trifolium pratense L. (2 (CR1 and corn-wheat-red clover (2 (CR3 had lower net margins and more variability of this indicator. Red clover had the highest CV value (1.00. The selection of crops for rotations and their sequence were determining factors in the economic behavior of rotations, affecting the level of RNMR and the degree of inter-annual variability of this indicator. Thus, differences among rotations of 47% in net margin were determined (CR2 vs. CR1, which only differed in the replacement of pasture with red clover (2 by bean-barley. The economic analysis based on the net margin and its variability allow for discriminating among rotations, providing valuable information for producers in deciding which crops to use in rotations.

Transport of indoleacetic acid in intact corn coleoptiles

International Nuclear Information System (INIS)

Parker, K.E.; Briggs, W.R.

1990-01-01

We have characterized the transport of [ 3 H]indoleacetic acid (IAA) in intact corn (Zea mays L.) coleoptiles. We have used a wide range of concentrations of added IAA (28 femtomoles to 100 picomoles taken up over 60 minutes). The shape of the transport curve varies with the concentration of added IAA, although the rate of movement of the observed front of tracer is invariant with concentration. At the lowest concentration of tracer used, the labeled IAA in the transport stream is not detectably metabolized or immobilized, curvature does not develop as a result of tracer application, and normal phototropic and gravitropic responsiveness are not affected. Therefore we believe we are observing the transport of true tracer quantities of labeled auxin at this lowest concentration

Efficacy of Silk Channel Injections with Insecticides for Management of Lepidoptera Pests of Sweet Corn.

Science.gov (United States)

Sparks, A N; Gadal, L; Ni, X

2015-08-01

The primary Lepidoptera pests of sweet corn (Zea mays L. convar. saccharata) in Georgia are the corn earworm, Helicoverpa zea (Boddie), and the fall armyworm, Spodoptera frugiperda (J. E. Smith). Management of these pests typically requires multiple insecticide applications from first silking until harvest, with commercial growers frequently spraying daily. This level of insecticide use presents problems for small growers, particularly for "pick-your-own" operations. Injection of oil into the corn ear silk channel 5-8 days after silking initiation has been used to suppress damage by these insects. Initial work with this technique in Georgia provided poor results. Subsequently, a series of experiments was conducted to evaluate the efficacy of silk channel injections as an application methodology for insecticides. A single application of synthetic insecticide, at greatly reduced per acre rates compared with common foliar applications, provided excellent control of Lepidoptera insects attacking the ear tip and suppressed damage by sap beetles (Nitidulidae). While this methodology is labor-intensive, it requires a single application of insecticide at reduced rates applied ∼2 wk prior to harvest, compared with potential daily applications at full rates up to the day of harvest with foliar insecticide applications. This methodology is not likely to eliminate the need for foliar applications because of other insect pests which do not enter through the silk channel or are not affected by the specific selective insecticide used in the silk channel injection, but would greatly reduce the number of applications required. This methodology may prove particularly useful for small acreage growers. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

A comparison of corn (Zea mays L.) residue and its biochar on soil C and plant growth.

Science.gov (United States)

Calderón, Francisco J; Benjamin, Joseph; Vigil, Merle F

2015-01-01

In order to properly determine the value of charring crop residues, the C use efficiency and effects on crop performance of biochar needs to be compared to the un-charred crop residues. In this study we compared the addition of corn stalks to soil, with equivalent additions of charred (300 °C and 500 °C) corn residues. Two experiments were conducted: a long term laboratory mineralization, and a growth chamber trial with proso millet plants. In the laboratory, we measured soil mineral N dynamics, C use efficiency, and soil organic matter (SOM) chemical changes via infrared spectroscopy. The 300 °C biochar decreased plant biomass relative to a nothing added control. The 500°C biochar had little to no effect on plant biomass. With incubation we measured lower soil NO3 content in the corn stalk treatment than in the biochar-amended soils, suggesting that the millet growth reduction in the stalk treatment was mainly driven by N limitation, whereas other factors contributed to the biomass yield reductions in the biochar treatments. Corn stalks had a C sequestration use efficiency of up to 0.26, but charring enhanced C sequestration to values that ranged from 0.64 to 1.0. Infrared spectroscopy of the soils as they mineralized showed that absorbance at 3400, 2925-2850, 1737 cm-1, and 1656 cm-1 decreased during the incubation and can be regarded as labile SOM, corn residue, or biochar bands. Absorbances near 1600, 1500-1420, and 1345 cm-1 represented the more refractory SOM moieties. Our results show that adding crop residue biochar to soil is a sound C sequestration technology compared to letting the crop residues decompose in the field. This is because the resistance to decomposition of the chars after soil amendment offsets any C losses during charring of the crop residues.

Increased Risk of Insect Injury to Corn Following Rye Cover Crop.

Science.gov (United States)

Dunbar, Mike W; O'Neal, Matthew E; Gassmann, Aaron J

2016-08-01

Decreased pest pressure is sometimes associated with more diverse agroecosystems, including the addition of a rye cover crop (Secale cereale L.). However, not all pests respond similarly to greater vegetational diversity. Polyphagous pests, such as true armyworm (Mythimna unipuncta Haworth), black cutworm (Agrotis ipsilon Hufnagel), and common stalk borer (Papaipema nebris Guenee), whose host range includes rye have the potential to cause injury to crops following a rye cover crop. The objectives of this study were to compare the abundance of early-season insect pests and injury to corn (Zea mays L.) from fields with and without a rye cover crop on commercial farms. Fields were sampled weekly to quantify adult and larval pests and feeding injury to corn plants from mid-April until corn reached V8 stage, during 2014 and 2015. Measurements within fields were collected along transects that extended perpendicularly from field edges into the interior of cornfields. Adult true armyworm and adult black cutworm were captured around all cornfields, but most lepidopteran larvae captured within cornfields were true armyworm and common stalk borer. Cornfields with a rye cover crop had significantly greater abundance of true armyworm and greater proportion of injured corn. Both true armyworm abundance and feeding injury were significantly greater in the interior of cornfields with rye. Common stalk borer abundance did not differ between cornfields with or without rye cover. Farmers planting corn following a rye cover crop should be aware of the potential for increased presence of true armyworm and for greater injury to corn. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Main: 1JB9 [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

Examining the impacts of increased corn production on ...

Science.gov (United States)

This study demonstrates the value of a coupled chemical transport modeling system for investigating groundwater nitrate contamination responses associated with nitrogen (N) fertilizer application and increased corn production. The coupled Community Multiscale Air Quality Bidirectional and Environmental Policy Integrated Climate modeling system incorporates agricultural management practices and N exchange processes between the soil and atmosphere to estimate levels of N that may volatilize into the atmosphere, re-deposit, and seep or flow into surface and groundwater. Simulated values from this modeling system were used in a land-use regression model to examine associations between groundwater nitrate-N measurements and a suite of factors related to N fertilizer and groundwater nitrate contamination. Multi-variable modeling analysis revealed that the N-fertilizer rate (versus total) applied to irrigated (versus rainfed) grain corn (versus other crops) was the strongest N-related predictor variable of groundwater nitrate-N concentrations. Application of this multi-variable model considered groundwater nitrate-N concentration responses under two corn production scenarios. Findings suggest that increased corn production between 2002 and 2022 could result in 56% to 79% increase in areas vulnerable to groundwater nitrate-N concentrations ≥ 5 mg/L. These above-threshold areas occur on soils with a hydraulic conductivity 13% higher than the rest of the domain. Additio

Aislamiento e identificación de cepas de Azospirillum sp. y evaluación de su capacidad para suplir las necesidades de nitrógeno en el cultivo de maíz (Zea mays) semihidroponico con dos sustratos diferentes bajo invernadero. Quito, Cayambe, Ecuador 2011.

OpenAIRE

Reyes Campaña, Alex Ramiro

2011-01-01

The corn, (Zea mays) L. is a basic crop in ecuadorian agriculture, which is why the search for environmentally friendly nitrogen fertilization of low cost doesn’t cease to be important. One of these options is the use of bio-fertilizers, for which the nitrogen fixing bacteria Azospirillum sp. can be used. The objective of this work is to isolate and identify Azospirillum sp. stumps, and evaluate its capacity to provide the nitrogen’s needs in the semi-hydroponic crop, , (Zea mays) L. withi...

Mycoflora Of Maize Zea Maize At Different Locations In Hail Area-Saudi Arabia

Directory of Open Access Journals (Sweden)

Elham S. Dawood

2015-06-01

Full Text Available Abstract Zea maize is one of the main cereals produced in Hail area Saudi Arabia. The risk of mycotoxin contamination is related to mycoflora associated with corn kernel. This paper reports on isolation and identification of external and internal mycoflora of maize harvested in Hail area in 2006 2008. A mycological survey was carried out on 200 samples from two agricultural companies . Comparison between frequency and relative density of the prevalent genera and species was carried out. Genus Fusarium was the most prevalent component of the internal seed - borne mycoflora in the two companies Aspergillus spp. was the most prevalent genus as external seed borne mycoflora. The predominant species of the different genera were Fusarium moniliforrme Aspergillus flavus A. niger and Alternaria alternate.

INFLUENCE OF CROP SEQUENCES ON AGRONOMIC CHARACTERISTICS OF CORN (Zea mays L. UNDER NO-TILLAGE INFLUÊNCIA DE SUCESSÃO DE CULTURAS SOBRE CARACTERÍSTICAS AGRONÔMICAS DO MILHO (Zea mays L. EM PLANTIO DIRETO

Directory of Open Access Journals (Sweden)

Liovando Marciano da Costa

2007-09-01

Full Text Available

Evoluated agronomic characteristics of corn in six crop sequences (corn-corn, soybean-corn, sunflower-corn, pearl milletcorn, sorghum-corn and pigeon pea-corn under no-tillage for three years, in Rio Verde, Goiás State. Significance was observed by the test F for plant height, 100 grain weight and grain moisture. Pigeon pea, soybean, sunflower and pearl millet, resulted in taller corn plants. No statistical differences were found between crop sequences for corn grain yield and other characteristics.

KEY-WORDS: Crop sequences; corn; agronomic characteristics.

Avaliaram-se características agronômicas na cultura do milho em seis sucessões de culturas (milho-milho, soja-milho,girassol-milho, milheto-milho, sorgo-milho e guandu milho em plantio direto, durante três anos, em Rio Verde, Goiás. Observou-se significância, pelo teste F, para altura de planta, peso de 100 grãos e umidade dos grãos na colheita. Guandu, soja, girassol e milheto proporcionaram maior altura da planta de milho. Não foram observadas diferenças estatísticas entre as sucessões para produtividades de grãos e demais características avaliadas.

PALAVRAS-CHAVE: Sucessão de culturas; milho; características agronômicas.

High-LET particle dosimetry in the ASTP-Biostack III: Zea mays experiment

International Nuclear Information System (INIS)

Peterson, D.D.; Benton, E.V.; Tran, M.; Yang, T.; Freeling, M.; Craise, L.; Tobias, C.A.

1977-01-01

High-LET particle hits in embryos of Zea mays (corn) seeds, flown as part of the ASTP-Biostack III, were determined via plastic nuclear track detectors. Based on etched particle-tracks measurements, 41 embryos were hit in seed layer 1 which contained 80 seeds, and 49 hits occurred in layer 2 which contained 79 seeds. The mean LET value and range of atomic numbers of recorded hits is, respectively, 210 +- 57 keV/μm and 9 approximately less than Z approximately less than 26. Detailed analysis of one particular seed showing marked growth anomalies revealed two hits in the central region of the embryo. These two hits had LET values in the region of 100 to 150 keV/μm, and Z less than approximately 20. (author)

Oxidation of indole-3-acetic acid to oxindole-3-acetic acid by an enzyme preparation from Zea mays

Science.gov (United States)

Reinecke, D. M.; Bandurski, R. S.

1988-01-01

Indole-3-acetic acid is oxidized to oxindole-3-acetic acid by Zea mays tissue extracts. Shoot, root, and endosperm tissues have enzyme activities of 1 to 10 picomoles per hour per milligram protein. The enzyme is heat labile, is soluble, and requires oxygen for activity. Cofactors of mixed function oxygenase, peroxidase, and intermolecular dioxygenase are not stimulatory to enzymic activity. A heat-stable, detergent-extractable component from corn enhances enzyme activity 6- to 10-fold. This is the first demonstration of the in vitro enzymic oxidation of indole-3-acetic acid to oxindole-3-acetic acid in higher plants.

Evaluation of Biosynthesis, Accumulation and Antioxidant Activityof Vitamin E in Sweet Corn (Zea mays L. during Kernel Development

Directory of Open Access Journals (Sweden)

Lihua Xie

2017-12-01

Full Text Available Sweet corn kernels were used in this research to study the dynamics of vitamin E, by evaluatingthe expression levels of genes involved in vitamin E synthesis, the accumulation of vitamin E, and the antioxidant activity during the different stage of kernel development. Results showed that expression levels of ZmHPT and ZmTC genes increased, whereas ZmTMT gene dramatically decreased during kernel development. The contents of all the types of vitamin E in sweet corn had a significant upward increase during kernel development, and reached the highest level at 30 days after pollination (DAP. Amongst the eight isomers of vitamin E, the content of γ-tocotrienol was the highest, and increased by 14.9 folds, followed by α-tocopherolwith an increase of 22 folds, and thecontents of isomers γ-tocopherol, α-tocotrienol, δ-tocopherol,δ-tocotrienol, and β-tocopherol were also followed during kernel development. The antioxidant activity of sweet corn during kernel development was increased, and was up to 101.8 ± 22.3 μmol of α-tocopherol equivlent/100 g in fresh weight (FW at 30 DAP. There was a positive correlation between vitamin E contents and antioxidant activity in sweet corn during the kernel development, and a negative correlation between the expressions of ZmTMT gene and vitamin E contents. These results revealed the relations amongst the content of vitamin E isomers and the gene expression, vitamin E accumulation, and antioxidant activity. The study can provide a harvesting strategy for vitamin E bio-fortification in sweet corn.

Evaluation of Biosynthesis, Accumulation and Antioxidant Activityof Vitamin E in Sweet Corn (Zea mays L.) during Kernel Development.

Science.gov (United States)

Xie, Lihua; Yu, Yongtao; Mao, Jihua; Liu, Haiying; Hu, Jian Guang; Li, Tong; Guo, Xinbo; Liu, Rui Hai

2017-12-20

Sweet corn kernels were used in this research to study the dynamics of vitamin E, by evaluatingthe expression levels of genes involved in vitamin E synthesis, the accumulation of vitamin E, and the antioxidant activity during the different stage of kernel development. Results showed that expression levels of Zm HPT and Zm TC genes increased, whereas Zm TMT gene dramatically decreased during kernel development. The contents of all the types of vitamin E in sweet corn had a significant upward increase during kernel development, and reached the highest level at 30 days after pollination (DAP). Amongst the eight isomers of vitamin E, the content of γ-tocotrienol was the highest, and increased by 14.9 folds, followed by α-tocopherolwith an increase of 22 folds, and thecontents of isomers γ-tocopherol, α-tocotrienol, δ-tocopherol,δ-tocotrienol, and β-tocopherol were also followed during kernel development. The antioxidant activity of sweet corn during kernel development was increased, and was up to 101.8 ± 22.3 μmol of α-tocopherol equivlent/100 g in fresh weight (FW) at 30 DAP. There was a positive correlation between vitamin E contents and antioxidant activity in sweet corn during the kernel development, and a negative correlation between the expressions of Zm TMT gene and vitamin E contents. These results revealed the relations amongst the content of vitamin E isomers and the gene expression, vitamin E accumulation, and antioxidant activity. The study can provide a harvesting strategy for vitamin E bio-fortification in sweet corn.

Expression of maize prolamins in Escherichia Coli. [Zea mays L

Energy Technology Data Exchange (ETDEWEB)

Wang, Szu-zhen; Esen, Asim

1985-12-02

A cDNA expression library of developing corn (Zea mays L.) endosperm has been constructed using plasmid pUC8 as vector and Escherichia coli strain DH1 as host. The expression library was screened with non-radioactive immunological probes to detect the expression of gamma-zein and alpha-zein. When anti-gamma-zein antibody was used as the probe, 23 colonies gave positive reactions. The lengths of cDNA inserts of the 23 colonies were found to be 250-900 base pairs. When anti-alpha zein antibody was used, however, fewer colonies gave positive reactions. The library was also screened by colony-hybridization with /sup 32/P-labeled DNA probes. Based on immunological and hybridization screening of the library and other evidence, it was conclude that alpha-zein was either toxic to E. coli cells or rapidly degraded whereas gamma-zein and its fragments were readily expressed. 21 references.

The Effects of Different Nitrogen Sources on Yield and Yield Components of Sweet Corn (Zea mays L. saccharata

Directory of Open Access Journals (Sweden)

ali mojab ghasroddashti

2017-09-01

Full Text Available Introduction Sweet corn (Zea mays L. saccharata is one of the tropical cereals of graminae which is cultivated in order to use for ear. Nitrogen is one of the most important nutrients and key factors to achieve desirable yield. Fertilizers play a major role in crop productivity. However, nowadays, excessive use of fertilizers have been found to have a negative impact on yield and environment. Introducing new management methods based on nitrogen and water use efficiency showed some improvements in the quality and quantity of crop production in association with the health of the community. In fact, soil organic matter content should be maintained in the appropriate level to improve fertility. Using municipal solid waste compost and poultry manure are appropriate solutions. They can increase soil organic matter, modify physicochemical properties and improve crop production. Moreover, they are able to solve problems caused by the accumulation of municipal solid waste compost and poultry manure. Material and Methods In order to investigate the impact of different sources of nitrogen on yield and yield components of sweet corn, a field experiment was conducted as a randomized complete block design with three replications in Marvdasht in 2013. Treatments included different resources of fertilizer: 200 kg.ha-1 net nitrogen (T1, 300 kg.ha-1 net nitrogen (T2, 8 ton.ha-1 poultry manure (T3, 24 ton.ha-1 municipal solid waste compost (T4, 150 kg net nitrogen + 2 ton municipal solid waste compost (T5, 100 kg net nitrogen + 4 ton poultry manure (T6, 150 kg net nitrogen + 6 ton municipal solid waste compost (T7, 100 kg.ha-1 net nitrogen + 12 ton municipal solid waste compost (T8 and fertilizer free (control (T9. At the time of crop maturity, two square meters from middle of each plot were harvested to measure yield and yield components. Statistical analysis was performed using the SAS statistical software. Least significant difference (LSD test at the five

Cover cropping to reduce nitrate loss through subsurface drainage in the northern U.S. corn belt.

Science.gov (United States)

Strock, J S; Porter, P M; Russelle, M P

2004-01-01

Despite the use of best management practices for nitrogen (N) application rate and timing, significant losses of nitrate nitrogen (NO3(-)-N) in drainage discharge continue to occur from row crop cropping systems. Our objective was to determine whether a autumn-seeded winter rye (Secale cereale L.) cover crop following corn (Zea mays L.) would reduce NO3(-)-N losses through subsurface tile drainage in a corn-soybean [Glycine mar (L.) Merr.] cropping system in the northern Corn Belt (USA) in a moderately well-drained soil. Both phases of the corn-soybean rotation, with and without the winter rye cover crop following corn, were established in 1998 in a Normania clay loam (fine-loamy, mixed, mesic Aquic Haplustoll) soil at Lamberton, MN. Cover cropping did not affect subsequent soybean yield, but reduced drainage discharge, flow-weighted mean nitrate concentration (FWMNC), and NO3(-)-N loss relative to winter fallow, although the magnitude of the effect varied considerably with annual precipitation. Three-year average drainage discharge was lower with a winter rye cover crop than without (p = 0.06). Over three years, subsurface tile-drainage discharge was reduced 11% and NO3(-)-N loss was reduced 13% for a corn-soybean cropping system with a rye cover crop following corn than with no rye cover crop. We estimate that establishment of a winter rye cover crop after corn will be successful in one of four years in southwestern Minnesota. Cover cropping with rye has the potential to be an effective management tool for reducing NO3(-)-N loss from subsurface drainage discharge despite challenges to establishment and spring growth in the north-central USA.

Scenarios of bioenergy development impacts on regional groundwater withdrawals

Science.gov (United States)

Uden, Daniel R.; Allen, Craig R.; Mitchell, Rob B.; Guan, Qingfeng; McCoy, Tim D.

2013-01-01

Irrigation increases agricultural productivity, but it also stresses water resources (Huffaker and Hamilton 2007). Drought and the potential for drier conditions resulting from climate change could strain water supplies in landscapes where human populations rely on finite groundwater resources for drinking, agriculture, energy, and industry (IPCC 2007). For instance, in the North American Great Plains, rowcrops are utilized for livestock feed, food, and bioenergy production (Cassman and Liska 2007), and a large portion is irrigated with groundwater from the High Plains aquifer system (McGuire 2011). Under projected future climatic conditions, greater crop water use requirements and diminished groundwater recharge rates could make rowcrop irrigation less feasible in some areas (Rosenberg et al. 1999; Sophocleous 2005). The Rainwater Basin region of south central Nebraska, United States, is an intensively farmed and irrigated Great Plains landscape dominated by corn (Zea mays L.) and soybean (Glycine max L.) production (Bishop and Vrtiska 2008). Ten starch-based ethanol plants currently service the region, producing ethanol from corn grain (figure 1). In this study, we explore the potential of switchgrass (Panicum virgatum L.), a drought-tolerant alternative bioenergy feedstock, to impact regional annual groundwater withdrawals for irrigation under warmer and drier future conditions. Although our research context is specific to the Rainwater Basin and surrounding North American Great Plains, we believe the broader research question is internationally pertinent and hope that this study simulates similar research in other areas.

Pectic polysaccharide from corn (Zea mays L.) effectively inhibited multi-step mediated cancer cell growth and metastasis.

Science.gov (United States)

Jayaram, Smitha; Kapoor, Sabeeta; Dharmesh, Shylaja M

2015-06-25

Corn pectic polysaccharide (COPP) inhibited galectin-3 mediated hemagglutination at Minimum Inhibitory Concentration (MIC) of 4.08 μg/mL as opposed to citrus pectin (25 μg/mL), a well known galectin-3 inhibitor and lactose (4.16 μg/mL)--sugar specific to galectin-3. COPP effectively (72%) inhibited invasion and metastasis in experimental animals. In vivo results were substantiated by modulation of cancer specific markers such as galectin-3, which is a key molecule for initiation of metastatic cascade, vascular endothelial growth factor (VEGF) that enhances angiogenesis, matrix metalloproteinases 2 and 9 that are required for invasion, NF-κB, a transcription factor for proliferative potency of tumor cells and a phosphoglucoisomerase (PGI), the activity of which favors cancer cell growth. Structural characterization studies indicate the active component (relatively less acidic, 0.05 M ammonium carbonate, 160 kDa fraction) which showed antimetastatic potency in vitro with MIC of 0.09 μg/mL, and ∼ 45 fold increase in the activity when compared to that of COPP. Gas liquid chromatographic analysis indicated the presence of rhamnose (1%), arabinose (20%), xylose (3%), mannose (4%), galactose (54%) and uronic acid (10%) in different proportions. However, correlative data attributed galectin-3 inhibitory activity to enhanced levels of arabinose and galactose. FTIR, HPLC and NMR spectroscopic analysis further highlights that COPP is an arabinogalactan with methyl/ethyl esters. It is therefore suggested that the blockade of galectin-3 mediated lung metastasis appears to be a result of an inhibition of mixed functions induced during metastasis. The data signifies the importance of dietary carbohydrate as cancer-preventive agent. Although pectin digestibility and absorption are issues of concern, promising in vivo data provides evidence for the cancer preventive property of corn. The present study reveals for the first time a new component of corn, i.e.,--corn pectin

Stochastic Corn Yield Response Functions to Nitrogen for Corn after Corn, Corn after Cotton, and Corn after Soybeans

OpenAIRE

Boyer, Christopher N.; Larson, James A.; Roberts, Roland K.; McClure, Angela T.; Tyler, Donald D.; Zhou, Vivian

2013-01-01

Deterministic and stochastic yield response plateau functions were estimated to determine the expected profit-maximizing nitrogen rates, yields, and net returns for corn grown after corn, cotton, and soybeans. The stochastic response functions were more appropriate than their deterministic counterparts, and the linear response stochastic plateau described the data the best. The profit-maximizing nitrogen rates were similar for corn after corn, cotton, and soybeans, but relative to corn after ...

Allelopathic Effects of Four Chickpea Cultivars on Vegetative Growth of Sunflower and Corn under Controlled Conditions

Directory of Open Access Journals (Sweden)

k Hajmohammadnia Ghalibaf

2011-02-01

Full Text Available Abstract In order to study the effects of four chickpea cultivar (Cicer arietinum L. on vegetative growth of sunflower (Helianthus annus and corn (Zea mays, two separate experiments was conducted at Research Greenhouse of Ferdowsi University of Mashhad in 2005. Experiments were done in a factorial arrangement of treatments with two factors based on completely randomized design with 4 replications. Factors included chickpea cultivars (Karag12-60-31, Filip 84-482, Gam, ILC 482, and no residue control and planting date of corn and sunflowers within root residues of chick pea (seeds planted simultaneously, 2 weeks, and 4 weeks after harvesting of chickpea shoots. Seeds of corn and sunflower were planted within root residues of chickpea. Results showed that root residues of chickpea cultivars influenced height and shoot weight of sunflower significantly. The lowest sunflower height was obtained when they were planted within root residues of Flip and ILC cultivars, which decreased 13.7 and 11.1% relative to control, respectively. Planting date of sunflower within root residues of chick pea cultivars had a significant effect on sunflower leaf area, shoot weight, and its root/shoot ratio. So that, lowest leaf area, shoot weight, and also highest root/shoot ratio was obtained in third planting date. Results showed that lowest plant height, leaf area, root weight, shoot weight, and also highest root/shoot ratio of corn (6 weeks after planting was obtained after planting within chickpea cultivars, Gam and ILC. Also the effect of corn planting date was significant. The lowest root and shoot weight, and root/shoot ratio of corn was obtained in the earliest corn planting date. Therefore, corn plants showed more sensitive than sunflower after planting within chickpea cultivars, and the highest inhibitory effects resulted in the earliest corn planting date. Keywords: Pea cultivars, Integrated management, Crop rotation

Latent nitrate reductase activity is associated with the plasma membrane of corn roots

Science.gov (United States)

Ward, M. R.; Grimes, H. D.; Huffaker, R. C.

1989-01-01

Latent nitrate reductase activity (NRA) was detected in corn (Zea mays L., Golden Jubilee) root microsome fractions. Microsome-associated NRA was stimulated up to 20-fold by Triton X-100 (octylphenoxy polyethoxyethanol) whereas soluble NRA was only increased up to 1.2-fold. Microsome-associated NRA represented up to 19% of the total root NRA. Analysis of microsomal fractions by aqueous two-phase partitioning showed that the membrane-associated NRA was localized in the second upper phase (U2). Analysis with marker enzymes indicated that the U2 fraction was plasma membrane (PM). The PM-associated NRA was not removed by washing vesicles with up to 1.0 M NACl but was solubilized from the PM with 0.05% Triton X-100. In contrast, vanadate-sensitive ATPase activity was not solubilized from the PM by treatment with 0.1% Triton X-100. The results show that a protein capable of reducing nitrate is embedded in the hydrophobic region of the PM of corn roots.

Effect of tillage and crop residue management on nematode densities on corn.

Science.gov (United States)

McSorley, R; Gallaher, R N

1994-12-01

Effects of winter cover crop management on nematode densities associated with a subsequent corn (Zea mays) crop were examined in five sites in north Florida. Two sites had received winter cover crops of lupine (Lupinus angustifolius), and one site each had rye (Secale cereale), hairy vetch (Vicia villosa), and crimson clover (Trifolium incarnatum). In each site, five different management regimes were compared: 1) conventional tillage after the cover crop was removed for forage; 2) conventional tillage with the cover crop retained as green manure; 3) no-till with the cover crop mowed and used as a mulch; 4) no-till with the cover crop removed as forage; and 5) fallow. Sites were sampled at corn planting and harvest for estimates of initial (Pi) and final (Pf) nematode population densities, respectively. Whether the cover crop was removed as forage or retained as green manure or mulch had no effect (P > 0.10) on population densities of any plant-parasitic nematode before or after corn at any site. Differences between conventional-till and no-till treatments were significant (P cover crop residues had little consistent effect on nematodes, and these practices should be considered based on agronomic benefits rather than for nematode management.

Efektivitas Amelioran pada Lahan Gambut Terdegradasi untuk Meningkatkan Pertumbuhan dan Serapan NPK Tanaman Jagung Manis (Zea mays L. var. saccharata

Directory of Open Access Journals (Sweden)

Eni Maftu’ah

2013-10-01

Full Text Available This study was aimed to determine the effectiveness of several of ameliorant formulas to increase plant growthand NPK uptake on sweet corn (Zea mays L. var. saccharata on degraded peatlands. The research was conducted in thegreenhouse of Balittra during May to July 2011. Sweet corn was planted in pot with soil taken from previously burnt peatin Kalampangan, Palangkaraya. The treatment consisted of two factors, i.e., combination of ameliorant (A1=80% chicken manure + 20% dolomite, A2=80% agricultural weeds + 20% dolomite, A3=80% mineral soil (Spodosol + 20% dolomite,A4=20% chicken manure + 20% agricultural weeds + 20% Eleocharis dulcis + 20% mineral soil + 20% dolomite, andA5=19% chicken manure + 71.5% mineral soil + 9.5% dolomite and application rates at 5, 10, 15, 20 and 25 ton ha-1, arranged in a randomized complete block design, with 3 replications. The results showed that ameliorants and application rates affected growth and NPK uptake of sweet corn. Application of 20 ton ameliorant (80% chicken manure + 20% dolomite ha-1 produced the highest dry weight of root and shoot, and NPK uptake.Keywords: ameliorants, degraded peatland, nitrogen, phosphate, potassium

Replacing gasoline with corn ethanol results in significant environmental problem-shifting.

Science.gov (United States)

Yang, Yi; Bae, Junghan; Kim, Junbeum; Suh, Sangwon

2012-04-03

Previous studies on the life-cycle environmental impacts of corn ethanol and gasoline focused almost exclusively on energy balance and greenhouse gas (GHG) emissions and largely overlooked the influence of regional differences in agricultural practices. This study compares the environmental impact of gasoline and E85 taking into consideration 12 different environmental impacts and regional differences among 19 corn-growing states. Results show that E85 does not outperform gasoline when a wide spectrum of impacts is considered. If the impacts are aggregated using weights developed by the National Institute of Standards and Technology (NIST), overall, E85 generates approximately 6% to 108% (23% on average) greater impact compared with gasoline, depending on where corn is produced, primarily because corn production induces significant eutrophication impacts and requires intensive irrigation. If GHG emissions from the indirect land use changes are considered, the differences increase to between 16% and 118% (33% on average). Our study indicates that replacing gasoline with corn ethanol may only result in shifting the net environmental impacts primarily toward increased eutrophication and greater water scarcity. These results suggest that the environmental criteria used in the Energy Independence and Security Act (EISA) be re-evaluated to include additional categories of environmental impact beyond GHG emissions.

Understanding N timing in corn yield and fertilizer N recovery: An insight from an isotopic labeled-N determination

Science.gov (United States)

de Almeida, Rodrigo Estevam Munhoz; Pierozan Junior, Clovis; Lago, Bruno Cocco; Trivelin, Paulo Cesar Ocheuze

2018-01-01

Early fertilizer nitrogen (N) application on cover crops or their residues during the off-season is a practice adopted in Brazil subtropical conditions under no-tillage corn (Zea mays L.) systems. However, the effect of early N application on yield, plant N content, and N recovery efficiency (NRE) for corn is not yet well documented. Five fertilizer N timings in an oat-corn system were evaluated in two studies utilizing an isotopic-labeled N determination, 15N isotope. The N fertilization timings were: (i) oat tillering, (ii) 15 days before corn planting time, over the oat residues, (iii) at corn planting time, (iv) in-season at the three-leaf growth stage (V3), and (v) in-season split application at V3 and six-leaf (V6) growth stages. Based on the statistical analysis, the N fertilization timings were separated into three groups: 1) N-OATS, designated to N applied at oat; 2) N-PLANT, referred to pre-plant and planting N applications; and 3) N-CORN, designated to in-season corn N applications. Corn yield was not affected by the N fertilization timing. However, the N-CORN N fertilization timings enhanced NRE by 17% and 35% and final N recovery system (plant plus soil) by 16% and 24% all relative to N-OATS and N-PLANT groups, respectively. Overall, N-OATS resulted in the largest N derived from fertilizer (NDFF) amount in the deeper soil layer, in overall a delta of 10 kg N ha-1 relative to the rest of the groups. Notwithstanding corn yield was not affected, early N fertilization under subtropical conditions is not a viable option since NRE was diminished and the non-recovery N increased relative to the in-season N applications. PMID:29462178

Understanding N timing in corn yield and fertilizer N recovery: An insight from an isotopic labeled-N determination.

Science.gov (United States)

Maciel de Oliveira, Silas; Almeida, Rodrigo Estevam Munhoz de; Ciampitti, Ignacio A; Pierozan Junior, Clovis; Lago, Bruno Cocco; Trivelin, Paulo Cesar Ocheuze; Favarin, José Laércio

2018-01-01

Early fertilizer nitrogen (N) application on cover crops or their residues during the off-season is a practice adopted in Brazil subtropical conditions under no-tillage corn (Zea mays L.) systems. However, the effect of early N application on yield, plant N content, and N recovery efficiency (NRE) for corn is not yet well documented. Five fertilizer N timings in an oat-corn system were evaluated in two studies utilizing an isotopic-labeled N determination, 15N isotope. The N fertilization timings were: (i) oat tillering, (ii) 15 days before corn planting time, over the oat residues, (iii) at corn planting time, (iv) in-season at the three-leaf growth stage (V3), and (v) in-season split application at V3 and six-leaf (V6) growth stages. Based on the statistical analysis, the N fertilization timings were separated into three groups: 1) N-OATS, designated to N applied at oat; 2) N-PLANT, referred to pre-plant and planting N applications; and 3) N-CORN, designated to in-season corn N applications. Corn yield was not affected by the N fertilization timing. However, the N-CORN N fertilization timings enhanced NRE by 17% and 35% and final N recovery system (plant plus soil) by 16% and 24% all relative to N-OATS and N-PLANT groups, respectively. Overall, N-OATS resulted in the largest N derived from fertilizer (NDFF) amount in the deeper soil layer, in overall a delta of 10 kg N ha-1 relative to the rest of the groups. Notwithstanding corn yield was not affected, early N fertilization under subtropical conditions is not a viable option since NRE was diminished and the non-recovery N increased relative to the in-season N applications.

Relationship between Aflatoxin Contamination and Physiological Responses of Corn Plants under Drought and Heat Stress

Directory of Open Access Journals (Sweden)

Nacer Bellaloui

2012-11-01

Full Text Available Increased aflatoxin contamination in corn by the fungus Aspergillus flavus is associated with frequent periods of drought and heat stress during the reproductive stages of the plants. The objective of this study was to evaluate the relationship between aflatoxin contamination and physiological responses of corn plants under drought and heat stress. The study was conducted in Stoneville, MS, USA under irrigated and non-irrigated conditions. Five commercial hybrids, P31G70, P33F87, P32B34, P31B13 and DKC63-42 and two inbred germplasm lines, PI 639055 and PI 489361, were evaluated. The plants were inoculated with Aspergillus flavus (K-54 at mid-silk stage, and aflatoxin contamination was determined on the kernels at harvest. Several physiological measurements which are indicators of stress response were determined. The results suggested that PI 639055, PI 489361 and hybrid DKC63-42 were more sensitive to drought and high temperature stress in the non-irrigated plots and P31G70 was the most tolerant among all the genotypes. Aflatoxin contamination was the highest in DKC63-42 and PI 489361 but significantly lower in P31G70. However, PI 639055, which is an aflatoxin resistant germplasm, had the lowest aflatoxin contamination, even though it was one of the most stressed genotypes. Possible reasons for these differences are discussed. These results suggested that the physiological responses were associated with the level of aflatoxin contamination in all the genotypes, except PI 639055. These and other physiological responses related to stress may help examine differences among corn genotypes in aflatoxin contamination.

Relationship between aflatoxin contamination and physiological responses of corn plants under drought and heat stress.

Science.gov (United States)

Kebede, Hirut; Abbas, Hamed K; Fisher, Daniel K; Bellaloui, Nacer

2012-11-20

Increased aflatoxin contamination in corn by the fungus Aspergillus flavus is associated with frequent periods of drought and heat stress during the reproductive stages of the plants. The objective of this study was to evaluate the relationship between aflatoxin contamination and physiological responses of corn plants under drought and heat stress. The study was conducted in Stoneville, MS, USA under irrigated and non-irrigated conditions. Five commercial hybrids, P31G70, P33F87, P32B34, P31B13 and DKC63-42 and two inbred germplasm lines, PI 639055 and PI 489361, were evaluated. The plants were inoculated with Aspergillus flavus (K-54) at mid-silk stage, and aflatoxin contamination was determined on the kernels at harvest. Several physiological measurements which are indicators of stress response were determined. The results suggested that PI 639055, PI 489361 and hybrid DKC63-42 were more sensitive to drought and high temperature stress in the non-irrigated plots and P31G70 was the most tolerant among all the genotypes. Aflatoxin contamination was the highest in DKC63-42 and PI 489361 but significantly lower in P31G70. However, PI 639055, which is an aflatoxin resistant germplasm, had the lowest aflatoxin contamination, even though it was one of the most stressed genotypes. Possible reasons for these differences are discussed. These results suggested that the physiological responses were associated with the level of aflatoxin contamination in all the genotypes, except PI 639055. These and other physiological responses related to stress may help examine differences among corn genotypes in aflatoxin contamination.

7 CFR 319.24 - Notice of quarantine.

Science.gov (United States)

2010-01-01

..., that maize or Indian corn (Zea mays L.) and closely related plants are subject to certain injurious... the United States. (d) Seed of Indian corn or maize (Zea mays L.) that is free from the cob and from...

Examination of the pest status of corn-infesting Ulidiidae (Diptera).

Science.gov (United States)

Goyal, Gaurav; Nuessly, Gregg S; Seal, Dakshina R; Steck, Gary J; Capinera, John L; Meagher, Robert L

2012-10-01

Larvae of 11 species of picture-winged flies (Diptera: Ulididae) are known to feed on corn plants (Zea mays L.) in the western hemisphere. Larvae emerge from eggs deposited in leaf axils and corn silk to feed mostly within ears, but the primary versus secondary nature (i.e., pest status) of their infestation is not known for all of these species. Choice and no-choice tests by using a split-plot design were conducted in greenhouse and field trials to determine the pest status on sweet corn of three of these species found in Florida: Chaetopsis massyla (Walker), Euxesta eluta Loew, and E. stigmatias Loew. The main treatments (uninfested ears and ears experimentally infested with either Spodoptera frugiperda [Lepidoptera: Noctuidae] or E. eluta larvae) were applied at first silk. The subtreatments (C. massyla, E. eluta, or E. stigmatias adults caged on ears) were applied 7 d later and maintained for 10 d. All three fly species were reared from uninfested and experimentally infested ears in both choice and no-choice tests in greenhouse and field trials confirming both primary and secondary modes of ear infestation. More flies of all three species emerged from ears that were preinfested with S. frugiperda compared with uninfested ears suggesting either preference for or greater survival within ears previously infested by S. frugiperda. Fewer E. eluta and E. stigmatias emerged from ears preinfested with E. eluta in no-choice field tests, suggesting that previous infestation by this fly may negatively affect oviposition or that older fly larvae affect survival of neonate larvae. All three species studied here should be considered primary pests that can render unprotected sweet corn ears unmarketable.

Effects of Plant Residues in Two Types of Soil Texture on Soil characteristics and corn (Zea mays L. NS640 Yield in a Reduced -Tillage cropping System

Directory of Open Access Journals (Sweden)

E Hesami

2018-05-01

Full Text Available Introduction The impact of agronomy on the subsequent product in rotational cropping systems depends on factors such as plant type, duration of crop growth, soil moisture content, tillage type, irrigation method, the amount of nitrogen fertilizer, quantity and quality of returned crop residues to the soil. Prior cultivated crops improve the next crop yield by causing different conditions (nitrogen availability, organic matter and volume of available water in soil. This study was conducted due to importance of corn cultivation in Khuzestan and necessity of increasing the soil organic matter, moisture conservation and in the other hand the lack of sufficient information about the relationship between soil texture, type of preparatory crop in low-tillage condition and some soil characteristics and corn growth habits. The purpose of this experiment was to evaluate the effect of residue of preparatory crops in low plowing condition in two soil types on corn yield and some soil characteristics. Materials and Methods This experiment was carried out at Shooshtar city located in Khuzestan province. An experiment was performed by combined analysis in randomized complete block design in two fields and in two consecutive years with four replications. Two kinds of soil texture including: clay loam and clay sand. Five preparatory crops including: broad bean, wheat, canola, cabbage and fallow as control assigned as sub plots. SAS Ver. 9.1 statistical software was used for analysis of variance and comparison of means. Graphs were drawn using MS Excel software. All means were compared by Duncan test at 5% probability level. Results and Discussion The soil texture and the type of preparatory crop influenced the characteristics of the soil and corn grain yield. Returning the broad bean residue into two types of soil caused the highest grain yield of corn 10128.6 and 9547.9 kgha-1, respectively. The control treatment in sandy loam texture had the lowest corn seed

Environmental effect of conventional and GM crops of cotton (Gossipium hirsitum L. and corn (Zea mays L.

Directory of Open Access Journals (Sweden)

Kelly Ávila

2011-12-01

Full Text Available In the corn belt of Valle de San Juan and in the cotton zone of El Espinal, municipalities in the department of Tolima (Colombia, 10 conventional corn producers, 10 producers of genetically modified corn, five producers of conventional cotton and 15 producers of transgenic cotton were surveyed in the first half of 2009 to contrast the differences in the environmental impact associated with use of insecticides and herbicides, which were evaluated by estimating the environmental index quotient-EIQ. In the case of maize, an EIQ of 42 was found in the conventional type, while transgenic technology had an EIQ of 3.03. In the cultivation of cotton, an EIQ of 263.59 was found for the conventional type while for transgenic technology this value varied between 335.75 (Nuopal BG/RR and 324.79 (DP 455 BG/RR. These data showed a lower environmental impact using GM technology in the cultivation of maize when compared to the conventional counterpart, in connection with the use of insecticides and herbicides, in the context of time, space and genotypic analysis. This effect was not observed in the case of cotton, where environmental impacts were similar

Simulation of temporal and spatial distribution of required irrigation water by crop models and the pan evaporation coefficient method

Science.gov (United States)

Yang, Yan-min; Yang, Yonghui; Han, Shu-min; Hu, Yu-kun

2009-07-01

Hebei Plain is the most important agricultural belt in North China. Intensive irrigation, low and uneven precipitation have led to severe water shortage on the plain. This study is an attempt to resolve this crucial issue of water shortage for sustainable agricultural production and water resources management. The paper models distributed regional irrigation requirement for a range of cultivated crops on the plain. Classic crop models like DSSAT- wheat/maize and COTTON2K are used in combination with pan-evaporation coefficient method to estimate water requirements for wheat, corn, cotton, fruit-trees and vegetables. The approach is more accurate than the static approach adopted in previous studies. This is because the combination use of crop models and pan-evaporation coefficient method dynamically accounts for irrigation requirement at different growth stages of crops, agronomic practices, and field and climatic conditions. The simulation results show increasing Required Irrigation Amount (RIA) with time. RIA ranges from 5.08×109 m3 to 14.42×109 m3 for the period 1986~2006, with an annual average of 10.6×109 m3. Percent average water use by wheat, fruit trees, vegetable, corn and cotton is 41%, 12%, 12%, 11%, 7% and 17% respectively. RIA for April and May (the period with the highest irrigation water use) is 1.78×109 m3 and 2.41×109 m3 respectively. The counties in the piedmont regions of Mount Taihang have high RIA while the central and eastern regions/counties have low irrigation requirement.

Residual nitrogen-15 recovery by corn as influenced by tillage and fertilization method

International Nuclear Information System (INIS)

Timmons, D.R.; Cruse, R.M.

1991-01-01

Tillage systems that create different surface residue conditions may also affect the recovery of residual fertilizer N during subsequent growing seasons. This study evaluated the recovery of residual labeled N fertilizer in the soil by corn (Zea mays L.) for two tillage systems and two fertilization methods. Five atom % 15 N-enriched 28% urea-ammonium nitrate solution (UAN) at 224 kg N ha -1 was either surface-applied in the fall before any primary tillage or banded (knifed in) just before planting in the spring. Continuous corn was grown with either fall moldboard-plow (MP) or ridge-till (RT) systems. After the initial growing season, the recovery of residual labeled N in the soil by corn was determined for three consecutive growing seasons, and the soil profile was sampled periodically to measure residual 15 N in the organic and inorganic pools. One year after labeled UAN application, from 16 to 27% of the initial 15 N applied was found in the organic N pool and only 1% as inorganic N[NH 4 +(NO 2 +NO 3 )-N]. After four seasons, residual 15 N in the organic N pool ranged from 13 to 24%. Less than 0.5% remained as inorganic N. Regression analyses indicated that about 5 kg 15 N ha -1 year -1 became available for both MP and RT systems with banded N, so the amounts were small. Total residual 15 N recovery by corn grain plus stover for three seasons ranged from 1.7 to 3.5%, and was greatest for spring-banded fertilizer. Because the amounts of residual 15 N utilized were too small to affect corn growth, this N source appears to be negligible when considering corn-N needs

Insecticidal Management and Movement of the Brown Stink Bug, Euschistus servus, in Corn

Science.gov (United States)

Reisig, Dominic D.

2011-01-01

In eastern North Carolina, some brown stink bugs, Euschistus servus (Say) (Hemiptera: Pentatomidae) are suspected to pass the F1 generation in wheat (Triticum aestivum L.) (Poales: Poaceae) before moving into corn (Zea mays L.) (Poales: Poaceae). These pests can injure corn ears as they develop. To test their effectiveness as a management tactic, pyrethroids were aerially applied to field corn in two experiments, one with 0.77 ha plots and another with 85 ha plots. Euschistus servus population abundance was monitored over time in both experiments and yield was assessed in the larger of the two experiments. In the smaller experiment, the populations were spatially monitored in a 6.3 ha area of corn adjacent to a recently harvested wheat field (352 sampling points of 6.1 row-meters in all but the first sampling event). Overall E. servus abundance decreased throughout the monitoring period in the sampling area of the smaller experiment, but remained unchanged over time in the large-scale experiment. During all sampling periods in both experiments, abundance was the same between treatments. Yield was unaffected by treatment where it was measured in the larger experiment. In the smaller experiment, E. servus were initially aggregated at the field edge of the corn (two, six and 13 days following the wheat harvest). Sixteen days following the wheat harvest they were randomly distributed in the corn. Although it was not directly measured, stink bugs are suspected to move the cornfield edge as a result of the adjacent wheat harvest. More study of the biology of E. servus is needed, specifically in the area of host preference, phenology and movement to explain these phenomena and to produce better management strategies for these pests. PMID:22950984

Spatial Patterns of Aflatoxin Levels in Relation to Ear-Feeding Insect Damage in Pre-Harvest Corn

Directory of Open Access Journals (Sweden)

Alisa Huffaker

2011-07-01

Full Text Available Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs, and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil and piercing-sucking insects (i.e., the stink bugs and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also

Spatial patterns of aflatoxin levels in relation to ear-feeding insect damage in pre-harvest corn.

Science.gov (United States)

Ni, Xinzhi; Wilson, Jeffrey P; Buntin, G David; Guo, Baozhu; Krakowsky, Matthew D; Lee, R Dewey; Cottrell, Ted E; Scully, Brian T; Huffaker, Alisa; Schmelz, Eric A

2011-07-01

Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs), and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil) and piercing-sucking insects (i.e., the stink bugs) and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also discussed.

Spatial Patterns of Aflatoxin Levels in Relation to Ear-Feeding Insect Damage in Pre-Harvest Corn

Science.gov (United States)

Ni, Xinzhi; Wilson, Jeffrey P.; Buntin, G. David; Guo, Baozhu; Krakowsky, Matthew D.; Lee, R. Dewey; Cottrell, Ted E.; Scully, Brian T.; Huffaker, Alisa; Schmelz, Eric A.

2011-01-01

Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs), and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil) and piercing-sucking insects (i.e., the stink bugs) and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also discussed. PMID

Windbreak effect on biomass and grain mass accumulation of corn: a modeling approach

International Nuclear Information System (INIS)

Zhang, H.; Brandle, J.R.

1996-01-01

While numerous studies have indicated that field windbreaks both improve crop growing conditions and generally enhance crop growth and yield, especially under less favorable conditions, the relationship between the two is not clearly understood. A simple model is proposed to simulate biomass and grain mass accumulation of corn (Zea mays L,) with a windbreak shelter or without (exposed condition). The model is based on the positive relationship between intercepted solar radiation and biomass accumulation and requires plant population and hourly inputs of solar radiation and air temperature. Using published data, radiation use efficiency (RUE) was related to plant population, and a temperature function was established between the relative corn growth and temperature for pre-silking stages. Biomass and grain mass simulated by the model agreed well with those measured for both sheltered and unsheltered plants from 1990 to 1992. Windbreaks did not significantly increase biomass or grain mass of corn for this study, even though air temperature was greater with than without shelter, probably indicating that the microclimatic changes induced by windbreaks were not physiologically significant for the 3-yr period studied. The model has potential use in future studies to relate windbreak effects to crop yield and to evaluate windbreak designs for maximum benefits

Estimating irrigation water use in the humid eastern United States

Science.gov (United States)

Levin, Sara B.; Zarriello, Phillip J.

2013-01-01

Accurate accounting of irrigation water use is an important part of the U.S. Geological Survey National Water-Use Information Program and the WaterSMART initiative to help maintain sustainable water resources in the Nation. Irrigation water use in the humid eastern United States is not well characterized because of inadequate reporting and wide variability associated with climate, soils, crops, and farming practices. To better understand irrigation water use in the eastern United States, two types of predictive models were developed and compared by using metered irrigation water-use data for corn, cotton, peanut, and soybean crops in Georgia and turf farms in Rhode Island. Reliable metered irrigation data were limited to these areas. The first predictive model that was developed uses logistic regression to predict the occurrence of irrigation on the basis of antecedent climate conditions. Logistic regression equations were developed for corn, cotton, peanut, and soybean crops by using weekly irrigation water-use data from 36 metered sites in Georgia in 2009 and 2010 and turf farms in Rhode Island from 2000 to 2004. For the weeks when irrigation was predicted to take place, the irrigation water-use volume was estimated by multiplying the average metered irrigation application rate by the irrigated acreage for a given crop. The second predictive model that was developed is a crop-water-demand model that uses a daily soil water balance to estimate the water needs of a crop on a given day based on climate, soil, and plant properties. Crop-water-demand models were developed independently of reported irrigation water-use practices and relied on knowledge of plant properties that are available in the literature. Both modeling approaches require accurate accounting of irrigated area and crop type to estimate total irrigation water use. Water-use estimates from both modeling methods were compared to the metered irrigation data from Rhode Island and Georgia that were used to

Effects of climatic factors, drought risk and irrigation requirement on maize yield in the Northeast Farming Region of China

DEFF Research Database (Denmark)

Yin, Xiaogang; Jabloun, Mohamed; Olesen, Jørgen Eivind

2016-01-01

Drought risk is considered to be among the main limiting factors for maize (Zea mays L.) production in the Northeast Farming Region of China (NFR). Maize yield data from 44 stations over the period 1961–2010 were combined with data from weather stations to evaluate the effects of climatic factors...... drought and intense rainfall illustrate the importance of further development of irrigation and drainage systems for ensuring the stability of maize production in NFR....

Active-Optical Sensors Using Red NDVI Compared to Red Edge NDVI for Prediction of Corn Grain Yield in North Dakota, U.S.A.

Science.gov (United States)

Sharma, Lakesh K; Bu, Honggang; Denton, Anne; Franzen, David W

2015-11-02

Active-optical sensor readings from an N non-limiting area standard established within a farm field are used to predict yield in the standard. Lower yield predictions from sensor readings obtained from other parts of the field outside of the N non-limiting standard area indicate a need for supplemental N. Active-optical sensor algorithms for predicting corn (Zea mays, L.) yield to direct in-season nitrogen (N) fertilization in corn utilize red NDVI (normalized differential vegetative index). Use of red edge NDVI might improve corn yield prediction at later growth stages when corn leaves cover the inter-row space resulting in "saturation" of red NDVI readings. The purpose of this study was to determine whether the use of red edge NDVI in two active-optical sensors (GreenSeeker™ and Holland Scientific Crop Circle™) improved corn yield prediction. Nitrogen rate experiments were established at 15 sites in North Dakota (ND). Sensor readings were conducted at V6 and V12 corn. Red NDVI and red edge NDVI were similar in the relationship of readings with yield at V6. At V12, the red edge NDVI was superior to the red NDVI in most comparisons, indicating that it would be most useful in developing late-season N application algorithms.

Active-Optical Sensors Using Red NDVI Compared to Red Edge NDVI for Prediction of Corn Grain Yield in North Dakota, U.S.A.

Science.gov (United States)

Sharma, Lakesh K.; Bu, Honggang; Denton, Anne; Franzen, David W.

2015-01-01

Active-optical sensor readings from an N non-limiting area standard established within a farm field are used to predict yield in the standard. Lower yield predictions from sensor readings obtained from other parts of the field outside of the N non-limiting standard area indicate a need for supplemental N. Active-optical sensor algorithms for predicting corn (Zea mays, L.) yield to direct in-season nitrogen (N) fertilization in corn utilize red NDVI (normalized differential vegetative index). Use of red edge NDVI might improve corn yield prediction at later growth stages when corn leaves cover the inter-row space resulting in “saturation” of red NDVI readings. The purpose of this study was to determine whether the use of red edge NDVI in two active-optical sensors (GreenSeeker™ and Holland Scientific Crop Circle™) improved corn yield prediction. Nitrogen rate experiments were established at 15 sites in North Dakota (ND). Sensor readings were conducted at V6 and V12 corn. Red NDVI and red edge NDVI were similar in the relationship of readings with yield at V6. At V12, the red edge NDVI was superior to the red NDVI in most comparisons, indicating that it would be most useful in developing late-season N application algorithms. PMID:26540057

Neonicotinoid-Coated Zea mays Seeds Indirectly Affect Honeybee Performance and Pathogen Susceptibility in Field Trials.

Directory of Open Access Journals (Sweden)

Mohamed Alburaki

Full Text Available Thirty-two honeybee (Apis mellifera colonies were studied in order to detect and measure potential in vivo effects of neonicotinoid pesticides used in cornfields (Zea mays spp on honeybee health. Honeybee colonies were randomly split on four different agricultural cornfield areas located near Quebec City, Canada. Two locations contained cornfields treated with a seed-coated systemic neonicotinoid insecticide while the two others were organic cornfields used as control treatments. Hives were extensively monitored for their performance and health traits over a period of two years. Honeybee viruses (brood queen cell virus BQCV, deformed wing virus DWV, and Israeli acute paralysis virus IAPV and the brain specific expression of a biomarker of host physiological stress, the Acetylcholinesterase gene AChE, were investigated using RT-qPCR. Liquid chromatography-mass spectrometry (LC-MS was performed to detect pesticide residues in adult bees, honey, pollen, and corn flowers collected from the studied hives in each location. In addition, general hive conditions were assessed by monitoring colony weight and brood development. Neonicotinoids were only identified in corn flowers at low concentrations. However, honeybee colonies located in neonicotinoid treated cornfields expressed significantly higher pathogen infection than those located in untreated cornfields. AChE levels showed elevated levels among honeybees that collected corn pollen from treated fields. Positive correlations were recorded between pathogens and the treated locations. Our data suggests that neonicotinoids indirectly weaken honeybee health by inducing physiological stress and increasing pathogen loads.

Physiological effects of the form of nitrogen on corn root tips: a 31P nuclear magnetic resonance study

International Nuclear Information System (INIS)

Andrade, F.H.; Anderson, I.C.

1986-01-01

Physiological effects of different N forms (NO − 3 , NH + 4 , or a combination of both) on corn (Zea mays L.) root tips and leaves were studied by following 31 P signals with a nuclear magnetic resonance spectrometer. With root tips, both cytoplasmic and vacuolar pH could be measured, whereas with leaves, only vacuolar pH could be determined. The N treatments did not affect the cytoplasmic pH of corn root tips in contrast to proposals of previous workers. Leaf vacuolar pH was higher and root tip vacuolar pH lower with NO − 3 than with NH + 4 . Under anaerobic conditions, cytoplasmic pH was reduced because of lactic acid fermentation. Nitrate, an electron acceptor, delayed the acidification of the cytoplasm compartment because it represents an alternative way to reoxidize NADH. In conclusion, for the conditions of these experiments, the pH of the cytoplasm of corn root tips was not modified by the form of N absorbed; however, the pH of this compartment was affected by the form of N presented during development anaerobiosi. (author)

[Corn.

Science.gov (United States)

Iowa History for Young People, 1993

1993-01-01

This theme issue focuses on corn. Iowa is the number one corn producing state in the United States. The featured articles in the issue concern, among other topics, Iowa children who live on farms, facts and statistics about corn, the Mesquakie Indians and corn shelling, corn hybrids, a short story, and the corn palaces of Sioux City. Activities,…

Comparison and analysis of empirical equations for soil heat flux for different cropping systems and irrigation methods

Science.gov (United States)

Irmak, A.; Singh, Ramesh K.; Walter-Shea, Elizabeth; Verma, S.B.; Suyker, A.E.

2011-01-01

We evaluated the performance of four models for estimating soil heat flux density (G) in maize (Zea mays L.) and soybean (Glycine max L.) fields under different irrigation methods (center-pivot irrigated fields at Mead, Nebraska, and subsurface drip irrigated field at Clay Center, Nebraska) and rainfed conditions at Mead. The model estimates were compared against measurements made during growing seasons of 2003, 2004, and 2005 at Mead and during 2005, 2006, and 2007 at Clay Center. We observed a strong relationship between the G and net radiation (Rn) ratio (G/Rn) and the normalized difference vegetation index (NDVI). When a significant portion of the ground was bare soil, G/Rn ranged from 0.15 to 0.30 and decreased with increasing NDVI. In contrast to the NDVI progression, the G/Rn ratio decreased with crop growth and development. The G/Rn ratio for subsurface drip irrigated crops was smaller than for the center-pivot irrigated crops. The seasonal average G was 13.1%, 15.2%, 10.9%, and 12.8% of Rn for irrigated maize, rainfed maize, irrigated soybean, and rainfed soybean, respectively. Statistical analyses of the performance of the four models showed a wide range of variation in G estimation. The root mean square error (RMSE) of predictions ranged from 15 to 81.3 W m-2. Based on the wide range of RMSE, it is recommended that local calibration of the models should be carried out for remote estimation of soil heat flux.

Correlation between Annual Corn Crop per Hectare in Croatia and Drought Indices for Zagreb-Gric Observatory

Science.gov (United States)

Pandzic, Kreso; Likso, Tanja

2017-04-01

Correlation coefficients between annual corn crop per hectare in Croatia and 9-month Standardized Precipitation Index (SPI) and Palmer Drought Severity Index (PDSI) for Zagreb - Gric for August are shown as significant. The results indicate that there is also a significant correlation between those drought indices and drought damages. Thus a forecast of the indices for August could be used for estimation e.g. annual corn crop per hectare in Croatia. Better results could be expected if statistical relationship between annual corn crops per hectare will be considered on county level instead the whole Croatia and indices calculated for weather stations for the same county. Effective way for reduction of drought damages is irrigation which need to be significantly improved in future in Croatia

Chemical form of technetium in corn (Zea mays) and the gastrointestinal absorption of plant-incorporated Tc by laboratory rats

Energy Technology Data Exchange (ETDEWEB)

Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.

1984-01-01

The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables.

Chemical form of technetium in corn (Zea mays) and the gastrointestinal absorption of plant-incorporated Tc by laboratory rats

International Nuclear Information System (INIS)

Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.

1984-01-01

The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables

Effect of planting methods, seed density and nitrogen phosphorus (NP) fertilizer levels on sweet corn (Zea maYs L.)

International Nuclear Information System (INIS)

Amin, M.; Razzaq, A.; Ullah, R.

2006-01-01

A field experiment was conducted to evaluate the effect of planting methods, seed density and nitrogen phosphorus (NP) fertilizer levels on emergence m/sup -2/ growth and grain yield of sweet corn. The fertilizer and interaction of fertilizer x seed density had significant negative effect with increasing level while seed density had a positive effect with increased density on emergence per m/sup 2/. Increased seed density significantly reduced plant growth which increased with application of higher fertilizer dose. The grain yield was improves by ridge planting methods, increased seed density and increased fertilizer levels. The highest grain yield (3,553.50 kg ha/sup-1/) of sweet corn plants was recorded in ridge planting method with highest NP fertilizer level of 300:150 kg ha/sup 1/ and 4 seeds hill/sup -1/. The lowest grain yield (3,493.75 kg ha/sup -1/) of sweet corn was observed in flat sowing planting method with 120:75 NP level and 2 seeds hill/sup -1/ seed density. The ridge planting rank first then furrow and flat planting methods on basis of grain yield per hectare. The sweet corn plant yield was high with 4 seeds hill/sup -1/ compared with 2 seeds hill/sup -1/. (author)

Quantitative trait loci for maysin synthesis in maize (Zea mays L.) lines selected for high silk maysin content.

Science.gov (United States)

Meyer, J D F; Snook, M E; Houchins, K E; Rector, B G; Widstrom, N W; McMullen, M D

2007-06-01

Maysin is a naturally occurring C-glycosyl flavone found in maize (Zea mays L.) silk tissue that confers resistance to corn earworm (Helicoverpa zea, Boddie). Recently, two new maize populations were derived for high silk maysin. The two populations were named the exotic populations of maize (EPM) and the southern inbreds of maize (SIM). Quantitative trait locus (QTL) analysis was employed to determine which loci were responsible for elevated maysin levels in inbred lines derived from the EPM and SIM populations. The candidate genes consistent with QTL position included the p (pericarp color), c2 (colorless2), whp1 (white pollen1) and in1 (intensifier1) loci. The role of these loci in controlling high maysin levels in silks was tested by expression analysis and use of the loci as genetic markers onto the QTL populations. These studies support p, c2 and whp1, but not in1, as loci controlling maysin. Through this study, we determined that the p locus regulates whp1 transcription and that increased maysin in these inbred lines was primarily due to alleles at both structural and regulatory loci promoting increased flux through the flavone pathway by increasing chalcone synthase activity.

Diapause hormone in the corn earworm, Helicoverpa zea: Optimum temperature for activity, structure–activity relationships, and efficacy in accelerating flesh fly pupariation

Czech Academy of Sciences Publication Activity Database

Zhang, Q.; Žďárek, Jan; Nachman, R. J.; Denlinger, D. L.

2008-01-01

Roč. 29, č. 2 (2008), s. 196-205 ISSN 0196-9781 Institutional research plan: CEZ:AV0Z40550506 Keywords : diapause hormone * neuropeptide analogs * diapause termination * pupariation * Helicoverpa zea Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008

Efecto de la aplicación de vinazas en las propiedades físicas y la actividad de deshidrogenasas en suelos cultivados con maíz dulce (Zea mays L. Effect of vinasse application on physical properties and dehydrogenases activity in soils under sweet corn (Zea mays L. cultivation

Directory of Open Access Journals (Sweden)

Magda Narváez Castillo

2010-04-01

Full Text Available Se evaluó el efecto de la aplicación de vinazas en algunas propiedades físicas y en la actividad de las deshidrogenasas en un Entic dystropept y en un Fluventic haplustoll del Valle de Cauca, Colombia. Para suplir los requerimientos de K+ del cultivo de maíz dulce (Zea mays L. se utilizaron seis tratamientos (T1 = 100% de K+ como vinaza, T2 = 100% de K+ con KCl; T3 = 50% de K+ como vinaza y KCl, T4 = 75% de K+ con vinaza y 25% de K+ como KCl, T5 = testigo absoluto sin planta, T6 = testigo más planta que fueron dispuestos en un diseño completamente al azar con cinco repeticiones. En el Entic dystropept la densidad aparente disminuyó y en consecuencia la porosidad total aumentó, mientras que en el Fluventic haplustoll sucedió lo contrario. La actividad de las deshidrogenasas fue significativamente mayor (P The effect of vinasse application was assessed on physical properties and dehydrogenases activity in Entic Dystropept and Fluventic Haplustoll of Valle del Cauca, Colombia. To meet the requirements of K+ in sweet corn (Zea mays L. six treatments were used (T1 = 100% of K+ as vinasse; T2 = 100% of K+ with KCl; T3 = 50% of K+ as vinasse and KCl; T4 = 75% of K+ with vinasse and 25% of K+ as KCl; T5 = absolute control without plants; T6 = control plus plants arranged in a completely randomized design with five replications. In Dystropept Entic bulk density decreased and consequently the total porosity increased, while the opposite happened in Haplustoll Fluventic. The dehydrogenase activity was significantly higher (P <0.05 in the Dystropept Entic than in Haplustoll Fluventic presenting low values. The results showed that the changes that are generated as a result of the application of vinasse are different for each type of soil.

Legumes and forage species sole or intercropped with corn in soybean-corn succession in midwestern Brazil Espécies leguminosas e forrageiras, solteiras ou consorciadas com milho, na sucessão soja-milho no centro-oeste do Brasil

Directory of Open Access Journals (Sweden)

Gessí Ceccon

2013-02-01

Full Text Available The feasibility of no-tillage in the Cerrado (Savanna-like vegetation of Brazil depends on the production of sufficient above-ground crop residue, which can be increased by corn-forage intercropping. This study evaluated how above-ground crop residue production and yields of soybean and late-season corn in a soybean-corn rotation were influenced by the following crops in the year before soybean: corn (Zea mays L. intercropped with Brachiaria (Urochloa brizantha cv. Marandu, B. decumbens cv. Basilisk, B. ruziziensis, cv. comum., Panicummaximum cv. Tanzânia, sunn hemp (Crotalaria juncea L., pigeon pea [Cajanus cajan (L. Millsp]; sole corn, forage sorghum [Sorghum bicolor (L. Moench (cv. Santa Elisa], and ruzi grass. In March 2005, corn and forage species were planted in alternate rows spaced 0.90 m apart, and sole forage species were planted in rows spaced 0.45 m apart. In October 2005, the forages were killed with glyphosate and soybean was planted. After the soybean harvest in March 2006, sole late-season corn was planted in the entire experimental area. Corn grain and stover yields were unaffected by intercropping. Above-ground crop residue was greater when corn was intercropped with Tanzania grass (10.7 Mg ha-1, Marandu (10.1 Mg ha-1, and Ruzi Grass (9.8 Mg ha-1 than when corn was not intercropped (4.0 Mg ha-1. The intercropped treatments increased the percentage of soil surface covered with crop residue. Soybean and corn grain yields were higher after sole ruzi grass and intercropped ruzi grass than after other crops. The intercropping corn with Brachiaria spp. and corn with Panicum spp. increases above-ground crop residue production and maintains nutrients in the soil without reducing late-season corn yield and the viability of no-till in the midwestern region of Brazil.A viabilidade do plantio direto no Cerrado brasileiro depende da produção adequada de palha das culturas, que pode ser aumentada pela consorciação de milho (Zea mays L

REMOTE-SENSING-BASED BIOPHYSICAL MODELS FOR ESTIMATING LAI OF IRRIGATED CROPS IN MURRY DARLING BASIN

Directory of Open Access Journals (Sweden)

I. Wittamperuma

2012-07-01

Full Text Available Remote sensing is a rapid and reliable method for estimating crop growth data from individual plant to crops in irrigated agriculture ecosystem. The LAI is one of the important biophysical parameter for determining vegetation health, biomass, photosynthesis and evapotranspiration (ET for the modelling of crop yield and water productivity. Ground measurement of this parameter is tedious and time-consuming due to heterogeneity across the landscape over time and space. This study deals with the development of remote-sensing based empirical relationships for the estimation of ground-based LAI (LAIG using NDVI, modelled with and without atmospheric correction models for three irrigated crops (corn, wheat and rice grown in irrigated farms within Coleambally Irrigation Area (CIA which is located in southern Murray Darling basin, NSW in Australia. Extensive ground truthing campaigns were carried out to measure crop growth and to collect field samples of LAI using LAI- 2000 Plant Canopy Analyser and reflectance using CROPSCAN Multi Spectral Radiometer at several farms within the CIA. A Set of 12 cloud free Landsat 5 TM satellite images for the period of 2010-11 were downloaded and regression analysis was carried out to analyse the co-relationships between satellite and ground measured reflectance and to check the reliability of data sets for the crops. Among all the developed regression relationships between LAI and NDVI, the atmospheric correction process has significantly improved the relationship between LAI and NDVI for Landsat 5 TM images. The regression analysis also shows strong correlations for corn and wheat but weak correlations for rice which is currently being investigated.

Effects of dripper discharge and irrigation frequency on growth and yield of maize in loess plateau of northwest china

International Nuclear Information System (INIS)

Xiukang, W.; Zhanbin, L.; Yingying, X.

2014-01-01

A field experiment was conducted at the Changwu Experimental Station in Changwu County, Shaanxi Province, in northwestern China from 2010 to 2011 with four treatments and six replicates in a randomized complete block design to determine appropriate dripper discharge and irrigation frequency for maize (Zea mays, L.) irrigated by drip irrigated system. Dripper discharge was applied to maize 1L/h of dripper discharge, 2 days irrigation frequency and 100% of evaporation from a class a pan (T1), 2, 3 and 4 L/h corresponding to 4, 6 and 8 days irrigation frequency, and deficit irrigation water levels was 90%, 80% and 70% of evaporation (T2, T3 and T4), respectively. The results indicated that longest root, root activity, plant height, leaf area, biomass and grain yields values were highest in T1 in both years. The highest grain yield was obtained of 8.78 and 8.84 t ha-1 under T1 in both years, and the minimum yield was obtained with 8.15 and 7.78 t ha-1 under T4 in 2010 and 2011, respectively. The maximum irrigation water use efficiency (IWUE) was 3.247 and 3.283 kg m-3 in both years under T4. Despite the reduction of growth and grain yield in T3, the dripper discharge was 3L/h, 6 days irrigation frequency and 80% of evaporation was still high and acceptable for maize production and irrigation water use efficiency in Loess Plateau of Northwest China. (author)

Modeling Long Term Corn Yield Response to Nitrogen Rate and Crop Rotation

Directory of Open Access Journals (Sweden)

Laila Alejandra Puntel

2016-11-01

Full Text Available Improved prediction of optimal N fertilizer rates for corn (Zea mays L. can reduce N losses and increase profits. We tested the ability of the Agricultural Production Systems sIMulator (APSIM to simulate corn and soybean (Glycine max L. yields, the economic optimum N rate (EONR using a 16-year field-experiment dataset from central Iowa, USA that included two crop sequences (continuous corn and soybean-corn and five N fertilizer rates (0, 67, 134, 201, and 268 kg N ha-1 applied to corn. Our objectives were to: a quantify model prediction accuracy before and after calibration, and report calibration steps; b compare crop model-based techniques in estimating optimal N rate for corn; and c utilize the calibrated model to explain factors causing year to year variability in yield and optimal N. Results indicated that the model simultaneously simulated well long-term crop yields response to N (relative root mean square error, RRMSE of 19.6% before and 12.3% after calibration, which provided strong evidence that important soil and crop processes were accounted for in the model. The prediction of EONR was more complex and had greater uncertainty than the prediction of crop yield (RRMSE of 44.5% before and 36.6% after calibration. For long-term site mean EONR predictions, both calibrated and uncalibrated versions can be used as the 16-yr mean differences in EONR’s were within the historical N rate error range (40 to 50 kg N ha-1. However, for accurate year-by-year simulation of EONR the calibrated version should be used. Model analysis revealed that higher EONR values in years with above normal spring precipitation were caused by an exponential increase in N loss (denitrification and leaching with precipitation. We concluded that long term experimental data were valuable in testing and refining APSIM predictions. The model can be used as a tool to assist N management guidelines in the US Midwest and we identified five avenues on how the model can add

Modeling Long-Term Corn Yield Response to Nitrogen Rate and Crop Rotation.

Science.gov (United States)

Puntel, Laila A; Sawyer, John E; Barker, Daniel W; Dietzel, Ranae; Poffenbarger, Hanna; Castellano, Michael J; Moore, Kenneth J; Thorburn, Peter; Archontoulis, Sotirios V

2016-01-01

Improved prediction of optimal N fertilizer rates for corn ( Zea mays L. ) can reduce N losses and increase profits. We tested the ability of the Agricultural Production Systems sIMulator (APSIM) to simulate corn and soybean ( Glycine max L. ) yields, the economic optimum N rate (EONR) using a 16-year field-experiment dataset from central Iowa, USA that included two crop sequences (continuous corn and soybean-corn) and five N fertilizer rates (0, 67, 134, 201, and 268 kg N ha -1 ) applied to corn. Our objectives were to: (a) quantify model prediction accuracy before and after calibration, and report calibration steps; (b) compare crop model-based techniques in estimating optimal N rate for corn; and (c) utilize the calibrated model to explain factors causing year to year variability in yield and optimal N. Results indicated that the model simulated well long-term crop yields response to N (relative root mean square error, RRMSE of 19.6% before and 12.3% after calibration), which provided strong evidence that important soil and crop processes were accounted for in the model. The prediction of EONR was more complex and had greater uncertainty than the prediction of crop yield (RRMSE of 44.5% before and 36.6% after calibration). For long-term site mean EONR predictions, both calibrated and uncalibrated versions can be used as the 16-year mean differences in EONR's were within the historical N rate error range (40-50 kg N ha -1 ). However, for accurate year-by-year simulation of EONR the calibrated version should be used. Model analysis revealed that higher EONR values in years with above normal spring precipitation were caused by an exponential increase in N loss (denitrification and leaching) with precipitation. We concluded that long-term experimental data were valuable in testing and refining APSIM predictions. The model can be used as a tool to assist N management guidelines in the US Midwest and we identified five avenues on how the model can add value toward

Effect of Treated Wastewater Combined with Various Amounts of Manure and Chemical Fertilizers on Nutrient Content and Yield in Corn

Directory of Open Access Journals (Sweden)

Abolfazal Tavassoli

2010-09-01

Full Text Available In order to study the effects of treated wastewater combined with manure and chemical fertilizers on the nutrients content and forage yield in corn, field experiments were conducted in 2007. The experiments were conducted in a split plot design with three replications. The treatments were comprised of two levels of irrigation water (W1= well water and W2= wastewater in the main plot and five levels of fertilizer (F1= unfertilized, F2 = 100% manure, F3= 50% manure, F4= 100% fertilizer, and F5= 50% fertilizer in the subplot. Results showed that, compared to ordinary water, irrigation with treated wastewater significantly increased fresh and dry forage yield of corn. The treatment using treated wastewater also had a significant effect on N, P, and K contents in corn forage. However, wastewater had no significant effect on plant Fe, Mn, and Zn contents. Among the fertilizer treatments, the highest fresh and dry forage yields and the highest N, P and K contents belonged to the treatments using 100% fertilizer. The highest Fe, Mn, and Zn contents were observed in plants in the treatment with 100% manure.

[Sowing date of corn in semiarid region of Jilin Province, Northeast China in adapting to climate change].

Science.gov (United States)

Jin, Ying-Hua; Zhou, Dao-Wei; Qin, Li-Jie

2012-10-01

Under the background of global climate change, the climate in semiarid region of west Jilin Province changed greatly, producing a profound impact on the corn production in this region. In this study, the corn seeds were under three treatments (accelerating germination at 10 and 25 degrees C, and dry seeds), and a field experiment with early sowing and traditional sowing was conducted in 2008 to investigate the effects of early sowing these seeds on the seedling emergence, growth, and yield, and compare the effects of early sowing and traditional sowing dates on the corn production and yield. In 1961-2010, the first day of the growth season of corn in semiarid region of west Jilin Province was advanced, the air temperature increased significantly, and the precipitation displayed a decreasing trend. At present, the corn sowing date in this region could be advanced to 11th, April. Accelerating germination at 10 degrees C, directly sowing dry seeds, and bed-irrigation sowing all benefited the seedling emergence and cold resistance of early-sown seeds, and the corn plant height and leaf area under early sowing were significantly higher, with the yield increased by 35% - 48%, compared with those under traditional sowing.

Nitrogen source and placement effects on soil nitrous oxide emissions from no-till corn.

Science.gov (United States)

Halvorson, Ardell D; Del Grosso, Stephen J

2012-01-01

A nitrogen (N) source comparison study was conducted to further evaluate the effects of inorganic N source and placement on growing-season and non-crop period soil nitrous oxide (NO). Commercially available controlled-release N fertilizers were evaluated for their potential to reduce NO emissions from a clay loam soil compared with conventionally used granular urea and urea-ammonium nitrate (UAN) fertilizers in an irrigated no-till (NT) corn ( L.) production system. Controlled-release N fertilizers evaluated were: a polymer-coated urea (ESN), stabilized urea (SuperU), and UAN+AgrotainPlus (SuperU and AgrotainPlus contain nitrification and urease inhibitors). Each N source was surface band applied (202 kg N ha) near the corn row at emergence and watered into the soil the next day. Subsurface banded ESN (ESNssb) and check (no N applied) treatments were included. Nitrous oxide fluxes were measured during two growing seasons and after harvest using static, vented chambers. All N sources had significantly lower growing-season NO emissions than granular urea (0.7% of applied N), with UAN+AgrotainPlus (0.2% of applied N) and ESN (0.3% of applied N) having lower emissions than UAN (0.4% of applied N). Similar trends were observed when expressing NO emissions on a grain yield and N uptake basis. Corn grain yields were not different among N sources but were greater than the check. Selection of N fertilizer source can be a mitigation practice for reducing NO emissions in NT, irrigated corn in semiarid areas. In our study, UAN+AgrotainPlus consistently had the lowest level of NO emissions with no yield loss. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Sweet corn water productivity under several deficit irrigation regimes applied during vegetative growth stage using treated wastewater as water irrigation source

DEFF Research Database (Denmark)

Hirich, A.; Rami, A.; Laajaj, K.

2012-01-01

Yield and Crop Water Productivity are crucial issues in sustainable agriculture, especially in high-demand resource crops such as sweet corn. This study was conducted to investigate agronomic responses such as plant growth, yield and soil parameters (EC and Nitrate accumulation) to several deficit...

Effects of Carriers, Emulsifiers, and Biopesticides for Direct Silk Treatments on Caterpillar Feeding Damage and Ear Development in Sweet Corn.

Science.gov (United States)

Westgate, P J; Schultz, B B; Hazzard, R V

2017-04-01

In the northeastern United States, control of Lepidopteran pests of sweet corn, particularly corn earworm [Helicoverpa zea (Boddie)], is difficult using organic methods. The direct application of corn oil and Bacillus thuringiensis (Bt) to corn silk has been shown to reduce ear damage from corn earworm in past studies; these studies sought to optimize this method by evaluating additional carrier and biopesticide mixtures that comply with the United States Federal Insecticide, Fungicide, and Rodenticide Act and National Organic Standards. Carriers, which are liquids used to dissolve the biopesticide and deliver it into the tip of the ear, may have phytotoxic or insecticidal properties. Experiments conducted from 2001 to 2005 evaluated caterpillar damage and ear development effects from carriers (vegetable and paraffinic oils and carrageenan), biopesticides (Bt, spinsosad, and neem), and three emulsifiers in various combinations when applied directly to the tips of the ears 5-7 d after silk initiation. There were no effects of emulsifiers on ear quality, except for slight reduction in caterpillar damage in one of the two years. There were no differences among corn, soy, canola, and safflower oils in corn earworm control or tip development. The carrageenan carrier had the least effect upon ear development as measured by the length of nonpollinated kernels at the tip, compared to corn oil or paraffinic oil (JMS Stylet Oil), which caused the greatest tip damage as well as an oily discoloration. The carrier-pesticide combinations with the best ear quality overall were spinosad in carrageenan or corn oil, and Bt in carrageenan. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Composition of grain and forage from insect-protected and herbicide-tolerant corn, MON 89034 × TC1507 × MON 88017 × DAS-59122-7 (SmartStax), is equivalent to that of conventional corn (Zea mays L.).

Science.gov (United States)

Lundry, Denise R; Burns, J Austin; Nemeth, Margaret A; Riordan, Susan G

2013-02-27

Monsanto Company and Dow AgroSciences LLC have developed the combined-trait corn product MON 89034 × TC1507 × MON 88017 × DAS-59122-7 (SmartStax, a registered trademark of Monsanto Technology LLC). The combination of four biotechnology-derived events into a single corn product (stacking) through conventional breeding provides broad protection against lepidopteran and corn rootworm insect pests as well as tolerance to the glyphosate and glufosinate-ammonium herbicide families. The purpose of the work described here was to assess whether the nutrient, antinutrient, and secondary metabolite levels in grain and forage tissues of the combined-trait product are comparable to those in conventional corn. Compositional analyses were conducted on grain and forage from SmartStax, a near-isogenic conventional corn hybrid (XE6001), and 14 conventional reference hybrids, grown at multiple locations across the United States. No statistically significant differences between SmartStax and conventional corn were observed for the 8 components analyzed in forage and for 46 of the 52 components analyzed in grain. The six significant differences observed in grain components (p corn, as previously demonstrated for the single-event products.

GROWTH, GAS EXCHANGE AND YIELD OF CORN WHEN FERTIGATED WITH BOVINE BIOFERTILIZER

OpenAIRE

THALES VINÍCIUS DE ARAÚJO VIANA; JOÃO GUILHERME ARAÚJO LIMA; GEOCLEBER GOMES DE SOUSA; LUIS GONZAGA PINHEIRO NETO; BENITO MOREIRA DE AZEVEDO

2014-01-01

The bovine biofertilizer applied through irrigation water in the soil (bio fertigation), can be a viable organic source to maintain fertility levels in agricultural production systems. So, this work was aimed at evaluating the effects of different concentrations of bovine biofertilizer applied by fertigation on corn growth, gas exchange and yield. The experiment was conducted under full sun exposure, in Fortaleza, Ceara, in 100 liter (100 L) vessels. The experimental design was that of random...

Phytotoxical effect of Lepidium draba L. extracts on the germination and growth of monocot (Zea mays L.) and dicot (Amaranthus retroflexus L.) seeds.

Science.gov (United States)

Kaya, Yusuf; Aksakal, Ozkan; Sunar, Serap; Erturk, Filiz Aygun; Bozari, Sedat; Agar, Guleray; Erez, Mehmet Emre; Battal, Peyami

2015-03-01

Laboratory experiments were performed to determine phytotoxic potentials of white top (Lepidium draba) methanol extracts (root, stem and leaf) on germination and early growth of corn (Zea mays) and redroot pigweed (Amaranthus retroflexus). Furthermore, the effects of different methanol extracts of L. draba on the phytohormone (indole-3-acetic acid (IAA), gibberellic acid (GA), abscisic acid (ABA) and zeatin) levels of corn and redroot pigweed were investigated. It was observed that all concentrations of methanol extracts of root, stem and leaf of L. draba inhibited germination, radicle and plumule elongation when compared with the respective controls. Besides this, the degree of inhibition was increased in concert with increasing concentrations of extracts used. On the other hand, phytohormone levels changed with the application of different extract concentrations. Comparing with the control, the GA levels significantly decreased while the ABA levels increased in all the application groups. Zeatin and IAA levels showed changes depending upon the applied extracts and concentrations. © The Author(s) 2012.

Expression of a maize Myb transcription factor driven by a putative silk-specific promoter significantly enhances resistance to Helicoverpa zea in transgenic maize.

Science.gov (United States)

Johnson, Eric T; Berhow, Mark A; Dowd, Patrick F

2007-04-18

Hi II maize (Zea mays) plants were engineered to express maize p1 cDNA, a Myb transcription factor, controlled by a putative silk specific promoter, for secondary metabolite production and corn earworm resistance. Transgene expression did not enhance silk color, but about half of the transformed plant silks displayed browning when cut, which indicated the presence of p1-produced secondary metabolites. Levels of maysin, a secondary metabolite with insect toxicity, were highest in newly emerged browning silks. The insect resistance of transgenic silks was also highest at emergence, regardless of maysin levels, which suggests that other unidentified p1-induced molecules likely contributed to larval mortality. Mean survivor weights of corn earworm larvae fed mature browning transgenic silks were significantly lower than weights of those fed mature nonbrowning transgenic silks. Some transgenic pericarps browned with drying and contained similar molecules found in pericarps expressing a dominant p1 allele, suggesting that the promoter may not be silk-specific.

Effects of Drought Stress on Vegetative and Reproductive Stages of Forage and Kernel Corn Hybrids

Directory of Open Access Journals (Sweden)

M Hajibabaei

2016-10-01

Full Text Available Introduction Maize is one of the most important cereals which its global production is severely affected by drought in many parts of the world. One of the best ways of water management on field is to choose the proper variety which could be chosen indirectly by the traits affecting the grain yield. Materials and Methods In order to study the effect of drought stress in vegetative and reproductive stages in 14 corn hybrids, an experiment was conducted at the experimental field of Seed and Plant Improvement Institute of Karaj, in 2009. The Research Station located in 50°, 55´ eastern latitude and 35°, 47´ northern longitude with 1254 height above mean sea level (AMSL. The soil texture of the location was loam-clay with pH= 7.5 and the Electrical Capacity (EC = 0.7 dsm-1. The experiment was carried out using split-plot in a randomized complete block design (RCBD with three replications. The main plots consisted of three levels of irrigation regimes (irrigation after 70, 100 and 130 mm cumulative evaporation from evaporation pan class A and sub-plots included 14 new corn hybrids Includes eleven new hybrids such as (K47/2-2-1-4-1-1-1×MO17، K3653/2×K19، KLM76004/3-2-1-1-1-1-1-1×K3545/6، K3653/2×MO17، K74/2-2-1-2-1-1-1-1×K3545/6، K47/3-1-2-7-1-1-1×MO17، K47/2-2-1-2-2-1-1-1×K3544/1، KLM76004/3-2-1-1-1-1-1-1×K3544/1، K47/2-2-1-2-1-1-1-1×K3544/1، KLM77029/8-1-2-3-2-3×MO17 and KLM76005/2-3-1-1-1-1×MO17 and three hybrid control (KSC704, KSC720, KSC700. Irrigation time was determined using daily evaporation rate of standard class A evaporation pan. To determine the volume of water per irrigation, a sample of each plot from depth of root development was prepared before irrigation. The samples were kept in oven 80°C for 24 hours. The weight of soil moisture content was calculated and the volume of water per irrigation was calculated using equations 1 and 2. 1: H = ρb (F.C - m D 2: V = H × A Where H is the water height in the

Long-term no-till and stover retention each decrease the global warming potential of irrigated continuous corn

Science.gov (United States)

Over the last 50 years, the most increase in cultivated land area globally has been due to a doubling of irrigated land. Long-term agronomic management impacts on soil organic carbon (SOC) stocks, soil greenhouse gas (GHG) emis-sions, and global warming potential (GWP) in irrigated systems, however,...

Corn defense responses to nitrogen availability and subsequent performance and feeding preferences of beet armyworm (Lepidoptera: Noctuidae).

Science.gov (United States)

Ren, Li-Li; Hardy, Giles; Liu, Zhu-Dong; Wei, Wei; Dai, Hua-Guo

2013-06-01

Many studies have reported the effect of nitrogen (N) fertilization on plant constitutive defense responses; however, little is known about their effects on plant induced defense patterns and its consequence for insect herbivores. In our experiments, the effects of N availability on growth, nutritional quality (N content, protein/carbohydrate [P:C] ratio, modified gross energy [MGE]), and constitutive phenolics of corn, Zea mays L. were quantified. Moreover, the indirect effects of N fertilization on the beet armyworm, Spodoptera exigua Hübner through larval performance and feeding preference were examined. N fertilization increased plant growth, and depressed defense traits by increasing N content and the P:C ratio, as well as decreasing the constitutive concentration of phenolics. Subsequently, beet armyworm showed higher performance and preferentially fed on high-N corn because of its low defense traits. After beet armyworm feeding, high-N corn significantly deterred larval feeding, and had negative effects on the performance of beet armyworm through decreasing P:C ratio and increasing induced phenolics. On the contrary, there were no significant changes in P:C ratio and phenolics in low-N corn after feeding damage. Larval performance and preference were also not affected by induced compounds in low-N corn, which suggested that the expression of induced defense was dependent on N availability. The result indicates that N availability can exert a variety of bottom-up effect on plant defense patterns to influence insect population dynamics, and thereby may represent a source of variation in plant-insect interactions.

Treated wastewater and Nitrate transport beneath irrigated fields near Dodge city, Kansas

Science.gov (United States)

Sophocleous, M.; Townsend, M.A.; Vocasek, F.; Ma, Liwang; Ashok, K.C.

2010-01-01

Use of secondary-treated municipal wastewater for crop irrigation south of Dodge City, Kansas, where the soils are mainly of silty clay loam texture, has raised a concern that it has resulted in high nitratenitrogen concentrations (10-50 mg/kg) in the soil and deeper vadose zone, and also in the underlying deep (20-45 m) ground water. The goal of this field-monitoring project was to assess how and under what circumstances nitrogen (N) nutrients under cultivated corn that is irrigated with this treated wastewater can reach the deep ground water of the underlying High Plains aquifer, and what can realistically be done to minimize this problem. We collected 15.2-m-deep cores for physical and chemical properties characterization; installed neutron moisture-probe access tubes and suction lysimeters for periodic measurements; sampled area monitoring, irrigation, and domestic wells; performed dye-tracer experiments to examine soil preferential-flow processes through macropores; and obtained climatic, crop, irrigation, and N-application rate records. These data and additional information were used in the comprehensive Root Zone Water Quality Model (RZWQM2) to identify key parameters and processes that influence N losses in the study area. We demonstrated that nitrate-N transport processes result in significant accumulations of N in the thick vadose zone. We also showed that nitrate-N in the underlying ground water is increasing with time and that the source of the nitrate is from the wastewater applications. RZWQM2 simulations indicated that macropore flow is generated particularly during heavy rainfall events, but during our 2005-06 simulations the total macropore flow was only about 3% of precipitation for one of two investigated sites, whereas it was more than 13% for the other site. Our calibrated model for the two wastewater-irrigated study sites indicated that reducing current levels of corn N fertilization by half or more to the level of 170 kg/ha substantially

THE EFFECT OF WINTER CATCH CROPS ON WEED INFESTATION IN SWEET CORN DEPENDING ON THE WEED CONTROL METHODS

Directory of Open Access Journals (Sweden)

Robert Rosa

2015-02-01

Full Text Available An experiment was carried out in east-central Poland (52°06’ N, 22°55’ E over 2008–2011 to study the effect of winter catch crops on the weed infestation, number, and fresh matter of weeds in sweet corn (Zea mays L. var. saccharata. The following winter catch crops were grown: hairy vetch (Vicia villosa Roth., white clover (Trifolium repens L., winter rye (Secale cereale L., Italian ryegrass (Lolium multiflorum L. and winter turnip rape (Brassica rapa var. typica Posp.. The catch crops were sown in early September and incorporated in early May. The effect of the catch crops was compared to the effect of FYM (30 t·ha-1 and control without organic manuring (NOM. Three methods of weed control were used: HW – hand weeding, twice during the growing period, GCM – the herbicide Guardian Complete Mix 664 SE, immediately after sowing of corn seeds, Z+T – a mixture of the herbicides Zeagran 340 SE and Titus 25 WG applied at the 3–4-leaf stage of sweet corn growth. Rye and turnip rape catch crops had least weeds in their fresh matter. Sweet corn following winter catch crops was less infested by weeds than corn following farmyard manure and non-manured corn. Least weeds and their lowest weight were found after SC, BRT and VV. LM and BRT reduced weed species numbers compared with FYM and NOM. The greatest weed species diversity, determined at the corn flowering stage, was determined after SC and FYM. The number and weight of weeds were significantly lower when chemically controlled compared with hand weeding. The best results were observed after a post-emergent application of the mixture Z+T. The weed species diversity on Z+T-treated plots was clearly lower compared with GCM and HW.

Degradability of dry matter and crude protein of dry grains and wet grain silages from different processing corn hybrids (Zea mays

Directory of Open Access Journals (Sweden)

Wagner dos Reis

2013-03-01

Full Text Available The objective of this work was to evaluate the effect of processing two corn hybrids conserved, dry and humid grains, the dry matter (DM and crude protein (CP degradability in situ. The particle size was determined and difference was verified in MGD (Medium Geometric Diameter of processed ingredients. Three sheep were used with rumen canulated, in a completely randomized design, using a factorial outline 2 x 2 x 3, being two corn hybrid, two conservation methods and three processing forms (whole, coarsely and finely ground, with five times of incubation (3, 6, 12, 24 and 48 hours. The fraction A in SDC (silage of dent corn of DM was superior to GDC (grain of dent corn in all of the particles size. The ensiling process increased the DM solubility, reducing the fraction B in comparison to dry grain. The values regarding the fractions DP and DE the 5% per hour of the protein, were larger for SDC and GDC, it presents a decreasing when the incubation time advances. The fermentation rate was superior for SDC and GDC. The ensiling process has positive effect in the decreasing of DM and CP in comparison to GDC.

Influence of Agricultural Management on Phytochemicals of Colored Corn Genotypes ( Zea mays L.). Part 1: Nitrogen Fertilization.

Science.gov (United States)

Giordano, Debora; Beta, Trust; Vanara, Francesca; Blandino, Massimo

2018-05-02

In this study, the influence of nitrogen (N) fertilization (170 versus 300 kg of N/ha) on the content of bioactive compounds of whole-meal flour of 10 different colored corn genotypes was investigated. Considerable differences in antioxidant capacity and phytochemical concentrations were observed among genotypes. Higher N fertilization rates significantly ( p < 0.05) increased the content of both total cell-wall-bound phenolics and xanthophylls (lutein and zeaxanthin). Nevertheless, the main phenolic acids (ferulic, p-coumaric, and sinapic acids) as well as the antioxidant capacity and content of β-cryptoxanthin, β-carotene, and total anthocyanins did not show significant differences as far as the N fertilization rate is concerned. For corn cultivation, the application of high N fertilization rates, generally carried out to obtain higher grain yields, could positively influence the content of some bioactives particularly in years characterized by high rainfall levels responsible for N leaching from the soil.

Influence of different irrigation and nitrogen levels on crude oil and fatty acid composition of maize (Zea mays L.)

International Nuclear Information System (INIS)

Kaplan, M.; Kale, H.; Karaman, K.; Unlukara, A.

2017-01-01

The effect of irrigation and nitrogen fertilizer levels on the crude oil and fatty acid composition of maize cultivars was studied. Three levels of irrigation (50, 75 and 100% of field capacity) and nitrogen (100, 200 and 300 kg·ha-1) were used for treatment groups. After harvest, the crude oils were extracted and fatty acid profiles were determined by Gas Chromatography system. The study was repeated for two years and the interaction effects of fertilizer and irrigation were determined. Our results show that the crude oil content was affected positively by the fertilizer and the irrigation applications. As expected, the most abundant fatty acid was linoleic and the harvest year did not alter it. The highest linoleic acid content value was obtained with a 50% field capacity and 300 kg·ha-1 fertilizer treatment combination. In addition, fatty acid contents varied with the changing of interaction effects except for myristic and palmitic acid. Oleic acid was the second abundant fatty acid in the oil samples and the lowest oleic acid value was obtained with a 50% field capacity and 300 kg·ha-1 fertilizer treatment combination. Oleic acid content tended to increase with 75% field capacity but 100% field capacity treatment decreased in it. [es

Zea mays L. extracts modify glomerular function and potassium urinary excretion in conscious rats.

Science.gov (United States)

Velazquez, D V O; Xavier, H S; Batista, J E M; de Castro-Chaves, C

2005-05-01

Diuretic and uricosuric properties have traditionally been attributed to corn silk, stigma/style of Zea mays L. Although the diuretic effect was confirmed, studies of the plant's effects on renal function or solute excretion were lacking. Thus, we studied the effects of corn silk aqueous extract on the urinary excretion of water, Na+, K+, and uric acid. Glomerular and proximal tubular function and Na+ tubular handling were also studied. Conscious, unrestrained adult male rats were housed in individual metabolic cages (IMC) with continuous urine collection for 5 and 3 h, following two protocols. The effects of 25, 50, 200, 350, and 500 mg/kg body wt. corn silk extract on urine volume plus Na+ and K+ excretions were studied in water-loaded conscious rats (2.5 ml/100 g body wt.) in the IMC for 5 h (Protocol 1). Kaliuresis was observed with doses of 350 (100.42 +/- 22.32-120.28 +/- 19.70 microEq/5 h/100 g body wt.; n = 13) and 500 mg/kg body wt. (94.97+/- 29.30-134.32 +/- 39.98 microEq/5h/100 g body wt.; n = 12; pcorn silk extract on urine volume, Na+, K+ and uric acid excretions, and glomerular and proximal tubular function, were measured respectively by creatinine (Cler) and Li+ (ClLi) clearances and Na+ tubular handling, in water-loaded rats (5 ml/100 g body wt.) in the IMC for 3 h (Protocol 2). Clcr (294.6 +/- 73.2, n = 12, to 241.7 +/- 48.0 microl/ min/100 g body wt.; n = 13; pcorn silk aqueous extract is diuretic at a dose of 500 mg/kg body wt. and kaliuretic at doses of 350 and 500 mg/kg body wt. In water-loaded conscious rats (5.0 ml/100 g body wt.), corn silk aqueous extract is kaliuretic at a dose of 500 mg/kg body wt., but glomerular filtration and filtered load decrease without affecting proximal tubular function, Na+, or uric acid excretion.

Study of Agronomical and Ecological Parameters of Additive and Replacement Intercropping Systems of Corn (Zea maize L. and Soybean (Glycine max L. Merr.

Directory of Open Access Journals (Sweden)

Issa Piri

2017-12-01

Full Text Available Introduction Intercropping is a multiple cropping agricultural practice involves growing two or more crops in close proximity. Intercropping of compatible plants also encourages biodiversity, by providing a habitat for a variety of insects and soil organisms that would not be present in a monocrop environment. This in turn can help limit outbreaks of crop pests by increasing predator biodiversity. Additionally, reducing the homogeneity of crops increases the barriers against biological dispersal of pests through the crops. Cereal–legume intercropping plays an important role in subsistence food production in developing countries, especially in the situations of limited resources. Nitrogen fixing legumes can be included to a greater extent in arable cropping systems via intercrops. Legumes contribute to maintaining the soil fertility via nitrogen fixation, which is increased in intercrops due to the more competitive character of the cereal for soil inorganic N. Ariel et al., (2013 showed that,Legume-Cereal Intercropping of corn and soybean may be advantageous compared to monocultures. Corn and soybean intercropping produce high yields of green matter and seed concentrates especially when the corn-soybean ratio is 1:2. Due to the importance of cereal–legume intercropping in the sustainability of agricultural systems, the objective of this study was to determine the effects of cereal-legume intercropping on the total biomass and grain yield and to find the best pattern of additive and replacement intercropping systems in Iranshahr Region. Material and Methods In order to study the agronomical and ecological parameters of additive and replacement intercropping systems of corn and soybean, a field experiment was conducted in 2012-13 in the south of Iranshahr city on a randomized complete block design with three replications. Treatments consisted of 8 different intercropping ratios: corn monoculture (C100S0 and soybean monoculture (C0S100 as sole

Rendimento do milho em diferentes condições físicas de solo e quantidade de resíduo na ausência ou na presença de irrigação Corn response in different physical conditions of soil and amount soil cover residues with or without irrigation

Directory of Open Access Journals (Sweden)

Osmar Conte

2009-07-01

Full Text Available Visando avaliar o efeito do tráfego de máquinas, da profundidade de atuação da haste sulcadora de adubo e da quantidade de resíduos presentes na superfície do solo sobre o desempenho do milho, com e sem irrigação, foi conduzido um experimento, em semeadura direta, sobre um Argissolo Vermelho Distrófico. O delineamento foi de blocos casualizados (DBC, com 36 parcelas, sendo 18 irrigadas e 18 sem irrigação. Os tratamentos consistiram de seis doses de resíduos de aveia preta consorciada com ervilhaca (0, 2, 4, 5, 6 e 8Mg ha-1, duas profundidades teóricas de atuação da haste sulcadora de adubo da semeadora (6 e 12cm e duas condições de tráfego de máquinas (trator e colhedora, sendo enquadrados numa análise trifatorial com três repetições. A semeadura do milho foi realizada em 10 de dezembro de 2005, com densidade de 62.000 sementes por hectare. A adubação usada foi de 400kg ha-1 da formulação NPK 5-20-20 e duas aplicações de nitrogênio, totalizando 180kg ha-1. Foram avaliados o rendimento de grãos, a população e a matéria seca de raízes. Tanto a população de plantas, quanto o rendimento de grãos do milho, foram influenciados pela presença ou não de irrigação. A profundidade de atuação das hastes sulcadoras não interferiu em nenhumas das variáveis avaliadas no milho. A condição de tráfego de rodado afetou a produtividade e a população de plantas.This study evaluates the effect of machine traffic, soil mobilization, soil cover by crop residues and water supply on corn under no tillage on a Paleudult. Machine traffic intensity, working depth of driller shank furrow opener for fertilizer deposition and amount of residues covering the soil surface, with and without irrigation, were evaluated. The experimental design used was split plot, with 36 plots being 18 with irrigation and 18 without irrigation. The treatments were quantities (0, 2, 4, 5, 6 and 8Mg ha-1 of black oats (Avena strigosa and vetch

Utility of the end-of-season nitrate test for nitrogen sufficiency of irrigated maize under Mediterranean semi-arid conditions

Energy Technology Data Exchange (ETDEWEB)

Isla, R.; Salmeron, M.; Cavero, J.; Yagüe, M.R.; Quilez, D.

2015-07-01

Calibration of decision tools to improve N fertilizer management is critical to increase its adoption by maize (Zea mays L.) growers. The objective of this study was to establish nitrate and total nitrogen concentrations in the basal maize stalks (BMS) at harvest to separate maize fields among three N availability categories (N-deficient, N-optimum, and N-excess) under Mediterranean irrigated semiarid conditions. We analysed data from 26 irrigated maize trials conducted between 2001 and 2012. Trials included treatments receiving different N fertilizer rates and sources (mineral and organic), irrigation systems (flood, sprinkler) and soil types. The critical nitrate concentration in BMS to identify N-deficient plots (CNCL) is affected by the irrigation system. The CNCL was lower under sprinkler irrigation (708 mg NO{sub 3}{sup -}–N/kg) than under flood irrigation (2205 mg NO{sub 3}{sup -}–N/kg), and the later presented a higher degree of uncertainty compared to sprinkler irrigated systems. The results showed the difficulty to identify the N-deficient plots with the BMS test and the higher sensibility of nitrate-N than total-N concentration in BMS to separate N-deficient from N-optimal plots. Under sprinkler irrigation, nitrate in BMS>1500 mg NO{sub 3}{sup -}–N/kg had a 85% probability of having received an excess of N. Considering economic net returns to N fertilization, the range of nitrate concentration in BMS that maximized profit under sprinkler-irrigated conditions was established between 1100 and 1700 mg NO3-–N/kg. Results suggest that BMS test can be useful in detecting plots with an excess of N but considering irrigation efficiency is crucial for stablishing successful CNC thresholds. (Author)

Aquatic degradation of Cry1Ab protein and decomposition dynamics of transgenic corn leaves under controlled conditions.

Science.gov (United States)

Böttger, Rita; Schaller, Jörg; Lintow, Sven; Gert Dudel, E

2015-03-01

The increasing cultivation of genetically modified corn plants (Zea mays) during the last decades is suggested as a potential risk to the environment. One of these genetically modified variety expressed the insecticidal Cry1Ab protein originating from Bacillus thuringiensis (Bt), resulting in resistance against Ostrinia nubilalis, the European corn borer. Transgenic litter material is extensively studied regarding the decomposition in soils. However, only a few field studies analyzed the fate of the Cry1Ab protein and the impact of green and senescent leaf litter from corn on the decomposition rate and related ecosystem functions in aquatic environments. Consequently, a microbial litter decomposition experiment was conducted under controlled semi-natural conditions in batch culture using two maize varieties: one variety with Cry1Ab and another one with the appertaining Iso-line as control treatment. The results showed no significant differences between the treatment with Cry1Ab and the Iso-line regarding loss of total mass in dry weight of 43% for Iso-line and 45% for Bt-corn litter, lignin content increased to 137.5% (Iso-line) and 115.7% (Bt-corn), and phenol loss decreased by 53.6% (Iso-line), 62.2% (Bt-corn) during three weeks of the experiment. At the end of the experiment Cry1Ab protein was still detected with 6% of the initial concentration. A slightly but significant lower cellulose content was found for the Cry1Ab treatment compared to the Iso-line litter at the end of the experiment. The significant higher total protein (25%) and nitrogen (25%) content in Bt corn, most likely due to the additionally expression of the transgenic protein, may increase the microbial cellulose degradation and decrease microbial lignin degradation. In conclusion a relevant year by year input of protein and therefore nitrogen rich Bt corn litter into aquatic environments may affect the balanced nutrient turnover in aquatic ecosystems. Copyright © 2014 Elsevier Inc. All rights

Defining the Insect Pollinator Community Found in Iowa Corn and Soybean Fields: Implications for Pollinator Conservation.

Science.gov (United States)

Wheelock, M J; Rey, K P; O'Neal, M E

2016-10-01

Although corn (Zea mays L.) and soybeans (Glycine max L.) do not require pollination, they offer floral resources used by insect pollinators. We asked if a similar community of insect pollinators visits these crops in central Iowa, a landscape dominated by corn and soybean production. We used modified pan traps (i.e., bee bowls) in both corn and soybean fields during anthesis and used nonmetric multidimensional scaling (NMS) to compare the communities found in the two crops. Summed across both crops, 6,704 individual insects were captured representing at least 60 species, morphospecies, or higher-level taxa. Thirty-four species were collected in both crops, 19 collected only in corn and seven were collected only in soybean. The most abundant taxa were Lasioglossum [Dialictus] spp., Agapostemon virescens Cresson, Melissodes bimaculata (Lepeletier), and Toxomerus marginatus (Say), which accounted for 65% of the insect pollinators collected from both crops. Although social bees (Apis mellifera L. and Bombus spp.) were found in both crops, they accounted for only 0.5% of all insects captured. The NMS analysis revealed a shared community of pollinators composed of mostly solitary, ground nesting bees. Many of these species have been found in other crop fields throughout North America. Although corn and soybean are grown in landscapes that are often highly disturbed, these data suggest that a community of pollinators can persist within them. We suggest approaches to conserving this community based on partnering with activities that aim to lessen the environmental impact of annual crop production. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Corn stover harvest increases herbicide movement to subsurface drains: RZWQM simulations

Science.gov (United States)

Shipitalo, Martin J.; Malone, Robert W.; Ma, Liwang; Nolan, Bernard T.; Kanwar, Rameshwar S.; Shaner, Dale L.; Pederson, Carl H.

2016-01-01

BACKGROUND Crop residue removal for bioenergy production can alter soil hydrologic properties and the movement of agrochemicals to subsurface drains. The Root Zone Water Quality Model (RZWQM), previously calibrated using measured flow and atrazine concentrations in drainage from a 0.4 ha chisel-tilled plot, was used to investigate effects of 50 and 100% corn (Zea mays L.) stover harvest and the accompanying reductions in soil crust hydraulic conductivity and total macroporosity on transport of atrazine, metolachlor, and metolachlor oxanilic acid (OXA). RESULTS The model accurately simulated field-measured metolachlor transport in drainage. A 3-yr simulation indicated that 50% residue removal decreased subsurface drainage by 31% and increased atrazine and metolachlor transport in drainage 4 to 5-fold when surface crust conductivity and macroporosity were reduced by 25%. Based on its measured sorption coefficient, ~ 2-fold reductions in OXA losses were simulated with residue removal. CONCLUSION RZWQM indicated that if corn stover harvest reduces crust conductivity and soil macroporosity, losses of atrazine and metolachlor in subsurface drainage will increase due to reduced sorption related to more water moving through fewer macropores. Losses of the metolachlor degradation product OXA will decrease due to the more rapid movement of the parent compound into the soil.

Effect of Light- and Dark-Germination on the Phenolic Biosynthesis, Phytochemical Profiles, and Antioxidant Activities in Sweet Corn (Zea mays L.) Sprouts.

Science.gov (United States)

Xiang, Nan; Guo, Xinbo; Liu, Fengyuan; Li, Quan; Hu, Jianguang; Brennan, Charles Stephen

2017-06-10

Sweet corn is one of the most widely planted crops in China. Sprouting of grains is a new processes to increase the nutritional value of grain products. The present study explores the effects of light on the nutritional quality of sweet corn sprouts. Gene expression of phenolic biosynthesis, phytochemical profiles and antioxidant activity were studied. Two treatments (light and dark) were selected and the morphological structure of sweet corn sprouts, as well as their biochemical composition were investigated to determine the effects of light on the regulation of genes responsible for nutritional compounds. Transcription analyses for three key-encoding genes in the biosynthesis of the precursors of phenolic were studied. Results revealed a negative regulation in the expression of Zm PAL with total phenolic content (TPC) in the light group. TPC and total flavonoid content (TFC) increased during germination and this was correlated with an increase in antioxidant activity ( r = 0.95 and 1.0). The findings illustrate that the nutritional value of sweet corn for the consumer can be improved through germination to the euphylla stage.

Uronide Deposition Rates in the Primary Root of Zea mays1

Science.gov (United States)

Silk, Wendy Kuhn; Walker, Robert C.; Labavitch, John

1984-01-01

The spatial distribution of the rate of deposition of uronic acids in the elongation zone of Zea mays L. Crow WF9 × Mo 17 was determined using the continuity equation with experimentally determined values for uronide density and growth velocity. In spatial terms, the uronide deposition rate has a maximum of 0.4 micrograms per millimeter per hour at s = 3.5 mm (i.e., at the location 3.5 mm from the root tip) and decreases to 0.1 mg mm−1 h−1 by s = 10 mm. In terms of a material tissue element, a tissue segment located initially from s = 2.0 to s = 2.1 mm has 0.14 μg of uronic acids and increases in both length and uronic acid content until it is 0.9 mm long and has 0.7 μg of uronide when its center is at s = 10 mm. Simulations of radioactive labeling experiments show that 15 min is the appropriate time scale for pulse determinations of deposition rate profiles in a rapidly growing corn root. PMID:16663488

Morpho-Productive and Chemical Composition of Local and Foreign Sweet Corn Hybrids Grown in the Conditions of Transylvania Plateau

Directory of Open Access Journals (Sweden)

Luana PĂCURAR

2017-11-01

Full Text Available Sweet corn (Zea mays L. belongs to the Gramineae family, var. rugosa (Bonof convar. Saccharate (Sturt. and can be distinguished from normal corn by presence of one or more mutant genes that affect carbohydrate metabolism in endosperm. Purpose of this research is to compare behavior of sweet corn hybrids created at SCDA Turda, but also foreign hybrids, in terms of quality elements and chemical composition, in conditions of Transylvania plateau, in two localities: Turda and Viişoara. As biological material following domestic sweet corn hybrids were chosen: ‘Prima’, ‘Estival’, ‘Deliciul verii’, ‘Dulcin’, ‘Delicios’, ‘Estival M’ and foreign hybrid ‘Jubilee’. These hybrids were also analyzed in terms of chemical composition. Weight of ‘Estival’ hybrid has the best behavior in both localities; as regards to cobs length, ‘Delicios’ hybrid has registered increases very significant positive, differences between plant height in the two localities confirm significant influence of environment on formation of this important typical qualitative characteristics, highest performances in terms of β-cryptoxanthin and zeaxanthin content, are recorded by ‘Jubilee’ in both localities, ‘Deliciul Verii’ hybrid records significant value for lutein content, also recording an important addition of carbohydrates in Turda, ‘Prima’ and ‘Estival’ hybrids recorded highest values of sucrose in both localities.

Use of natural enemies and biorational pest control of corne

Directory of Open Access Journals (Sweden)

Cipriano García Gutiérrez

2012-09-01

Full Text Available A general analysis of the potential use of natural enemies and biorational insecticides for control of main pests of corn in thestate of Sinaloa is presented. A discuss on their composition, dosage, toxicity and type of effect on beneficial organisms(natural enemies and pollinators is too included. The work revealed that is possible implement the use of these natural enemies and products for the control of neonate larvae of Spodoptera frugiperda fall armyworm (J. E Smith with Nomuraea rileyi (Farlow (Samson; against thrips Frankliniella occidentalis (Pergande using the nematodes Steinernema riobravis (Cabanillas and Poinar, S. feltiae (Filipjev and Heterorhabditis bacteriophora (Poinar at doses of 10,000 IJ (4x10 ~ IJ/m; against the corn silk fly Euxesta stigmatias (Loew encouraging the natural parasitism of Spalangia sp., while for the cutworm Agrotis ipsilon (Hufnagel can be with spinosad (soluble concentrate at doses of 0.123 kg a. i, and to the corn earwormHelicoverpa zea (Boddie using the analog of methoxyfenozide molting hormone (24% at 144 mg of a. i/L. The biorational control agents that not affect significantly to the natural enemies were the nucleopoliedrosis virus SfMNPV and SeMNPV; N. rileyi and Isaria fumosorosea (Wize; Bacillus thuringiensis (Berlinier; the azadirachtin (neem and parasitoids. In the case of products of chemical synthesis: Spinosad, oxymatrine and bifenthrin showed high rates of mortality in the control of corn pests, so these are considered as of high and moderate risk to Aphis mellifera (L. bees, the methoxyfenozide presented relatively low toxicity to natural enemies. In general, biorational products have repellent effect on larvae and adults of these insects, inhibit feeding and induce molting, also causing deformities and impede the development and growth, too interfere with sexual intercourse and copulate, reducing the oviposition, as well as cause sterility of adults, so these may also constitute a risk to

The potential of Zea mays, Commelina bengelensis, Helianthus annuus and Amaranthus hybridus for phytoremediation of waste water

Directory of Open Access Journals (Sweden)

Chacha Joseph Sarima

2012-12-01

Full Text Available Waste-water from domestic use and from industrial effluent burden the water systems with high levels of heavy metal hence there is need to remove these heavy metals so that the waste water can be recycled for use for household or irrigation. The present study has screened Zea mays (maize, Commelina bengelensis (wondering jew, Helianthus annuus (sunflower and Amaranthus hybridus (amaranthus for their ability to bioaccumulate Pb, Cu, Cd and Zn metals. The results obtained show that the H. annuus and C. bengelensis plant have promising potential for removal of Pb, Cu and Cd from wastewater though their ability to remove Zn from contaminated solutions is not much different from that of Z. mays and A. hybridus.

Western bean cutworm survival and the development of economic injury levels and economic thresholds in field corn.

Science.gov (United States)

Paula-Moraes, S; Hunt, T E; Wright, R J; Hein, G L; Blankenship, E E

2013-06-01

Western bean cutworm, Striacosta albicosta (Smith) (Lepidoptera: Noctuidae), is a native pest of dry beans (Phaseolus vulgaris L.) and corn (Zea mays L.). Historically, the western bean cutworm was distributed in the western United States, but since 1999 eastward expansion has been observed. In corn, economic impact is caused by larval ear feeding. Information on western bean cutworm biology, ecology, and economic impact is relatively limited, and the development of economic injury levels (EILs) and economic thresholds (ETs) is required for more effective management. Studies during 2008-2011, across three ecoregions of Nebraska, sought to characterize western bean cutworm survival and development of EILs and ETs. Calculations of EILs and ETs incorporated the dynamics of corn price, management cost, and pest survival. The results from the current study demonstrated low larval survival of this species (1.51-12.82%). The mean yield loss from one western bean cutworm larva per plant was 945.52 kg/ha (15.08 bu/acre), based on 74,100 plants per ha. Economic thresholds are expressed as a percentage of plants with at least one egg mass. This study is the first study that explicitly incorporates variable management costs and crop values into western bean cutworm EIL calculations, and larval survival into ET calculations.

Application of Polyacrylamide (PAM) through Lay-Flat Polyethylene Tubing: Effects on Infiltration, Erosion, N and P Transport, and Corn Yield.

Science.gov (United States)

McNeal, J P; Krutz, L J; Locke, M A; Kenty, M M; Atwill, R L; Pickelmann, D M; Bryant, C J; Wood, C W; Golden, B R; Cox, M S

2017-07-01

Polyacrylamides (PAMs), when applied as a soil amendment, purportedly improve soil infiltration, decrease erosion, and reduce offsite agrochemical transport. The effect of PAM on infiltration, erosion, agrochemical transport, and crop yield when applied in furrow to mid-southern US production systems has not been evaluated. The objective of this study was to assess PAM effects on infiltration, erosion, corn ( L.) grain yield, and nitrogen (N) and phosphorus (P) transport when applied at 10 mg L through lay-flat polyethylene tubing. A 2-yr field study was conducted at the Mississippi State Delta Research and Extension Center in Stoneville, MS, on a Dundee silt loam and a Forestdale silty clay loam. The experimental design was a randomized complete block with four replications of each treatment: irrigated plus no PAM (control) and irrigated plus PAM at 10 mg L. Each irrigation event delivered 102 mm of water at 18.9 L m per furrow, and runoff was captured in a holding tank on the lower end of each plot. Pooled over year and soil texture, PAM increased infiltration and corn grain yield by 6% ( ≤ 0.0398). Polyacrylamide effects on the offsite transport of sediment and N and P were inconsistent, varying across year and soil texture. Results indicate that PAM improves infiltration and corn grain yield on silt loam and silty clay loam textured soils; however, further research is required before PAM can be recommended as a best management practice for mitigating erosion and offsite agrochemical transport in mid-southern production systems. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Corn rootworm area-wide management across the United States

International Nuclear Information System (INIS)

Chandler, Laurence D.; Coppedge, James R.; Richard Edwards, C.; Tollefson, Jon J.; Wilde, Gerald E.

2000-01-01

The western corn rootworm, Diabrotica virgifera virgifera LeConte, northern corn rootworm, D. barberi Smith and Lawrence, and Mexican corn rootworm, D. virgifera zeae Krysan and Smith are among the most economically and environmentally important pests of United States maize (Zea mays L.) production systems (Metcalf 1986). Annually, 8 to 10 million hectares of maize are treated with soil applied insecticides to protect the crop from larval feeding damage. Crop rotation, however, is also widely used to minimise the need for soil insecticide applications. Insecticides for adult rootworm management are also frequently used. Numerous problems are currently associated with corn rootworm management approaches. Soil insecticides are normally used to protect maize roots from larval feeding damage. However, they are ineffective in controlling the management of corn rootworm populations (Gray et al. 1992, Sutter et al. 1991). It is not uncommon for large numbers of rootworms to develop within treated fields. Thus, when maize is grown in the same field year after year (continuous cropping), soil insecticide applications must be used to protect the plant. These applications are generally made without knowledge (prophylactic) of the rootworm population levels within the field due to the difficulty of sampling for immature life stages. Western corn rootworm resistance to chlorinated hydrocarbon insecticides has been extensively documented (Ball and Weekman 1962). Recently, two distinct populations of western corn rootworms in Nebraska were found to be resistant to carbaryl and methyl parathion which are commonly used for adult control (Meinke et al. 1998). Although the occurrence of resistance has not spread outside of these areas, the potential for increased tolerance of western corn rootworm populations to carbamate and organophosphate insecticides across the region does exist. In response to many of the management problems discussed above, scientists with the USDA Agricultural

Uptake and phytotoxicity of the herbicide metsulfuron methyl in corn root tissue in the presence of the safener 1,8-naphthalic anhydride

International Nuclear Information System (INIS)

Milhomme, H.; Bastide, J.

1990-01-01

Growth of Zea mays L. cv Potro roots was inhibited by the herbicide metsulfuron methyl (MSM) at the lowest concentration tested: 5 nanomoles per liter. Pretreatment of corn seeds with commercial 1,8-naphthalic anhydride (NA) at 1% (w/w) partially reversed MSM-induced root growth inhibition. MSM at a concentration of 52 nanomoles per liter was taken up rapidly by roots and accumulated in the corn tissue to concentrations three times those in the external medium; the safener NA increased MSM uptake up to 48 hours. The protective effect of NA was related to the ability of the safener to increase the metabolism of MSM; ten-fold increases in the metabolic rates of MSM were observed in NA-pretreated corn seedlings grown for 48 hours on 52 nanomolar [ 14 C]MSM solution. DNA synthesis determined by measurement of [ 3 H]thymidine incorporation into DNA was inhibited by root MSM applications; after a 6-hour application period, 13 nanomolar MSM solution reduced DNA synthesis by 64%, and the same reduction was also observed with NA-treated seedlings. Pretreatment of corn seeds with safener NA did not increase the acetolactate synthase activity in the roots and did not change, up to 13 micromoles per liter, the in vitro sensitivity of roots to MSM

Agricultural irrigated land-use inventory for Jackson, Calhoun, and Gadsden Counties in Florida, and Houston County in Alabama, 2014

Science.gov (United States)

Marella, Richard L.; Dixon, Joann F.

2015-09-18

A detailed inventory of irrigated crop acreage is not available at the level of resolution needed to accurately estimate water use or to project future water demands in many Florida counties. This report provides a detailed digital map and summary of irrigated areas for 2014 within Jackson, Calhoun, and Gadsden Counties in Florida, and Houston County in Alabama. The irrigated areas were delineated using land-use data and orthoimagery that were then field verified between June and November 2014. Selected attribute data were collected for the irrigated areas, including crop type, primary water source, and type of irrigation system. Results of the 2014 study indicate that an estimated 31,608 acres were irrigated in Jackson County during 2014. This estimate includes 25,733 acres of field crops, 1,534 acres of ornamentals and grasses (including pasture), and 420 acres of orchards. Specific irrigated crops include cotton (11,759 acres), peanuts (9,909 acres), field corn (2,444 acres), and 3,235 acres of various vegetable (row) crops. The vegetable acreage includes 1,714 acres of which 857 acres were planted with both a spring and fall crop on the same field (double cropped). Overall, groundwater was used to irrigate 98.6 percent of the total irrigated acreage in Jackson County during 2014, whereas surface water and wastewater were used to irrigate the remaining 1.4 percent.

Yield and fruit quality of four sweet corn hybrids (Zea mays) under conventional and integrated fertilization with vermicompost.

Science.gov (United States)

Lazcano, Cristina; Revilla, Pedro; Malvar, Rosa Ana; Domínguez, Jorge

2011-05-01

Vermicompost has been proposed as a valuable fertilizer for sustainable agriculture. The effects of vermicompost on yield and quality of sweet corn were evaluated in this study. In two field trials, sweet corn plants were grown under (i) a conventional fertilization regime with inorganic fertilizer, and integrated fertilization regimes in which 75% of the nutrients were supplied by the inorganic fertilizer and 25% of the nutrients were supplied by either (ii) rabbit manure, or (iii) vermicompost. All three types of fertilization regime were supplied at two doses. Two pairs of nearly isogenic sweet corn hybrids homozygous for sugary1 and shrunken2 mutants were included in the trials to explore fertilizer × genotype interactions. Growth, yield and ear quality of the plants were evaluated in relation to the three fertilization regimes. In general, the integrated regimes yielded the same productivity levels as the conventional treatment. Moreover, both vermicompost and manure produced significant increases in plant growth and marketable yield, and also affected the chemical composition and quality of the marketable ear. Nevertheless, most of the observed effects of the organic fertilizers were genotype-dependent. The results confirm that the use of organic fertilizers such as vermicompost has a positive effect on crop yield and quality. Nevertheless, these effects were not general, indicating the complexity of the organic amendment-plant interactions and the importance of controlling genetic variation when studying the effects of vermicompost on plant growth. Copyright © 2011 Society of Chemical Industry.

Differential Concentrations of some Nutrient Element in Forage of Corn (Zea mays L. as Affected by Organic Fertilizers and Soil Compaction

Directory of Open Access Journals (Sweden)

N. Najafi

2016-01-01

Full Text Available Soil compaction is one of the most important limiting factor for normal crop growth, because it reduces absorption by the plant. Application of organic fertilizers in agricultural soils can reduce the detrimental effects of soil compaction on plant growth and also supply some nutrients to plant. Thus, a factorial experiment was carried out in a randomized complete block design with three replications and 14 treatments to evaluate the effects of organic fertilizers in mitigating soil compaction. The first factor in this study was the source and amount of organic fertilizer at seven levels (control, farmyard manure, sewage sludge compost and municipal solid waste compost and each of organic fertilizers at two levels of 15 and 30 g/kg of soil. The second factor was soil compaction at two levels (bulk density of 1.2 and 1.7 g/cm3. To perform this experiment, 10 kg of dry soil was poured into special PVC pots and then seeds of single cross 704 corn were planted. At the end of the growth period, the corn shoot was harvested and concentrations of phosphorus (P, potassium (K, sodium (Na, iron (Fe, zinc (Zn, manganese (Mn, cadmium (Cd and lead (Pb were determined by dry ashing method. The results showed that concentrations of Cd and Pb in the shoot, related to the different treatments, were negligible. Concentrations of P, K, Fe, Mn and Zn in the corn shoot were increased significantly by application of farmyard manure, sewage sludge compost and municipal solid waste compost at both levels of soil compaction. However, Na concentration of shoot did not change significantly. Soil compaction significantly reduced P, Fe, Mn and Zn concentrations of corn shoot, but it affected concentrations of Na and K significantly. Application of organic fertilizers and increasing their levels reduced the negative effects of soil compaction on nutrients uptake by corn plant. This study showed that to improve forage corn nutrition, application of 15 or 30 g of farmyard

Recurrent Selection and Participatory Plant Breeding for Improvement of Two Organic Open-Pollinated Sweet Corn (Zea mays L. Populations

Directory of Open Access Journals (Sweden)

Adrienne C. Shelton

2015-04-01

Full Text Available Organic growers face unique challenges when raising sweet corn, and benefit from varieties that maintain high eating quality, germinate consistently, deter insect pests, and resist diseases. Genotype by environment rank changes can occur in the performance of cultivars grown on conventional and organic farms, yet few varieties have been bred specifically for organic systems. The objective of this experiment was to evaluate the changes made to open-pollinated sweet corn populations using recurrent selection and a participatory plant breeding (PPB methodology. From 2008 to 2011, four cycles of two open-pollinated (OP sweet corn populations were selected on a certified organic farm in Minnesota using a modified ear-to-row recurrent selection scheme. Selections were made in collaboration with an organic farmer, with selection criteria based on traits identified by the farmer. In 2012 and 2013, the population cycles were evaluated in a randomized complete block design in two certified organic locations in Wisconsin, with multiple replications in each environment. Significant linear trends were found among cycles of selection for quantitative and qualitative traits, suggesting the changes were due to recurrent selection and PPB methodology for these populations. However, further improvement is necessary to satisfy the requirements for a useful cultivar for organic growers.

Cotton, tomato, corn, and onion production with subsurface drip irrigation – a review

Science.gov (United States)

The usage of subsurface drip irrigation (SDI) has increased by 89% in the USA during the last ten years according to USDA NASS estimates and over 93% of the SDI land area is located in just ten states. Combining public entity and private industry perceptions of SDI in these ten states, the major cro...

Pengaruh Tepung Cangkang Telur dan Pupuk Kandang Ayam Terhadap pH, Ketersediaan Hara P dan Ca Tanah Inseptisol dan Serapan P dan Ca pada Tanaman Jagung (Zea mays .L)

OpenAIRE

Simanjuntak, Desi

2017-01-01

This study was to know the effect of eggshell flour and manure in increasing soil pH, P- availability and Ca of inceptisol with P-absorption and Ca-absorption of corn (Zea mays L.). The research had been conducted from march to september 2015 at screen hoise faculty of agriculture,USU. The experimental design used was Randomized Block Design with 2 factors and 2 replications. The first factor was dosage of manure 0, 18,75, 37,5 and 56,25g /5 Kg soil and the second factor was dosage of chic...

Effect of Drought Stress During Phenological Stage and Biofertilizer and Nitrogen Application on Yield and Yield Components of Corn (KSC 704

Directory of Open Access Journals (Sweden)

M. Ashkavand

2013-06-01

Full Text Available To study the effect of cutting irrigation and application of biofertilizer and nitrogen on yield and yield components of corn single cross hybrid, an experiment was carried out in Satloo Agricultural and Natural resources Research Station of west Azarbaijan, 2009-2010. This experiment was arranged as split plot based on Randomized Complete Block Design with three replications.Four irrigation factors including I1, I2, I3 and I4, respectively: cutting irrigations at stem elongation, blossom and seed filling stages and normal irrigation assigned to main plots and fertilizer treatments consisted of Nitoxin + 50% urea (F1 , Niragin + 50% urea (F2 , and without biofertilizer application + 100% urea (F3 were allocated to sub plots.Results indicated that the effect of cutting irrigations had negative and significant effects on all characteristics; Fertilizer treatments on the other hand had significant effect only on seed numbers per ear, 100 seeds weight and seed yield. The highest seed yield was obtained under normal irrigation and treatment of Nitragin + 50% urea (12320.7 kg/ha and 11100.5 kg/ha respectively.

Modeling nitrate leaching and optimizing water and nitrogen management under irrigated maize in desert oases in Northwestern China.

Science.gov (United States)

Hu, Kelin; Li, Yong; Chen, Weiping; Chen, Deli; Wei, Yongping; Edis, Robert; Li, Baoguo; Huang, Yuanfang; Zhang, Yuanpei

2010-01-01

Understanding water and N transport through the soil profile is important for efficient irrigation and nutrient management to minimize nitrate leaching to the groundwater, and to promote agricultural sustainable development in desert oases. In this study, a process-based water and nitrogen management model (WNMM) was used to simulate soil water movement, nitrate transport, and crop growth (maize [Zea mays L.]) under desert oasis conditions in northwestern China. The model was calibrated and validated with a field experiment. The model simulation results showed that about 35% of total water input and 58% of the total N input were leached to <1.8 m depth under traditional management practice. Excessive irrigation and N fertilizer application, high nitrate concentration in the irrigation water, together with the sandy soil texture, resulted in large nitrate leaching. Nitrate leaching was significantly reduced under the improved management practice suggested by farm extension personnel; however, the water and nitrate inputs still far exceeded the crop requirements. More than 1700 scenarios combining various types of irrigation and fertilizer practices were simulated. Quantitative analysis was conducted to obtain the best management practices (BMPs) with simultaneous consideration of crop yield, water use efficiency, fertilizer N use efficiency, and nitrate leaching. The results indicated that the BMPs under the specific desert oasis conditions are to irrigate the maize with 600 mm of water in eight times with a single fertilizer application at a rate of 75 kg N ha(-1).

Effect of integrated plant nutrition and irrigation scheduling on yield and yield components of maize (zea mays l.)

International Nuclear Information System (INIS)

Randhawa, M.S.; Maqsood, M.; Wajid, S.A.; Haq, A.U.

2012-01-01

Effect of three irrigation schedules (4-6 irrigations) and seven integrated plant nutrition levels (control, 125-60-62 kg N-P/sub 2/O/sub 5/-K/sub 2/O ha/sup -1/, 125-60-62 kg N-P/sub 2/O/sub 5/--K/sub 2/O ha/sup -1/ + Farmyard manure at the rate 10 t ha/sup -1/, 125-60-62 kg N-P/sub 2/O/sub 5/-K/sub 2/O ha/sup -1/ + Farm yard manure at the rate 15 t ha-1, 250-120-125 kg N-P/sub 2/O/sub 5/--K/sub 2/O ha-1, 250-120-125 kg N-P/sub 2/O/sub 5/ -K/sub 2/O ha/sup -1/ + Farmyard manure at the rate 10 t ha-1 and 250-120-125 kg N-P/sub 2/O/sub 5/--K/sub 2/O ha/sup -1/ + Farmyard manure at the rate 15 t ha/sup -1/) on grain yield and its components in maize were studied during 2009 and 2010. Plant height, number of cobs plant-1, number of grain rows cob-1, number of grains cob-1, 1000-grain weight, grain weight cob-1, grain yield, stover yield and biological yield were significantly affected by irrigation schedules and integrated plant nutrition levels during both years. The crop applied with six irrigations and fertilized by integrated application of chemical fertilizers (250-120-125 kg N-P/sub 2/O/sub 5/--K/sub 2/O ha/sup -1/) and farmyard manure (15 t ha/sup -1/) produced the highest grain yield of 8.47 t ha/sup -1/ and 8.22 t ha/sup -1/ during 2009 and 2010, respectively. (author)

Degradability of dry matter and crude protein of dry grains and wet grain silages from different processing corn hybrids (Zea mays)

OpenAIRE

Wagner dos Reis; Ciniro Costa; Paulo Roberto de Lima Meirelles; Marina Gabriela Berchiol da Silva; Marco Aurélio Factori; Janaína Conte Hadlich; Kátia de Oliveira; Erikelly Aline Ribeiro de Santana; Cristiano Magalhães Pariz; Josineudson Augusto II de Vasconcelos Silva

2013-01-01

The objective of this work was to evaluate the effect of processing two corn hybrids conserved, dry and humid grains, the dry matter (DM) and crude protein (CP) degradability in situ. The particle size was determined and difference was verified in MGD (Medium Geometric Diameter) of processed ingredients. Three sheep were used with rumen canulated, in a completely randomized design, using a factorial outline 2 x 2 x 3, being two corn hybrid, two conservation methods and three processing forms ...

Macronutrients leaf contents of corn in intercropping with forages of genus Panicum and Urochloa in simultaneous seeding

Directory of Open Access Journals (Sweden)

Denise Tsuzukibashi

2013-12-01

Full Text Available The planting of crops in degraded pasture areas is a formula used for decades by farmers to recover the productive capacity of pastures and soils. The integrated crop-livestock (ICL consists of different production systems of grains, fibers, wood, meat, milk and agro-deployed in the same area, in intercrop, rotation or succession. Typically this integration mainly involves the planting of grain and pasture in the recovery or deployment. This work aimed to evaluate the macronutrients leaf contents of irrigated corn intercropped with forages of the genus Panicum and Urochloa simultaneously to sown corn. The experiment was conducted at the Farm for Teaching, Research and Extension, Faculty of Engineering - UNESP, Ilha Solteira in an Oxisol in Savannah conditions, in experimental area that had a history of no-tillage to 8 years (previous crop corn. The experimental design used was randomized blocks with four replications and five treatments: Panicum maximum cv. Tanzania sown simultaneously (CTS corn; Panicum maximum cv. Mombaça sown simultaneously (CMS to corn; Urochloa brizantha cv. Xaraes sown simultaneously (CBS corn; Urochloa ruziziensis sown simultaneously (CRS to corn, and corn without intercropping (CWI. The seeds of grasses were sown in spacing of 0.34 m, being sown with a seed drill with disc coulters mounted mechanism for no-tillage system at a depth of 0.03 m. There was no significant difference between the single corn tillage and intercropping with different modalities of forage genus Panicum and Urochloa to the leaf contents of N, P, K, Ca and Mg, demonstrating the non-compete forages with corn in a intercrop on the absorption of these nutrients. In respect to S, CTS presented higher content of S foliar when compared to CWI (Table 1. The absorption of nutrients by corn are not affect by the intercrop with forages of the genus Panicum and Urochloa, in simultaneously sown.

Inhibition of white light of 86Rb+ absorption in the root apex of corn

International Nuclear Information System (INIS)

McKendree, W.L.; Smith, R.C.

1990-01-01

Measurements of cell lengths made at 0.5 millimeter intervals in median longitudinal sections of the primary roots of corn (Zea mays) were used to construct a growth curve. The region 1.5 to 4.0 millimeters from the apex contained the largest number of elongating cells. Absorption of 86 Rb + was measured using intact, dark-grown corn seedlings. Following uptake and exchange, the terminal 8.0 millimeters of each root was cut into four 2.0 millimeter segments. Maximum 86 Rb + uptake occurred in the region from 0.0 to 4.0 millimeter from the root tip. Washing the intact primary root in fresh 2.0 millimolar CaSO 4 for 2 hours prior to uptake augmented the rate of 86 Rb + uptake in all regions. Illumination with white light during washing caused a reduction of 86 Rb + uptake as compared with controls washing in darkness, and the region of greatest light response was the region of elongation. Removal of the coleoptile prior to washing did not prevent the light inhibition of subsequent 86 Rb + uptake. Removal of the root cap prior to washing in light partially reversed the light-induced inhibition of the washing response

Use of dried cassava root to replace corn in supplementation of Holstein cows grazing and consuming spontaneously, apparent digestibility and energy metabolism

Directory of Open Access Journals (Sweden)

Ádler Carvalho da Silva

2015-07-01

Full Text Available The development of this experiment intended to evaluate the effect of replacing ground corn for dried and ground cassava roots with the levels of 0%, 25%, 50%, 75% and 100% in the experimental supplements for lactating cows kept on tropical irrigated and fertilized pastures. Ten Holstein cows were divided into two 5x5 Latin squares, with an initial lactation average of 150 days, 22 kg/day of average milk production of lactation and approximate initial average body eight of 603 kg. The animals were kept in pasture constituted by elephant grass (Pennisetum purpureum, SCHUM cv Pioneer, associated with Tifton 85 grass (Cynodon nlemfuensis, irrigated and fertilized with 600 kg of nitrogen per hectare/year. No significant effects on the substitution of ground corn for dried and ground cassava roots in the concentrate (P>0.05 over the spontaneous consumption of the total diet, with estimated average of 20.61 kg/DM/animal/day, apparent digestibility of DM with estimated average of 59.60% and energy balance with estimated average of +6.36 Mcal day-1. The results of this study demonstrate that the cassava root can be used as an energy source of high nutritional value for supplementation of lactating cows grazing on tropical pastures, similar to corn results.

Assessment of the nutritional values of genetically modified wheat, corn, and tomato crops.

Science.gov (United States)

Venneria, Eugenia; Fanasca, Simone; Monastra, Giovanni; Finotti, Enrico; Ambra, Roberto; Azzini, Elena; Durazzo, Alessandra; Foddai, Maria Stella; Maiani, Giuseppe

2008-10-08

The genetic modification in fruit and vegetables could lead to changes in metabolic pathways and, therefore, to the variation of the molecular pattern, with particular attention to antioxidant compounds not well-described in the literature. The aim of the present study was to compare the quality composition of transgenic wheat ( Triticum durum L.), corn ( Zea mays L.), and tomato ( Lycopersicum esculentum Mill.) to the nontransgenic control with a similar genetic background. In the first experiment, Ofanto wheat cultivar containing the tobacco rab1 gene and nontransgenic Ofanto were used. The second experiment compared two transgenic lines of corn containing Bacillus thuringiensis "Cry toxin" gene (PR33P67 and Pegaso Bt) to their nontransgenic forms. The third experiment was conducted on transgenic tomato ( Lycopersicum esculentum Mill.) containing the Agrobacterium rhizogenes rolD gene and its nontransgenic control (cv. Tondino). Conventional and genetically modified crops were compared in terms of fatty acids content, unsaponifiable fraction of antioxidants, total phenols, polyphenols, carotenoids, vitamin C, total antioxidant activity, and mineral composition. No significant differences were observed for qualitative traits analyzed in wheat and corn samples. In tomato samples, the total antioxidant activity (TAA), measured by FRAP assay, and the naringenin content showed a lower value in genetically modified organism (GMO) samples (0.35 mmol of Fe (2+) 100 g (-1) and 2.82 mg 100 g (-1), respectively), in comparison to its nontransgenic control (0.41 mmol of Fe (2+) 100 g (-1) and 4.17 mg 100 g (-1), respectively). On the basis of the principle of substantial equivalence, as articulated by the World Health Organization, the Organization for Economic Cooperation and Development, and the United Nations Food and Agriculture Organization, these data support the conclusion that GM events are nutritionally similar to conventional varieties of wheat, corn, and tomato on

Effects of application of corn straw on soil microbial community structure during the maize growing season.

Science.gov (United States)

Lu, Ping; Lin, Yin-Hua; Yang, Zhong-Qi; Xu, Yan-Peng; Tan, Fei; Jia, Xu-Dong; Wang, Miao; Xu, De-Rong; Wang, Xi-Zhuo

2015-01-01

This study investigated the influence of corn straw application on soil microbial communities and the relationship between such communities and soil properties in black soil. The crop used in this study was maize (Zea mays L.). The five treatments consisted of applying a gradient (50, 100, 150, and 200%) of shattered corn straw residue to the soil. Soil samples were taken from May through September during the 2012 maize growing season. The microbial community structure was determined using phospholipid fatty acid (PLFA) analysis. Our results revealed that the application of corn straw influenced the soil properties and increased the soil organic carbon and total nitrogen. Applying corn straw to fields also influenced the variation in soil microbial biomass and community composition, which is consistent with the variations found in soil total nitrogen (TN) and soil respiration (SR). However, the soil carbon-to-nitrogen ratio had no effect on soil microbial communities. The abundance of PLFAs, TN, and SR was higher in C1.5 than those in other treatments, suggesting that the soil properties and soil microbial community composition were affected positively by the application of corn straw to black soil. A Principal Component Analysis indicated that soil microbial communities were different in the straw decomposition processes. Moreover, the soil microbial communities from C1.5 were significantly different from those of CK (p soil and significant variations in the ratio of monounsaturated-to-branched fatty acids with different straw treatments that correlated with SR (p soil properties and soil microbial communities and that these properties affect these communities. The individual PLFA signatures were sensitive indicators that reflected the changes in the soil environment condition. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The U2U Corn Growing Degree Day tool: Tracking corn growth across the US Corn Belt

Directory of Open Access Journals (Sweden)

James R. Angel

2017-01-01

Full Text Available The Corn Growing Degree Day (Corn GDD tool is a web-based product that can provide decision support on a variety of issues throughout the entire growing season by integrating current conditions, historical climate data, and projections of Corn GDD through the end of the growing season based on both National Weather Service computer model forecasts and climatology. The Corn GDD tool can help agricultural producers make a variety of important decisions before and during the growing season. This support can include: assessing the risk of early and late frosts and freezes that can cause crop damage; comparing corn hybrid maturity requirements and Corn GDD projections to select seed varieties and plan activities such as spraying; guiding marketing decisions based on historical and projected Corn GDDs when considering forward crop pricing (i.e., futures market. The Corn GDD tool provides decision support for corn producers in the central U.S. corn-producing states. Survey results, web statistics, and user feedback indicate that this tool is being actively used by decision makers.

Calcium-regulated in vivo protein phosphorylation in Zea mays L. root tips

Science.gov (United States)

Raghothama, K. G.; Reddy, A. S.; Friedmann, M.; Poovaiah, B. W.

1987-01-01

Calcium dependent protein phosphorylation was studied in corn (Zea mays L.) root tips. Prior to in vivo protein phosphorylation experiments, the effect of calcium, ethyleneglycol-bis-(beta-aminoethyl ether)-N-N' -tetraacetic acid (EGTA) and calcium ionophore (A-23187) on phosphorus uptake was studied. Calcium increased phosphorus uptake, whereas EGTA and A-23187 decreased it. Consequently, phosphorus concentration in the media was adjusted so as to attain similar uptake in different treatments. Phosphoproteins were analyzed by two-dimensional gel electrophoresis. Distinct changes in phosphorylation were observed following altered calcium levels. Calcium depletion in root tips with EGTA and A-23187 decreased protein phosphorylation. However, replenishment of calcium following EGTA and ionophore pretreatment enhanced phosphorylation of proteins. Preloading of the root tips with 32P in the presence of EGTA and A-23187 followed by a ten minute calcium treatment, resulted in increased phosphorylation indicating the involvement of calcium, calcium and calmodulin-dependent kinases. Calmodulin antagonist W-7 was effective in inhibiting calcium-promoted phosphorylation. These studies suggest a physiological role for calcium-dependent phosphorylation in calcium-mediated processes in plants.

Feasibility for improving phytonutrient content in vegetable crops using conventional breeding strategies: case study with carotenoids and tocopherols in sweet corn and broccoli.

Science.gov (United States)

Ibrahim, Khalid E; Juvik, John A

2009-06-10

Among vegetables, sweet corn ( Zea mays L.) and broccoli ( Brassica oleracea L. ssp. italica) are important sources of dietary carotenoids and tocopherols. Because medical evidence suggests that carotenoid and tocopherol health-promoting activity acts in a dose-dependent manner, conventional breeding to develop elite sweet corn and broccoli germplasm with enhanced levels of these phytochemicals will potentially promote health among the consuming public. This investigation includes the quantitative analysis of carotenoid and tocopherol contents of 41 corn and 24 broccoli genotypes grown in multiple environments (years and seasons in one location) to partition the variation into genetic, environment, and genotype by environment interaction (GxE) components and measure the phenotypic stability of genotypes for these phytochemicals. The primary carotenoids and tocopherols in corn were lutein and gamma-tocopherol (65 and 73% of total carotenoid and tocopherol, respectively), whereas beta-carotene and alpha-tocopherol were dominant in broccoli (65 and 79% of total carotenoid and tocopherol, respectively). Partitioning of the variance indicated that genetic differences among the genotypes averaged for the primary compounds in corn (lutein, zeaxanthin, and alpha- and gamma-tocopherol) and broccoli (beta-carotene, lutein, and alpha- and gamma-tocopherol) accounted for the largest proportion of the variation (67 and 55% of total phenotypic variation averaged across the phytochemicals in sweet corn and broccoli, respectively). Stability analysis identified several corn (IL451b sh2 and IL2027-8 sh2) and broccoli ('Pirate' and 'Baccus') genotypes with relatively high mean concentrations for the various carotenoids and tocopherols that were comparatively stable across seasons and years. The results of this investigation suggest that sweet corn and broccoli germplasm with enhanced concentrations of carotenoids and tocopherols can be developed using conventional breeding protocols.

Zea mays L

African Journals Online (AJOL)

Markus

near Jos, during the 2007 and 2008 planting seasons, to study the productivity of seven (7) hybrid varieties of maize. (Zea maysL.), namely SUWAN-1-Y, 'Kenya Kitali', ACR-9776-2, TZMSR-W, DMESR-Y, ACROSS-98 and TZPBSR-W. The experiments were laid out in a randomized complete block design (RCBD) with three ...

Avaliação de cinco híbridos de milho (Zea mays, L. em diferentes estádios de maturação: 3. Composição químico-bromatológica Evaluation of five corn hybrids (Zea mays, L. at different maturity stages: 3. Chemical-bromatology composition

Directory of Open Access Journals (Sweden)

Lúcia Maria Zeoula

2003-06-01

Full Text Available O objetivo do presente estudo foi avaliar cinco híbridos de milho (Zea mays L. Pioneer: superprecoce P32R21, os precoces P30R07, P3041 e P30F33 e o semiprecoce P30F80, quanto à composição química, em diferentes estádios de maturação. O delineamento utilizado foi de blocos ao acaso, com cinco tratamentos e quatro repetições. A colheita das amostras dos híbridos de milho foi adotada estimando-se os cinco estádios de maturação da planta: 30, 34, 38, 42 e 46% de matéria seca (MS. Para cada estádio de maturação, procedeu-se à separação de colmo + bainha, lâmina foliar e do grão para posteriores analises químicas. Da fração grão, foram determinados os teores de nitrogênio total e de amido, nos cinco estádios de maturação. Nas frações de lâmina foliar e colmo + bainha, foram determinados os teores de fibra em detergente ácido (FDA, fibra em detergente neutro (FDN, lignina, nitrogênio insolúvel em detergente ácido (NIDA e nitrogênio total. Para os parâmetros avaliados observou-se diferença entre os híbridos de milho e efeito de dias pós-plantio. Com o avanço do estádio de maturação, observou-se que houve ligeira redução nos teores de proteína bruta (PB e os teores de amido praticamente não variaram no grão. Para a fração lâmina foliar, verificou-se que, com o aumento nos teores de matéria seca da planta, houve queda nos teores de PB e NIDA, ao contrário da fração colmo + bainha, cujos teores aumentaram. Os teores de FDN, FDA e lignina na lâmina foliar aumentaram, porém esses nutrientes na fração colmo + bainha dos híbridos de milho, praticamente, não variaram com o avanço do estádio de maturação.The objective of this study was evaluate, of the chemical composition of five corn (Zea mays L. hybrids Pioneer: P32R21, P30R07, P3041, P30F33 and P30F80, at different maturity stages. The treatments were used in plots of 7 x 8 m in a randomized block design, with four replicates. The samples

Consumption and utilization of experimentally altered corn by southern armyworm: Iron, nitrogen, and cyclic hydroxamates.

Science.gov (United States)

Manuwoto, S; Scriber, J M

1985-11-01

The effects of differential leaf water, leaf nitrogen and cyclic hydroxamate (DIMBOA) concentrations in corn seedlings were analyzed for a polyphagous insect, the southern armyworm (Spodoptera eridania Cram.). Six different combinations of nutrients and allelochemicals [DIMBOA = 2,4-dihydroxy-7-methoxy(2H)-benzoxazin-3(4H)-one] were generated using two corn genotypes (WF9 and CI3IA) and three fertility regimes (complete nutrient, Fe-deficient, and N-deficient solutions) in the University Biotron. Poorest larval growth was observed in the low-nitrogen treatments (1.2% and 1.7% leaf N) and was the result of both low consumption rates and high metabolic costs (low efficiency of conversion of digested food, ECD). Fastest growth rates were observed forthe larvae fed leaves from the high-nitrogen treatments (4.6% and 4.4% leaf N). It is noteworthy that these treatments also contained the highest concentration of cyclic hydroxamates, which are generally believed to be the primary defensive chemicals mediating resistance against the European corn borer,Ostrinia nubilalis (Hubner). If these hydroxamates do have any deleterious or costly effects (perhaps accounting for a large portion of metabolic expenditures), the high digestibility of the leaf tissue and the increased consumption rates more than compensate, resulting in rapid growth (growth rate = consumption rate × approximate digestibility × efficiency of conversion of the digested food). These studies illustrate that variation in key nutrients and allelochemicals within a single plant species (Zea mays L.) may have significantly different effects upon various potential leaf-chewing caterpillars, such as these armyworms versus corn borers (which cannot handle the cyclic hydroxamates, even if provided with young nutritious leaf tissues).

Influence of the corn resistance gene Mv on the fitness of Peregrinus maidis (Hemiptera: Delphacidae) and on the transmission of maize mosaic virus (Rhabdoviridae: Nucleorhabdovirus).

Science.gov (United States)

Higashi, C H V; Brewbaker, J L; Bressan, A

2013-08-01

Crops that are resistant to pests and pathogens are cost-effective for the management of pests and diseases. A corn (Zea mays L.) breeding program conducted in Hawaii has identified a source of heritable resistance to maize mosaic virus (MMV) (Rhabdoviridae: Nucleorhabdovirus). This resistance is controlled by the gene Mv, which has been shown to have a codominant action. To date, no studies have examined whether the resistance associated with this gene affects only MMV or whether it also affects the insect vector, the corn planthopper Peregrinus maidis (Ashmead) (Hemiptera: Delphacidae). Here, we examined the life history of the corn planthopper and its ability to transmit MMV on near isogenic lines that were homozygous dominant (Mv/Mv), homozygous recessive (mv/mv), or heterozygous (Mv/mv) for the gene. A field trial was also conducted to study the colonization of the corn plants with different genotypes by the planthopper. Although field observations revealed slightly lower densities ofplanthoppers on corn with the genotype Mv/Mv than on the inbreds with the genotype mv/mv and their hybrids with the genotype Mv/mv, laboratory assays showed no effects of the gene on planthopper development, longevity, or fecundity. In the field, the corn lines Mv/Mv had a lower incidence of MMV-infected plants. However, in the greenhouse, the transmission of MMV to corn seedlings did not differ across the near isogenic lines, although the corn lines Mv/Mv showed a delayed onset of symptoms compared with the corn lines mv/mv and Mv/mv. The acquisition of MMV by corn planthoppers on the corn genotypes Mv/Mv and Mv/mv averaged 0.2, whereas the acquisition on the corn genotypes mv/mv averaged > 0.3. Our results show that the Mv gene does not influence the fitness of the planthopper vector, suggesting that it may confer resistance by other means, possibly by limiting virus replication or movement within the host plant.

Optimization of Water Allocation between Different Crops in Water Stress Conditions in Qazvin Irrigation Network

Directory of Open Access Journals (Sweden)

Mehdi Mohammad khani

2017-06-01

Full Text Available Introduction: Evaluations show the necessity of using optimization models in order to determine optimal allocation of water in different water conditions. Its use can be proposed according to developed model abilities in this study in order to optimize water productivity and provide sustainable management and development of water resources over irrigation and drainage networks. Basic needs of the earth growing population and limitation of water and soil resources remindnecessity of optimal use of resources. World’s more than 280 million hectare lands are covered by irrigation networks (Khalkhali et al., 2006. The efficiency of most projects is between 30-50 percent and studies show that performance of most irrigation and drainage networks is not desirable and they have not achieved their aims. Hirich et al. (2014 Used deficit irrigation to improve crop water productivity of sweet corn, chickpea, faba bean and quinoa. For all crops, the highest water productivity and yield were obtained when deficit irrigation was applied during the vegetative growth stage. During the second season 2011 two cultivars of quinoa, faba bean and sweet corn have been cultivated applying 6 deficit irrigation treatments (rainfed, 0, 25, 50, 75 and 100% of full irrigation only during the vegetative growth stage, while in the rest of a crop cycle full irrigation was provided except for rainfed treatment. For quinoa and faba bean, treatment receiving 50% of the full irrigation during the vegetative growth stage recorded the highest yield and water productivity, while for sweet corn applying 75% of full irrigation was the optimal treatment in terms of yield and water productivity. Moghaddasi et al. (2010 worked examines and compares this approach with that based on the optimization method to manage agricultural water demand during drought to minimize damage. The results show that the optimization method resulted in 42% more income for the agricultural sector using the

A Multiplex Real-Time PCR Assay to Diagnose and Separate Helicoverpa armigera and H. zea (Lepidoptera: Noctuidae) in the New World.

Science.gov (United States)

Gilligan, Todd M; Tembrock, Luke R; Farris, Roxanne E; Barr, Norman B; van der Straten, Marja J; van de Vossenberg, Bart T L H; Metz-Verschure, Eveline

2015-01-01

The Old World bollworm, Helicoverpa armigera (Hübner), and the corn earworm, H. zea (Boddie), are two of the most important agricultural pests in the world. Diagnosing these two species is difficult-adults can only be separated with a complex dissection, and larvae cannot be identified to species using morphology, necessitating the use of geographic origin for identification in most instances. With the discovery of H. armigera in the New World, identification of immature Helicoverpa based on origin is no longer possible because H. zea also occurs in all of the geographic regions where H. armigera has been discovered. DNA barcoding and restriction fragment length polymorphism (RFLP) analyses have been reported in publications to distinguish these species, but these methods both require post-PCR processing (i.e., DNA sequencing or restriction digestion) to complete. We report the first real-time PCR assay to distinguish these pests based on two hydrolysis probes that bind to a segment of the internal transcribed spacer region 2 (ITS2) amplified using a single primer pair. One probe targets H. armigera, the second probe targets H. zea, and a third probe that targets a conserved segment of 18S rDNA is used as a control of DNA quality. The assay can be completed in 50 minutes when using isolated DNA and is successfully tested on larvae intercepted at ports of entry and adults captured during domestic surveys. We demonstrate that the assay can be run in triplex with no negative effects on sensitivity, can be run using alternative real-time PCR reagents and instruments, and does not cross react with other New World Heliothinae.

A Multiplex Real-Time PCR Assay to Diagnose and Separate Helicoverpa armigera and H. zea (Lepidoptera: Noctuidae in the New World.

Directory of Open Access Journals (Sweden)

Todd M Gilligan

Full Text Available The Old World bollworm, Helicoverpa armigera (Hübner, and the corn earworm, H. zea (Boddie, are two of the most important agricultural pests in the world. Diagnosing these two species is difficult-adults can only be separated with a complex dissection, and larvae cannot be identified to species using morphology, necessitating the use of geographic origin for identification in most instances. With the discovery of H. armigera in the New World, identification of immature Helicoverpa based on origin is no longer possible because H. zea also occurs in all of the geographic regions where H. armigera has been discovered. DNA barcoding and restriction fragment length polymorphism (RFLP analyses have been reported in publications to distinguish these species, but these methods both require post-PCR processing (i.e., DNA sequencing or restriction digestion to complete. We report the first real-time PCR assay to distinguish these pests based on two hydrolysis probes that bind to a segment of the internal transcribed spacer region 2 (ITS2 amplified using a single primer pair. One probe targets H. armigera, the second probe targets H. zea, and a third probe that targets a conserved segment of 18S rDNA is used as a control of DNA quality. The assay can be completed in 50 minutes when using isolated DNA and is successfully tested on larvae intercepted at ports of entry and adults captured during domestic surveys. We demonstrate that the assay can be run in triplex with no negative effects on sensitivity, can be run using alternative real-time PCR reagents and instruments, and does not cross react with other New World Heliothinae.

Quantitative Trait Loci Mapping of Western Corn Rootworm (Coleoptera: Chrysomelidae) Host Plant Resistance in Two Populations of Doubled Haploid Lines in Maize (Zea mays L.).

Science.gov (United States)

Bohn, Martin O; Marroquin, Juan J; Flint-Garcia, Sherry; Dashiell, Kenton; Willmot, David B; Hibbard, Bruce E

2018-02-09

Over the last 70 yr, more than 12,000 maize accessions have been screened for their level of resistance to western corn rootworm, Diabrotica virgifera virgifera (LeConte; Coleoptera: Chrysomelidae), larval feeding. Less than 1% of this germplasm was selected for initiating recurrent selection or other breeding programs. Selected genotypes were mostly characterized by large root systems and superior root regrowth after root damage caused by western corn rootworm larvae. However, no hybrids claiming native (i.e., host plant) resistance to western corn rootworm larval feeding are currently commercially available. We investigated the genetic basis of western corn rootworm resistance in maize materials with improved levels of resistance using linkage disequilibrium mapping approaches. Two populations of topcrossed doubled haploid maize lines (DHLs) derived from crosses between resistant and susceptible maize lines were evaluated for their level of resistance in three to four different environments. For each DHL topcross an average root damage score was estimated and used for quantitative trait loci (QTL) analysis. We found genomic regions contributing to western corn rootworm resistance on all maize chromosomes, except for chromosome 4. Models fitting all QTL simultaneously explained about 30 to 50% of the genotypic variance for root damage scores in both mapping populations. Our findings confirm the complex genetic structure of host plant resistance against western corn rootworm larval feeding in maize. Interestingly, three of these QTL regions also carry genes involved in ascorbate biosynthesis, a key compound we hypothesize is involved in the expression of western corn rootworm resistance. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Influence of corn oil recovery on life-cycle greenhouse gas emissions of corn ethanol and corn oil biodiesel.

Science.gov (United States)

Wang, Zhichao; Dunn, Jennifer B; Han, Jeongwoo; Wang, Michael Q

2015-01-01

Corn oil recovery and conversion to biodiesel has been widely adopted at corn ethanol plants recently. The US EPA has projected 2.6 billion liters of biodiesel will be produced from corn oil in 2022. Corn oil biodiesel may qualify for federal renewable identification number (RIN) credits under the Renewable Fuel Standard, as well as for low greenhouse gas (GHG) emission intensity credits under California's Low Carbon Fuel Standard. Because multiple products [ethanol, biodiesel, and distiller's grain with solubles (DGS)] are produced from one feedstock (corn), however, a careful co-product treatment approach is required to accurately estimate GHG intensities of both ethanol and corn oil biodiesel and to avoid double counting of benefits associated with corn oil biodiesel production. This study develops four co-product treatment methods: (1) displacement, (2) marginal, (3) hybrid allocation, and (4) process-level energy allocation. Life-cycle GHG emissions for corn oil biodiesel were more sensitive to the choice of co-product allocation method because significantly less corn oil biodiesel is produced than corn ethanol at a dry mill. Corn ethanol life-cycle GHG emissions with the displacement, marginal, and hybrid allocation approaches are similar (61, 62, and 59 g CO2e/MJ, respectively). Although corn ethanol and DGS share upstream farming and conversion burdens in both the hybrid and process-level energy allocation methods, DGS bears a higher burden in the latter because it has lower energy content per selling price as compared to corn ethanol. As a result, with the process-level allocation approach, ethanol's life-cycle GHG emissions are lower at 46 g CO2e/MJ. Corn oil biodiesel life-cycle GHG emissions from the marginal, hybrid allocation, and process-level energy allocation methods were 14, 59, and 45 g CO2e/MJ, respectively. Sensitivity analyses were conducted to investigate the influence corn oil yield, soy biodiesel, and defatted DGS displacement credits

Studi Awal Desain Pabrik Bioetanol dari Corn stover

Directory of Open Access Journals (Sweden)

Gumelar Ahmad Muhlis

2015-12-01

Full Text Available Jagung (Zea mays merupakan tanaman pangan yang penting di Indonesia. Pada tahun 2006, luas panen jagung adalah 3,5 juta hektar dengan produksi rata-rata 3,47ton/ha, produksi jagung secara nasional 11,7 juta ton. Limbah batang dan daun jagung kering adalah 3,46 ton/ha sehingga limbah pertanian yang dihasilkan sekitar 12.1juta ton. Potensi energi limbah pada komoditas jagung sangat besar dan diharapkan akan terus meningkat sejalan dengan program pemerintah dalam meningkatkan produksi jagung secara nasional yaitu program pengembangan peternakan secara terintegrasi (Crop Livestock System/CLS. Oleh karena itu, optimasi pemanfaatan limbah jagung sangat diperlukan untuk mendapatkan keuntungan yang optimal sehingga dalam studi ini diputuskan pemanfaatan sebanyak 50% limbah pertanian jagung yang ada di Kab. Tuban untuk selanjutnya diproses menjadi Bioetanol 95%. Ketersediaan bahan baku, letak strategis, transportasi yang mudah terletak di jalur pantura dan langsung terhubung dengan pelabuhan, serta potensi tenaga kerja yang cukup menjanjikan menjadikan alasan dalam pemilihan Kawasan Industri Kec. Jenu Kab. Tuban sebagai lokasi pabrik. Proses pembuatan bioetanol dari corn stover dengan proses fermentasi dibagi menjadi 4 tahap yaitu:  penyimpanan dan penanganan bahan baku, hidrolisis, fermentasi, dan pemurnian. Desain konseptual yang disajikan mengacu pada Technical Report Pilot Plan National Renewable Energy Laboratory tahun 2011. Pabrik Bioetanol direncanakan dapat mengolah 484.625 ton corn stover kering/hari pada yield etanol (303 L/dry ton dengan kapasitas produksi etanol 95% sebanyak 44.226 kL/tahun, harga jual adalah Rp13.500,00/L. Masa konstruksi pabrik yang didirikan 2 tahun dengan pembiayaan berupa modal tetap (FCI Rp. 515.854.121.170; modal kerja (WCI Rp. 91.033.080.207; investasi total (TCI Rp. 606.887.201.377 ; total production cost (TPC Rp. 345.715.009.709. Sehingga didapatkan IRR 23,37 % pertahun ;pay out time (POT 6,98 tahun dengan project

Crescimento e produtividade de inhame e de milho doce em cultivo associado Growth and productivity of taro and sweet corn under intercropping conditions

Directory of Open Access Journals (Sweden)

Mário Puiatti

2000-03-01

Full Text Available Objetivando avaliar a viabilidade agronômica e econômica da associação inhame e milho doce, foi desenvolvido um trabalho em área da horta de pesquisas da Universidade Federal de Viçosa, em sistema de consórcio (associação aditiva, utilizando-se inhame (Colocasia esculenta 'Chinês' como cultura principal e milho doce (Zea mays 'Doce Cristal' como cultura contrastante. O inhame foi plantado em sulcos de 12 cm de profundidade, no espaçamento de 100 x 30 cm, e o milho doce em covas de 3 cm de profundidade, na fileira de plantio, entre as plantas de inhame, 40 dias após plantio do inhame. O delineamento experimental foi de blocos ao acaso, com quatro repetições, no esquema fatorial (3 x 2 + 2 (três arranjos de plantas: uma planta de milho a cada 30 cm; duas plantas de milho a cada 60 cm e três plantas de milho a cada 90 cm x dois manejos das plantas de milho: sem e com corte e retirada da parte aérea das plantas de milho no momento da colheita das espigas verdes + dois controles: monoculturas de inhame e de milho doce. Foram avaliadas características de crescimento e de produção das culturas, além dos índices de eficiência dos consórcios. As duas espécies são adequadas para plantio em sistema de consórcio. O arranjo com uma planta de milho a cada 30 cm propiciou maiores produtividades e índices de eficiência dos consórcios. Com exceção do arranjo com três plantas de milho/cova a cada 90 cm com corte da parte aérea das plantas de milho na colheita das espigas, no qual ocorreram menores índices de eficiência dos consórcios e rendimento financeiro total inferior ao da monocultura do inhame, as demais associações estudadas demonstraram-se viáveis agronômica e economicamente.An experiment was conducted to evaluate some crop production characteristics and economic viability of intercropping systems using taro (Colocasia esculenta 'Chinês', as major crop, and sweet corn (Zea mays 'Doce Cristal' as minor crop. Taro

Water erosion and soil water infiltration in different stages of corn development and tillage systems

Directory of Open Access Journals (Sweden)

Daniel F. de Carvalho

2015-11-01

Full Text Available ABSTRACTThis study evaluated soil and water losses, soil water infiltration and infiltration rate models in soil tillage systems and corn (Zea mays, L. development stages under simulated rainfall. The treatments were: cultivation along contour lines, cultivation down the slope and exposed soil. Soil losses and infiltration in each treatment were quantified for rains applied using a portable simulator, at 0, 30, 60 and 75 days after planting. Infiltration rates were estimated using the models of Kostiakov-Lewis, Horton and Philip. Based on the obtained results, the combination of effects between soil tillage system and corn development stages reduces soil and water losses. The contour tillage system promoted improvements in soil physical properties, favoring the reduction of erosion in 59.7% (water loss and 86.6% (soil loss at 75 days after planting, and the increase in the stable infiltration rate in 223.3%, compared with the exposed soil. Associated to soil cover, contour cultivation reduces soil and water losses, and the former is more influenced by management. Horton model is the most adequate to represent soil water infiltration rate under the evaluated conditions.

The Effect of Different Levels of Irrigation and Nitrogen Fertilizer on Yield and Water Use Efficiency of Potato in Subsurface Drip Irrigation

Directory of Open Access Journals (Sweden)

Mohammad Jolaini

2017-06-01

Full Text Available Introduction: After wheat, rice and corn, potato is the fourth most important food plant in the world. In comparison with other species, potato is very sensitive to water stress because of its shallow root system: approximately 85% of the root length is concentrated in the upper 0.3-0.4 m of the soil. Several studies showed that drip irrigation is an effective method for enhancing potato yield. Fabeiro et al. (2001 concluded that tuber bulking and ripening stages were found to be the most sensitive stages of water stress with drip irrigation. Water deficit occurring in these two growth stages could result in yield reductions. Wang et al. (2006 investigated the effects of drip irrigation frequency on soil wetting pattern and potato yield. The results indicated that potato roots were not limited in wetted soil volume even when the crop was irrigated at the highest frequency while high frequency irrigation enhanced potato tuber growth and water use efficiency (WUE. Though information about irrigation and N management of this crop is often conflicting in the literature, it is accepted generally that production and quality are highly influenced by both N and irrigation amounts and these requirements are related to the cropping technique. Researches revealed that nitrogen fertilizers play a special role in the growth, production and quality of potatoes. Materials and Methods: A factorial experiment in randomized complete block design with three replications was carried out during two growing seasons. Studied factors were irrigation frequency (I1:2 and I2:4 days interval and nitrogen fertilizer levels (applying 100 (N1, 75 (N2 and 50 (N3 % of the recommended amount. Nitrogen fertilizer was applied through irrigation water. In each plot two rows with within-and between-row spacing of 45 and 105 cm and 20 m length. The amount of nitrogen fertilizer for the control treatment was determined by soil analysis (N1. In all treatments, nitrogen fertilizer

Nitrous oxide emissions in cover crop-based corn production systems

Science.gov (United States)

Davis, Brian Wesley

Nitrous oxide (N2O) is a potent greenhouse gas; the majority of N2O emissions are the result of agricultural management, particularly the application of N fertilizers to soils. The relationship of N2O emissions to varying sources of N (manures, mineral fertilizers, and cover crops) has not been well-evaluated. Here we discussed a novel methodology for estimating precipitation-induced pulses of N2O using flux measurements; results indicated that short-term intensive time-series sampling methods can adequately describe the magnitude of these pulses. We also evaluated the annual N2O emissions from corn-cover crop (Zea mays; cereal rye [Secale cereale], hairy vetch [Vicia villosa ], or biculture) production systems when fertilized with multiple rates of subsurface banded poultry litter, as compared with tillage incorporation or mineral fertilizer. N2O emissions increased exponentially with total N rate; tillage decreased emissions following cover crops with legume components, while the effect of mineral fertilizer was mixed across cover crops.

Estimating irrigated areas from satellite and model soil moisture data over the contiguous US

Science.gov (United States)

Zaussinger, Felix; Dorigo, Wouter; Gruber, Alexander

2017-04-01

Information about irrigation is crucial for a number of applications such as drought- and yield management and contributes to a better understanding of the water-cycle, land-atmosphere interactions as well as climate projections. Currently, irrigation is mainly quantified by national agricultural statistics, which do not include spatial information. The digital Global Map of Irrigated Areas (GMIA) has been the first effort to quantify irrigation at the global scale by merging these statistics with remote sensing data. Also, the MODIS-Irrigated Agriculture Dataset (MirAD-US) was created by merging annual peak MODIS-NDVI with US county level irrigation statistics. In this study we aim to map irrigated areas by confronting time series of various satellite soil moisture products with soil moisture from the ERA-Interim/Land reanalysis product. We follow the assumption that irrigation signals are not modelled in the reanalysis product, nor contributing to its forcing data, but affecting the spatially continuous remote sensing observations. Based on this assumption, spatial patterns of irrigation are derived from differences between the temporal slopes of the modelled and remotely sensed time series during the irrigation season. Results show that a combination of ASCAT and ERA-Interim/Land show spatial patterns which are in good agreement with the MIrAD-US, particularly within the Mississippi Delta, Texas and eastern Nebraska. In contrast, AMSRE shows weak agreements, plausibly due to a higher vegetation dependency of the soil moisture signal. There is no significant agreement to the MIrAD-US in California, which is possibly related to higher crop-diversity and lower field sizes. Also, a strong signal in the region of the Great Corn Belt is observed, which is generally not outlined as an irrigated area. It is not yet clear to what extent the signal obtained in the Mississippi Delta is related to re-reflection effects caused by standing water due to flood or furrow

Kinetics of α-amylase and α-glucosidase inhibitory potential of Zea mays Linnaeus (Poaceae), Stigma maydis aqueous extract: An in vitro assessment.

Science.gov (United States)

Sabiu, S; O'Neill, F H; Ashafa, A O T

2016-05-13

Corn silk (Zea mays L., Stigma maydis) is an important herb used traditionally in many parts of the world to treat array of diseases including diabetes mellitus. Inhibitors of α-amylase and α-glucosidase offer an effective strategy to modulate levels of post prandial hyperglycaemia via control of starch metabolism. This study evaluated α-amylase and α-glucosidase inhibitory potentials of corn silk aqueous extract. Active principles and antioxidant attributes of the extract were also analysed. The α-amylase inhibitory potential of the extract was investigated by reacting its different concentrations with α-amylase and starch solution, while α-glucosidase inhibition was determined by pre-incubating α-glucosidase with different concentrations of the extract followed by addition of p-nitrophenylglucopyranoside. The mode(s) of inhibition of the enzymes were determined using Lineweaver-Burke plot. In vitro analysis of the extract showed that it exhibited potent and moderate inhibitory potential against α-amylase and α-glucosidase, respectively. The inhibition was concentration-dependent with respective half-maximal inhibitory concentration (IC50) values of 5.89 and 0.93mg/mL. Phytochemical analyses revealed the presence of alkaloids, flavonoids, phenols, saponins, tannins and phytosterols as probable inhibitory constituents. Furthermore, the extract remarkably scavenges reactive oxygen species like DPPH and nitric oxide radicals, elicited good reducing power and a significant metal chelating attributes. Overall, the non-competitive and uncompetitive mechanism of action of corn silk extract is due to its inhibitory effects on α-amylase and α-glucosidase, respectively. Consequently, this will reduce the rate of starch hydrolysis, enhance palliated glucose levels, and thus, lending credence to hypoglycaemic candidature of corn silk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Attraction, Oviposition Preferences, and Olfactory Responses of Corn-Infesting Ulidiidae (Diptera) to Various Host-Based Substrates.

Science.gov (United States)

Owens, D; Nuessly, G S; Kendra, P E; Colquhoun, T A; Seal, D R

2017-08-01

Fresh market sweet corn (Zea mays L., convar. saccharata var. rugosa, Poales: Poaceae) ears produced in Florida are damaged by the larvae of Euxesta stigmatias Loew, Euxesta eluta Loew, and Chaetopsis massyla Walker (Diptera: Ulidiidae) that renders ears unmarketable. No standard lure exists for monitoring these pests. Oviposition substrate and attractant bioassays were designed to identify attractive substrates for further semiochemical investigation. Frass from the fall armyworm, Spodoptera frugiperda J.E. Smith (Lepidoptera: Noctuidae), was more attractive than other ovipositional substrates tested for E. eluta and C. massyla, and resulted in greater ovipositional output. Tassel-derived armyworm frass was more attractive than leaf-derived frass for oviposition. Frass also resulted in greater oviposition output by two species. In attraction bioassays, frass was generally preferred over the corresponding corn tissue, and only C. massyla demonstrated a preference for silk-frass over tassel-frass. The most promising substrates were then evaluated by electroantennography (EAG) to quantify olfactory responses. Frass volatiles also elicited greater antennal responses than corn volatiles. With tassel-frass, greater amplitude EAG responses were recorded from immature E. eluta female antennae, while mature female E. stigmatias exhibited greater responses. Equivalent antennal response to silk-frass was observed from E. eluta. Overall, silk-frass elicited the greatest EAG responses among all three fly species. Our results indicate that armyworm frass is an important resource in the chemical ecology of corn-infesting silk flies, and this substrate warrants further investigation for potential attractants that may facilitate development of novel management tools for these pests. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Effects of planting pattern and density on growth indices, yield and yield component of corn (Zea mays in competition with redroot pigweed (Amaranthus retrofelexus(

Directory of Open Access Journals (Sweden)

alireza barkhi

2009-06-01

Full Text Available An experiment was conducted in 2002-2003 using split-split plot arrangement based on Rondomised Compelete Block Design with three replications at Feiz Abad Agricultural Research Station of Qazvin, in order to study of planting patterns and corn densitis effect in competition with redroot pigweed. Main plots inclouded two planting pattern of corn (P1: single row and P2: double row, sub plots inclouded two corn densities (D1:7 and D2:10 plant/m2 and sub sub plots inclouded 4 weed densities (C1:0, C2:2, C3:6, C4:12 plant/m2. Sampling conducted in 2-weekly intervals and growth indices evaluated. Results indicated that with increasing of weed density CGR, TDW, LAI, number of seeds in row, grain and ear yield decreased but plant height increased. Also LAI, CGR, TDW, number of weed seed and seed,s weight of weed increased. By increasing in corn density LAI, CGR, TDW, ear and grain yield increased, but length and diameter of ear and number of seeds in row decreased. Also LAI and CGR of weed increased, but TDW was decreased. In double row planting pattern just CGR, LAI, TDW of corn were higher significantly than single row planting pattern. But single row planting of weed caused higher LAI, NAR, RGR, CGR and TDW of weed in comparison with double row planting pattern. In 2-way interaction, double row planting pattern and zero densities and 2 weeds/m2 had highest grain yield respectively. There were no significant differences for 3-way interactions but double row planting pattern 10 plant density of corn/m2 zero weed/ m2 had highest grain yield.

Double-Mutated 5-Enol Pyruvylshikimate-3-phosphate Synthase Protein Expressed in MZHG0JG Corn (Zea mays L.) Has No Impact on Toxicological Safety and Nutritional Composition.

Science.gov (United States)

Matthews, Bethany A; Launis, Karen L; Bauman, Patricia A; Juba, Nicole C

2017-09-27

MZHG0JG corn will offer growers the flexibility to alternate between herbicides with two different modes of action in their weed-management programs, helping to mitigate and manage the evolution of herbicide resistance in weed populations. The proteins conferring herbicide tolerence in MZHG0JG corn, double-mutated 5-enol pyruvylshikimate-3-phosphate synthase protein (mEPSPS) and phosphinothricin acetyltransferase (PAT), as well as the MZHG0JG corn event, have been assessed by regulatory authorities globally and have been determined to be safe for humans, animals, and the environment. In addition to the safety data available for these proteins, further studies were conducted on MZHG0JG corn to assess levels of mEPSPS as compared to previously registered genetically modified (GM) corn. The results support the conclusion of no impact on toxicological safety or nutritional composition.

Behavioural modelling of irrigation decision making under water scarcity

Science.gov (United States)

Foster, T.; Brozovic, N.; Butler, A. P.

2013-12-01

Providing effective policy solutions to aquifer depletion caused by abstraction for irrigation is a key challenge for socio-hydrology. However, most crop production functions used in hydrological models do not capture the intraseasonal nature of irrigation planning, or the importance of well yield in land and water use decisions. Here we develop a method for determining stochastic intraseasonal water use that is based on observed farmer behaviour but is also theoretically consistent with dynamically optimal decision making. We use the model to (i) analyse the joint land and water use decision by farmers; (ii) to assess changes in behaviour and production risk in response to water scarcity; and (iii) to understand the limits of applicability of current methods in policy design. We develop a biophysical model of water-limited crop yield building on the AquaCrop model. The model is calibrated and applied to case studies of irrigated corn production in Nebraska and Texas. We run the model iteratively, using long-term climate records, to define two formulations of the crop-water production function: (i) the aggregate relationship between total seasonal irrigation and yield (typical of current approaches); and (ii) the stochastic response of yield and total seasonal irrigation to the choice of an intraseasonal soil moisture target and irrigated area. Irrigated area (the extensive margin decision) and per-area irrigation intensity (the intensive margin decision) are then calculated for different seasonal water restrictions (corresponding to regulatory policies) and well yield constraints on intraseasonal abstraction rates (corresponding to aquifer system limits). Profit- and utility-maximising decisions are determined assuming risk neutrality and varying degrees of risk aversion, respectively. Our results demonstrate that the formulation of the production function has a significant impact on the response to water scarcity. For low well yields, which are the major concern

Can nitrate contaminated groundwater be remediated by optimizing flood irrigation rate with high nitrate water in a desert oasis using the WHCNS model?

Science.gov (United States)

Liang, Hao; Qi, Zhiming; Hu, Kelin; Prasher, Shiv O; Zhang, Yuanpei

2016-10-01

Nitrate contamination of groundwater is an environmental concern in intensively cultivated desert oases where this polluted groundwater is in turn used as a major irrigation water resource. However, nitrate fluxes from root zone to groundwater are difficult to monitor in this complex system. The objectives of this study were to validate and apply the WHCNS (soil Water Heat Carbon Nitrogen Simulator) model to simulate water drainage and nitrate leaching under different irrigation and nitrogen (N) management practices, and to assess the utilization of groundwater nitrate as an approach to remediate nitrate contaminated groundwater while maintain crop yield. A two-year field experiment was conducted in a corn field irrigated with high nitrate groundwater (20 mg N L(-1)) in Alxa, Inner Mongolia, China. The experiment consisted of two irrigation treatments (Istd, standard, 750 mm per season; Icsv, conservation, 570 mm per season) factorially combined with two N fertilization treatments (Nstd, standard, 138 kg ha(-1); Ncsv, conservation, 92 kg ha(-1)). The validated results showed that the WHCNS model simulated values of crop dry matter, yield, soil water content and soil N concentration in soil profile all agreed well with the observed values. Compared to the standard water management (Istd), the simulated drainage and nitrate leaching decreased about 65% and 59%, respectively, under the conservation water management (Icsv). Nearly 55% of input N was lost by leaching under the IstdNstd and IstdNcsv treatments, compared to only 26% under the IcsvNstd and IcsvNcsv treatments. Simulations with more than 240 scenarios combing different levels of irrigation and fertilization indicated that irrigation was the main reason leading to the high risk of nitrate leaching, and the nitrate in irrigation groundwater can be best utilized without corn yield loss when the total irrigation was reduced from the current 750 mm to 491 mm. This reduced irrigation rate facilitated

Physiological time model for predicting adult emergence of western corn rootworm (Coleoptera: Chrysomelidae) in the Texas High Plains.

Science.gov (United States)

Stevenson, Douglass E; Michels, Gerald J; Bible, John B; Jackman, John A; Harris, Marvin K

2008-10-01

Field observations at three locations in the Texas High Plains were used to develop and validate a degree-day phenology model to predict the onset and proportional emergence of adult Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae) adults. Climatic data from the Texas High Plains Potential Evapotranspiration network were used with records of cumulative proportional adult emergence to determine the functional lower developmental temperature, optimum starting date, and the sum of degree-days for phenological events from onset to 99% adult emergence. The model base temperature, 10 degrees C (50 degrees F), corresponds closely to known physiological lower limits for development. The model uses a modified Gompertz equation, y = 96.5 x exp (-(exp(6.0 - 0.00404 x (x - 4.0), where x is cumulative heat (degree-days), to predict y, cumulative proportional emergence expressed as a percentage. The model starts degree-day accumulation on the date of corn, Zea mays L., emergence, and predictions correspond closely to corn phenological stages from tasseling to black layer development. Validation shows the model predicts cumulative proportional adult emergence within a satisfactory interval of 4.5 d. The model is flexible enough to accommodate early planting, late emergence, and the effects of drought and heat stress. The model provides corn producers ample lead time to anticipate and implement adult control practices.

OCORRÊNCIA DE PLANTAS DANINHAS NA CULTURA DO MILHO (Zea mays L. EM SUCESSÃO A CULTURAS DE SAFRINHA NO SISTEMA PLANTIO DIRETO WEEDS IN THE DOUBLE CROPPING WITH CORN (Zea mays L. UNDER NO-TILLAGE

Directory of Open Access Journals (Sweden)

Antônio Pasqualetto

2007-09-01

Full Text Available

Objetivou-se avaliar a ocorrência de espécies daninhas na cultura do milho após diversas culturas de safrinha, no sistema plantio direto. As culturas de safrinha foram milho, soja, milheto, girassol, sorgo, aveia e guandu. As plantas daninhas foram avaliadas aos 30 dias após a semeadura, por meio de amostragens ao acaso na parcela, utilizando um quadro de 0,45 m2 (1,5 m x 0,3 m, colocado perpendicularmente às linhas de semeadura e recolhendo-se todo o material verde de plantas daninhas existentes na amostra, classificando-o por espécie vegetal, agrupando as principais monocotiledôneas, principais dicotiledôneas e outras plantas daninhas. Os resultados demonstraram maior ocorrência das espécies Digitaria horizontalis e Commelina benghalensis na cultura do milho, independentemente da sucessão estabelecida. C. benghalensis predominou na sucessão milho-milho, e D. horizontalis na sucessão soja-milho. A menor infestação de plantas daninhas foi observada na área em que a cultura do girassol antecede a cultura do milho. Utilizando-se o milheto como cultura de safrinha, há maior ocorrência de espécies dicotiledôneas na cultura do milho, especialmente a Euphorbia heterophylla.

PALAVRAS-CHAVE: Sucessões de culturas; milho; plantas daninhas.

It was observed to evaluate the occurrence of the weeds, after 3 years of cultivation with successions of double cropping cultures with the culture of the corn. The double cropping cultures were: corn, soybean, pearl millet, sunflower, sorghum, oat and pigeon pea. The weeds were appraised to the 30 days after the sowing, by means of sampling to the maybe in the portion, using a icture of 0.45 m2 (1.5 m x 0.3 m, placed in a perpendicular way to the plantation lines

Corn stover harvest strategy effects on grain yield and soil quality indicators

International Nuclear Information System (INIS)

Douglas, K.; Stuart, B.; Adam, W.

2013-01-01

Developing strategies to collect and use cellulo sic biomass for bio energy production is important because those materials are not used as human food sources. This study compared corn (Zea mays L.) stover harvest strategies on a 50 ha Clarion- Nicol let-Webster soil Association site near Emmetsburg, Iowa, USA. Surface soil samples (0 to 15 cm) were analyzed after each harvest to monitor soil organic carbon (Soc), ph, phosphorus (P) and potassium (K) changes. Grain yields in 2008, before the stover harvest treatments were imposed, averaged 11.4 Mg ha-1. In 2009, 2010, and 2011 grain yields averaged 10.1, 9.7, and 9.5 Mg ha-1, respectively. Although grain yields after stover harvest strategies imposed were lower than in 2008, there were no significant differences among the treatments. Four-year average stover collection rates ranged 1.0 to 5.2 Mg ha-1 which was 12 to 60% of the above-ground biomass. Soc showed a slight decrease during the study, but the change was not related to any specific stover harvest treatment. Instead, we attribute the Soc decline to the tillage intensity and lower than expected crop yields. Overall, these results are consistent with other Midwestern USA studies that indicate corn stover should not be harvested if average grain yields are less than 11 Mg ha-1

Using a water-food-energy nexus approach for optimal irrigation management during drought events in Nebraska

Science.gov (United States)

Campana, P. E.; Zhang, J.; Yao, T.; Melton, F. S.; Yan, J.

2017-12-01

Climate change and drought have severe impacts on the agricultural sector affecting crop yields, water availability, and energy consumption for irrigation. Monitoring, assessing and mitigating the effects of climate change and drought on the agricultural and energy sectors are fundamental challenges that require investigation for water, food, and energy security issues. Using an integrated water-food-energy nexus approach, this study is developing a comprehensive drought management system through integration of real-time drought monitoring with real-time irrigation management. The spatially explicit model developed, GIS-OptiCE, can be used for simulation, multi-criteria optimization and generation of forecasts to support irrigation management. To demonstrate the value of the approach, the model has been applied to one major corn region in Nebraska to study the effects of the 2012 drought on crop yield and irrigation water/energy requirements as compared to a wet year such as 2009. The water-food-energy interrelationships evaluated show that significant water volumes and energy are required to halt the negative effects of drought on the crop yield. The multi-criteria optimization problem applied in this study indicates that the optimal solutions of irrigation do not necessarily correspond to those that would produce the maximum crop yields, depending on both water and economic constraints. In particular, crop pricing forecasts are extremely important to define the optimal irrigation management strategy. The model developed shows great potential in precision agriculture by providing near real-time data products including information on evapotranspiration, irrigation volumes, energy requirements, predicted crop growth, and nutrient requirements.

Direct measures of mechanical energy for knife mill size reduction of switchgrass, wheat straw, and corn stover.

Science.gov (United States)

Bitra, Venkata S P; Womac, Alvin R; Igathinathane, C; Miu, Petre I; Yang, Yuechuan T; Smith, David R; Chevanan, Nehru; Sokhansanj, Shahab

2009-12-01

Lengthy straw/stalk of biomass may not be directly fed into grinders such as hammer mills and disc refiners. Hence, biomass needs to be preprocessed using coarse grinders like a knife mill to allow for efficient feeding in refiner mills without bridging and choking. Size reduction mechanical energy was directly measured for switchgrass (Panicum virgatum L.), wheat straw (Triticum aestivum L.), and corn stover (Zea mays L.) in an instrumented knife mill. Direct power inputs were determined for different knife mill screen openings from 12.7 to 50.8 mm, rotor speeds between 250 and 500 rpm, and mass feed rates from 1 to 11 kg/min. Overall accuracy of power measurement was calculated to be +/-0.003 kW. Total specific energy (kWh/Mg) was defined as size reduction energy to operate mill with biomass. Effective specific energy was defined as the energy that can be assumed to reach the biomass. The difference is parasitic or no-load energy of mill. Total specific energy for switchgrass, wheat straw, and corn stover chopping increased with knife mill speed, whereas, effective specific energy decreased marginally for switchgrass and increased for wheat straw and corn stover. Total and effective specific energy decreased with an increase in screen size for all the crops studied. Total specific energy decreased with increase in mass feed rate, but effective specific energy increased for switchgrass and wheat straw, and decreased for corn stover at increased feed rate. For knife mill screen size of 25.4 mm and optimum speed of 250 rpm, optimum feed rates were 7.6, 5.8, and 4.5 kg/min for switchgrass, wheat straw, and corn stover, respectively, and the corresponding total specific energies were 7.57, 10.53, and 8.87 kWh/Mg and effective specific energies were 1.27, 1.50, and 0.24 kWh/Mg for switchgrass, wheat straw, and corn stover, respectively. Energy utilization ratios were calculated as 16.8%, 14.3%, and 2.8% for switchgrass, wheat straw, and corn stover, respectively. These

Chemical composition of the volatile extract and antioxidant activities of the volatile and nonvolatile extracts of Egyptian corn silk (Zea mays L.).

Science.gov (United States)

El-Ghorab, Ahmed; El-Massry, Khaled F; Shibamoto, Takayuki

2007-10-31

A total of 36 compounds, which comprised 99.4% of the extract, were identified by gas chromatography and mass spectrometry (GC-MS) in the volatile dichloromethane extract obtained from Egyptian corn silk. The main constituents of the volatile extract were cis-alpha-terpineol (24.22%), 6,11-oxidoacor-4-ene (18.06%), citronellol (16.18%), trans-pinocamphone (5.86%), eugenol (4.37%), neo-iso-3-thujanol (2.59%), and cis-sabinene hydrate (2.28%). Dried Egyptian corn silk was also directly extracted with petroleum ether, ethanol, and water. All extracts from solvent extraction and the volatile extract described above exhibited clear antioxidant activities at levels of 50-400 microg/mL in the 2,2-diphenyl-1-picrylhydrazyl (DPPH)/linoleic acid assay. The ethanol extract inhibited DPPH activity by 84% at a level of 400 microg/mL. All samples tested via the beta-carotene bleaching assay also exhibited satisfactory antioxidant activity with clear dose responses. This study indicates that corn silk could be used to produce novel natural antioxidants as well as a flavoring agent in various food products.

Análises físicas, composição centesimal e nutricional de minimilho (Zea mays, L. orgânico de diferentes variedades

Directory of Open Access Journals (Sweden)

A. S. O. D. Lima

2015-12-01

Full Text Available Atualmente os produtos orgânicos vêm roubando a cena dos produtos tradicionais, por serem saudáveis, livres de agrotóxicos e por gerarem menor impacto no meio ambiente. O minimilho (Zea mays, L. também conhecido como “babycorn”, uma espiga imatura ainda não fertilizada (espiguetas, é uma hortaliça, produto considerado fino que vem ganhando importância no mercado de conservas no Brasil. Esta pesquisa se propôs avaliar a qualidade de minimilho orgânico in natura de diferentes variedades e determinar a composição centesimal e nutricional.Utilizou-se como metodologias analíticas as determinações de rendimento, peso médio, diâmetro e comprimento das espiguetas, além de pH, sólidos solúveis, acidez  titulável, umidade, cinzas, lipídeos,  proteínas, carboidratos e valor energético total. Com os resultados obtidos concluiu-se que as variedades que apresentaram maior rendimento foram Pipoca (48,75%, Eldorado (42,06%e Branco (40,50%, sendo mais recomendadas para o beneficiamento e que o minimilho se trata de um produto de baixo valor calórico, podendo ser indicado em dietas hipocalóricas.Physical analysis, and nutritional composition centesimal babycorn (Zea mays, L. organic variety of differentAbstract: Currently organic products come stealing the show from traditional products to be healthy, free of pesticides and generate less impact on the environment. The lithe corn (Zea mays L. also known as " babycorn " an immature ear is not fertilized  (spikelets, is a vegetable , thin product concerned that has gained importance in the market preserved in Brazil. This research aims to evaluate the quality of organic fresh baby corn in different varieties and determine the composition and nutritional. Used as analytical methodologies determinations yield , average weight , diameter and length of the spikelets , and pH , soluble solids , titratable acidity, moisture, ash , lipids , proteins , carbohydrates and total energetic

Optimized Subsurface Irrigation System: The Future of Sugarcane Irrigation

Directory of Open Access Journals (Sweden)

M. H. J. P. Gunarathna

2018-03-01

Full Text Available Climate change may harm the growth and yield of sugarcane (Saccharum officinarum L. without the introduction of appropriate irrigation facilities. Therefore, new irrigation methods should be developed to maximize water use efficiency and reduce operational costs. OPSIS (optimized subsurface irrigation system is a new solar-powered automatic subsurface irrigation system that creates a phreatic zone below crop roots and relies on capillarity to supply water to the root zone. It is designed for upland crops such as sugarcane. We investigated the performance of OPSIS for irrigating sugarcane and evaluated its performance against sprinkler irrigation under subtropical conditions. We conducted field experiments in Okinawa, Japan, over the period from 2013 to 2016 and took measurements during spring- and summer-planted main crops and two ratoon crops of the spring-planted crop. Compared with sprinkler irrigation, OPSIS produced a significantly higher fresh cane yield, consumed less irrigation water and provided a higher irrigation water use efficiency. We conclude that OPSIS could be adopted as a sustainable solution to sugarcane irrigation in Okinawa and similar environments.

Updates to the Corn Ethanol Pathway and Development of an Integrated Corn and Corn Stover Ethanol Pathway in the GREET™ Model

Energy Technology Data Exchange (ETDEWEB)

Wang, Zhichao [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Dunn, Jennifer B. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Wang, Michael Q. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division

2014-09-01

Corn ethanol, a first-generation biofuel, is the predominant biofuel in the United States. In 2013, the total U.S. ethanol fuel production was 13.3 billion gallons, over 95% of which was produced from corn (RFA, 2014). The 2013 total renewable fuel mandate was 16.6 billion gallons according to the Energy Independence and Security Act (EISA) (U.S. Congress, 2007). Furthermore, until 2020, corn ethanol will make up a large portion of the renewable fuel volume mandated by Renewable Fuels Standard (RFS2). For the GREET1_2014 release, the corn ethanol pathway was subject to updates reflecting changes in corn agriculture and at corn ethanol plants. In the latter case, we especially focused on the incorporation of corn oil as a corn ethanol plant co-product. Section 2 covers these updates. In addition, GREET now includes options to integrate corn grain and corn stover ethanol production on the field and at the biorefinery. These changes are the focus of Section 3.

Corn

OpenAIRE

Sherwood, Brianne; Hawks, Amanda

2011-01-01

We have so much corn right now it's coming out of our ears (great pun, right?). And it's SO incredibly cheap! This is probably because the US produces 42% of the world's corn! Most of it is used for animal feed, but other uses include exporting to other countries, human food, seed, and industrial uses such as ethanol production. Because there is so much corn available here in the U.S. You can find it in a lot more foods than you think. It's in peanut butter, snack foods, soft drinks, multivit...

A new mutant gene su-1 in corn obtained by irradiation with low doses of gamma rays

International Nuclear Information System (INIS)

Diaconu, P.

1993-01-01

This paper provides a description of a sugar corn mutant obtained by irradiation of wetted kernels of Romanesc de Studina variety with low doses of gamma rays (300 R). This mutant influences the structure of the endosperm similarly to the su-1 genes developed spontaneously which resulted in the corn variety Zea mays saccharata thousands of years ago. Although the mutant is a multiple allele of the su-1 locus in chromosome IV it differs widely from the spontaneous mutant. The length of the ears is much reduced, varying between 4 and 6 cm, with numbers of kernels per ear varying between 45 and 72. Attempts to improve the cob size and the number of kernels by breeding and propagation in an insulated area led to no result. Crossing the mutants with the sugar hybrid Delicious resulted in sugar type progeny which confirms the common position of the mutant gene induced by irradiation and the spontaneous su-1 gene. The progenies of sugar mutant x Delicious are 38-43 % lower in cob vigor and 36-46% lower in kernel number. (author). 2 figs, 2 tab., 16 refs

Exploring of Agro Waste (Pineapple Leaf, Corn Stalk, and Napier Grass by Chemical Composition and Morphological Study

Directory of Open Access Journals (Sweden)

Angzzas Sari Mohd Kassim

2013-12-01

Full Text Available Malaysia is a country that is a rich source of agricultural waste material. Three different crops were studied here, including pineapple (Ananas comosus leaf, corn (Zea mays stalk, and Napier grass (Pennisetum purpureum. These crops are characterized as agricultural waste materials in Malaysia and have a high potential to be used as alternative fibers for the paper making industry. The objective of this work was to analyze the chemical composition of pineapple leaf, corn stalk, and Napier grass and to investigate the fiber morphology of these crops. The chemical components analyzed include the following: cellulose (Kurshner-Hoffner method, holocellulose (chlorination method, hemicellulose (chlorination method, ash content (TAPPI method T211-om-93, lignin content (TAPPI method T222-om-98, and soluble sodium hydroxide (TAPPI method T203-om-98. All handsheets morphologies were observed using scanning electron microscopy (SEM. Results indicated each crop has the potential for use as a fiber in paper making. SEM images indicated a condensed composition of the fiber structure. The observed chemical composition and morphology of these three crops indicate their suitability for use as fiber sources for the paper industry.

Advances in Fluorescence Sensing Systems for the Remote Assessment of Nitrogen Supply in Field Corn

Science.gov (United States)

Corp, L. A.; Chappelle, E. W.; McMurtrey, J. E.; Daughtry, C. S. T.; Kim, M. S.

2000-01-01

The studies described herein were conducted to better define changes in fluorescence properties of leaves from field grown corn (Zea mays L.) as they relate to varying levels of nitrogen (N) fertilization. This research was directed toward: 1) providing a remote non-destructive sensing technique to aid in the determination of optimal rates of N fertilization in corn crops and, 2) defining parameters for further development of fluorescence instrumentation to be operated remotely at field canopy levels. Fluorescence imaging bands centered in the blue (450 nm), green (525 nm), red (680 nm), and far-red (740 nm) and ratios of these bands were compared with the following plant parameters: rates of photosynthesis, N:C ratio, pigment concentrations, and grain yields. Both the fluorescence and physiological measures exhibited similar curvilinear responses to N fertilization level while significant linear correlations were obtained among fluorescence bands and band ratios to certain physiological measures of plant productivity. The red / blue, red / green, far-red / blue, far-red /green fluorescence ratios are well suited for remote observation and provided high correlations to grain yield, LAI, N:C, and chlorophyll contents. The results from this investigation indicate that fluorescence technology could aid in the determination of N fertilization requirements for corn. This discussion will also address design concepts and preliminary field trials of a mobile field-based Laser Induced Fluorescence Imaging System (LIFIS) capable of simultaneously acquiring images of four fluorescence emission bands from areas of plant canopies equaling 1 sq m and greater without interference of ambient solar radiation.

Induced cytomictic diversity in maize (Zea mays L.) inbred.

Science.gov (United States)

Rai, Prashant Kumar; Kumar, Girjesh; Tripathi, Avinash

2010-01-01

Mutation breeding has been used for improving oligogenic and polygenic characters, disease resistance and quantitative characters including yielding ability. The cytological stability of maize inbred lines is an important consideration in view of their extensive use in genetics and plant breeding research. Investigation in Zea mays L. confirms that the migration of chromosomes is a real event that cannot be misunderstood as an artifact produced by fixation or mechanical injuries. During present investigation, we found that out of six inbred lines of Zea mays L. viz. CM-135, CM-136, CM-137, CM-138, CM-142 and CM-213 at various treatment doses of gamma irradiations viz. 200, 400 and 600 Gy, some of the plants of inbred line CM- 138 at 200 Gy dose displayed characteristic cytoplasmic connections during all the stages of meiosis. Four plants from this treatment set were found to be engaged in a rare phenomenon reported as "Cytomixis". It elucidates that in inbred of Zea mays L., induced cytomixis through gamma rays treatment may be considered to be a possible source of production of aneuploid and polyploid gametes. This phenomenon may have several applications in Zea mays L. improvement in the sense of diversity and ever yield potential.

Effects of Mineral Phosphorous Fertilization and cd Loading on cd Translocation from Soil to Corn (Zea mays L.)

Science.gov (United States)

László, Márton, ,, Dr.

2010-05-01

been identified as hazardous (H) waste (W) sites (S)(HWS) because of the presence of elevated concentrations of these elements. They will remain a threat to the environment until they are removed or immobilized. We can test and improve these situation by using different plant species, as corn (Zea mays L.) x macro nutrients as phosphorous experimental methods. Maize has a very great biomass (B) production (P) potential (P)(BPP) and important role in soil fertility by the design of plant rotation to field plant production, the animal foraging as a fodder-crop with a high carbohydrate (70%) and protein (10%) content (70%) and via pytoremediation possibilities. Cd is considered to be a nonessential element for maize, it is effectively absorbed by both the root and leaf system. By these ways a great proportion of the cadmium is to be accumulated in root tissues, even when Cd enters the plant via foliar system from the polluted air and precipitation. The most chief geobiochemical property of cadmium ions is their strong affinity for sulfhydryl groups of several compounds (OSHA 1992; Richardson 1992; RAIS 1991; Sittig 1991; TAP 1999; WA 1996; WHO 1992, 2001). Furthermore Cd shows an affinity for other side chains of protein and for phosphate groups too. The Cd content of maize is of the highest concern as a Cd reservoir and as the patway of cadmium to soil-plant-animal-man chain (FOOD CHAIN). Thus, tolerance and adaptation of corn to higher Cd levels, although important from the environmental poin of view, create a helth risc. Material and Method The phosphorus (P2O5) mineral fertilization and cadmium loading effects were studied in a long-term field experiment set up at Experimental Station of the Research Institute for Soil Science and Agricultural Chemistry of the Hungarian Academy of Sciences on a calcareous chernozem soil at Nagyhörcsök in 1977. The soil had the following agrogeochemical characteristics: pH (KCl) 7.3, humus 3.0%, ammonlactate (AL) soluble-P2O5 60